[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for spne4:ACF55228.1

[Show Plain Result]


## Summary of Sequence Search
    1::230
    1::233     5e-54  46%  233 aa  MTNN_LISW6 RecName:
    1::233     7e-54  46%  233 aa  MTNN_LISMO RecName:
    1::233     7e-54  46%  233 aa  MTNN_LISMF RecName:
    1::233     2e-53  45%  233 aa  MTNN_LISMC RecName:
    1::233     2e-53  45%  233 aa  MTNN_LISMH RecName:
    1::233     6e-52  44%  233 aa  MTNN_LISIN RecName:
    1::230     3e-51  42%  230 aa  MTNN_SHEWM RecName:
    1::230     3e-51  41%  232 aa  MTNN_ENTS8 RecName:
    1::230     5e-51  42%  230 aa  MTNN_SHESH RecName:
    1::231     2e-50  42%  236 aa  MTNN_SHESA RecName:
    1::230     3e-50  45%  230 aa  MTNN_AERHH RecName:
    1::230     4e-50  41%  230 aa  MTNN_SHEDO RecName:
    1::231     5e-50  42%  236 aa  MTNN_SHESR RecName:
    1::231     6e-50  42%  236 aa  MTNN_SHESM RecName:
    1::230     1e-49  40%  230 aa  MTNN_SHELP RecName:
    1::229     2e-49  43%  229 aa  MTNN_HAES2 RecName:
    1::231     2e-49  42%  236 aa  MTNN_SHEB8 RecName:
    1::231     2e-49  42%  236 aa  MTNN_SHEB5 RecName:
    1::231     3e-49  42%  236 aa  MTNN_SHEB9 RecName:
    1::231     3e-49  42%  236 aa  MTNN_SHEB2 RecName:
    1::230     3e-49  42%  231 aa  MTNN_ALISL RecName:
    1::230     4e-49  42%  231 aa  MTNN_SHESW RecName:
    1::230     4e-49  42%  231 aa  MTNN_SHEPC RecName:
    1::229     4e-49  41%  232 aa  MTNN_ESCF3 RecName:
    1::230     5e-49  41%  230 aa  MTNN_SHEFN RecName:
    1::229     7e-49  41%  229 aa  MTNN_OCEIH RecName:
    1::229     1e-48  41%  232 aa  MTNN_SALTY RecName:
    1::229     1e-48  41%  232 aa  MTNN_SALTI RecName:
    1::229     1e-48  41%  232 aa  MTNN_SALSV RecName:
    1::229     1e-48  41%  232 aa  MTNN_SALPK RecName:
    1::229     1e-48  41%  232 aa  MTNN_SALPC RecName:
    1::229     1e-48  41%  232 aa  MTNN_SALPB RecName:
    1::229     1e-48  41%  232 aa  MTNN_SALDC RecName:
    1::229     1e-48  41%  232 aa  MTNN_SALCH RecName:
    1::229     1e-48  41%  232 aa  MTNN_SALA4 RecName:
    1::229     2e-48  42%  229 aa  MTNN_HAES1 RecName:
    1::231     3e-48  40%  236 aa  MTNN_SHEON RecName:
    1::229     4e-48  40%  232 aa  MTNN_SALNS RecName:
    1::229     4e-48  40%  232 aa  MTNN_SALHS RecName:
    1::229     4e-48  40%  232 aa  MTNN_SALG2 RecName:
    1::229     4e-48  40%  232 aa  MTNN_SALEP RecName:
    1::230     6e-48  42%  231 aa  MTNN_VIBFM RecName:
    1::230     6e-48  42%  231 aa  MTNN_VIBF1 RecName:
    1::230     7e-48  42%  231 aa  MTNN_VIBFI RecName:
    1::230     7e-48  43%  230 aa  MTNN_AERS4 RecName:
    1::230     1e-47  43%  231 aa  MTNN_VIBVY RecName:
    1::230     1e-47  43%  231 aa  MTNN_VIBVU RecName:
    2::228     1e-47  42%  228 aa  MTNN_STAHJ RecName:
    1::230     1e-47  41%  230 aa  MTNN_SHEHH RecName:
    1::230     1e-47  45%  230 aa  MTNN_LYSSC RecName:
    1::229     1e-47  40%  232 aa  MTNN_KLEP7 RecName:
    2::228     2e-47  42%  228 aa  MTNN_STAAB RecName:
    1::230     2e-47  41%  230 aa  MTNN_SHEPA RecName:
    1::229     2e-47  41%  233 aa  MTNN_YERPY RecName:
    1::229     2e-47  41%  233 aa  MTNN_YERPS RecName:
