[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for spne4:ACF55177.1

[Show Plain Result]


## Summary of Sequence Search
    1::141
 2308::2432    2e-08  34% 2710 aa  TOXA_CLODI RecName: Full=Toxin A;
  198::258     8e-05  40%  318 aa  ALYS_BPHB3 RecName: Full=Lytic amidase;       
  198::258     2e-04  40%  318 aa  ALYS_STRPN RecName: Full=Autolysin;         EC=3.5.1.28;AltName:
  198::234     5e-04  46%  339 aa  LYS_BPCP9 RecName: Full=Lysozyme;         EC=3.2.1.17;AltName:
  198::234     5e-04  46%  339 aa  LYS_BPCP1 RecName: Full=Lysozyme;         EC=3.2.1.17;AltName:
  154::187     7e-04  53% 1365 aa  GTFS_STRDO RecName: Full=Glucosyltransferase-S;       
    1::141

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxFFGLLGTSTVFADDSEGWQFVQENGRTYYKKGDLKETYWRVIDGKYYYFDPLSGE
TOXA_CLODI      ---------------FLTLNGKKYYFDNDSKGWQTI--DGKKYYFNLNTAETGWQTIDGKKYYFNLNTAE
ALYS_BPHB3      ---------------------------------KFEKINGTWYYFDGSLSDRWKKHTDGNWYYFDQ-SGE
ALYS_STRPN      ---------------------------------KFEKINGTWYYSSGYMLADRWRKTDGNWYWFDN-SGE
LYS_BPCP9       ---------------------TAGTWKQDSKGWWFRRNNGSFPYNK-------WEKIGGVWYYFD-----
LYS_BPCP1       ---------------------TAGTWKQDSKGWWFRRNNGSFPYNK-------WEKIGGVWYYFD-----
GTFS_STRDO      --------------------------------------DGKTYYANGQRLKNYSMVIDGKTYYFDGQTGE


                         .         .         *         .         .         .         .:140
query           MVVGWQYIPAPHKGVTIGPSPRIEISLRPDWFYFGQDGVLQEFVGKQVLEAKTATNTNKHHGExxxxxxx
TOXA_CLODI      AATGWQTIDGKYFNTNTFIASTGYTSINGKHFYFNTDGIMQVFKGPNGFEYFAPANTDANNIE-------
ALYS_BPHB3      MATGWK-------------------KIADKWYYFDVEGAMK-----------------------------
ALYS_STRPN      MATGWK-------------------KIADKWYYFNEEGAMK-----------------------------
LYS_BPCP9       ----------------------------------------------------------------------
LYS_BPCP1       ----------------------------------------------------------------------
GTFS_STRDO      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           x
TOXA_CLODI      -
ALYS_BPHB3      -
ALYS_STRPN      -
LYS_BPCP9       -
LYS_BPCP1       -
GTFS_STRDO      -