    1::229     2e-47  41%  233 aa  MTNN_YERPB RecName:
    1::229     2e-47  41%  233 aa  MTNN_YERP3 RecName:
    1::228     2e-47  43%  231 aa  MTNN_VIBHB RecName:
    1::230     2e-47  43%  231 aa  MTNN_VIBCM RecName:
    1::230     2e-47  43%  231 aa  MTNN_VIBCH RecName:
    1::230     2e-47  43%  231 aa  MTNN_VIBC3 RecName:
    2::228     3e-47  41%  228 aa  MTNN_STAAW RecName:
    2::228     3e-47  41%  228 aa  MTNN_STAAT RecName:
    2::228     3e-47  41%  228 aa  MTNN_STAAS RecName:
    2::228     3e-47  41%  228 aa  MTNN_STAAN RecName:
    2::228     3e-47  41%  228 aa  MTNN_STAAM RecName:
    2::228     3e-47  41%  228 aa  MTNN_STAAE RecName:
    2::228     3e-47  41%  228 aa  MTNN_STAAC RecName:
    2::228     3e-47  41%  228 aa  MTNN_STAA9 RecName:
    2::228     3e-47  41%  228 aa  MTNN_STAA8 RecName:
    2::228     3e-47  41%  228 aa  MTNN_STAA3 RecName:
    2::228     3e-47  41%  228 aa  MTNN_STAA2 RecName:
    2::228     3e-47  41%  228 aa  MTNN_STAA1 RecName:
    2::228     4e-47  41%  228 aa  MTNN_STAAR RecName:
    1::229     4e-47  41%  232 aa  MTNN_ERWCT RecName:
    1::229     4e-47  39%  232 aa  MTNN_CITK8 RecName:
    1::229     6e-47  40%  232 aa  MTNN_KLEP3 RecName:
    1::231     6e-47  41%  232 aa  MTNN_ANOFW RecName:
    1::229     8e-47  40%  233 aa  MTNN_YERPP RecName:
    1::229     8e-47  40%  233 aa  MTNN_YERPN RecName:
    1::229     8e-47  40%  233 aa  MTNN_YERPG RecName:
    1::229     8e-47  40%  233 aa  MTNN_YERPE RecName:
    1::229     8e-47  40%  233 aa  MTNN_YERPA RecName:
    1::229     8e-47  41%  233 aa  MTNN_YERE8 RecName:
    1::231     8e-47  41%  233 aa  MTNN_EXISA RecName:
    1::229     1e-46  39%  232 aa  MTNN_SALAR RecName:
    1::229     1e-46  40%  232 aa  MTNN_PECCP RecName:
    1::229     1e-46  39%  232 aa  MTNN_ENT38 RecName:
    1::230     2e-46  40%  230 aa  MTNN_SHEAM RecName:
    1::230     2e-46  40%  230 aa  MTNN_ACTSZ RecName:
    1::229     3e-46  41%  233 aa  MTNN_SODGM RecName:
    1::229     4e-46  41%  229 aa  MTNN_PASMU RecName:
    1::230     5e-46  42%  235 aa  MTNN_PSEHT RecName:
    1::229     7e-46  40%  232 aa  MTNN_SALPA RecName:
    1::229     1e-45  41%  235 aa  MTNN_PROMH RecName:
    1::229     1e-45  38%  232 aa  MTNN_ERWT9 RecName:
    1::228     2e-45  42%  231 aa  MTNN_VIBPA RecName:
    1::229     2e-45  42%  229 aa  MTNN_HAEIE RecName:
    1::230     3e-45  41%  231 aa  MTNN_VIBSL RecName:
    1::230     3e-45  42%  232 aa  MTNN_GEOSW RecName:
    1::235     3e-45  41%  243 aa  MTNN_COLP3 RecName:
    1::229     4e-45  39%  233 aa  MTNN_PHOLL RecName:
    1::230     4e-45  39%  234 aa  MTNN_EXIS2 RecName:
    1::230     6e-45  40%  235 aa  MTNN_GEOKA RecName:
    1::227     1e-44  41%  236 aa  MTNN_GEOTN RecName:
    1::229     1e-44  41%  229 aa  MTNN_HAEIN RecName:
    1::229     2e-44  41%  229 aa  MTNN_HAEIG RecName:
    1::229     2e-44  40%  230 aa  MTNN_HAEI8 RecName:
    1::229     2e-44  40%  232 aa  MTNN_EDWI9 RecName:
    1::230     3e-44  41%  230 aa  MTNN_SHEPW RecName:
    1::229     4e-44  38%  232 aa  MTNN_SHISS RecName:
    1::229     4e-44  38%  232 aa  MTNN_SHIFL RecName:
    1::229     4e-44  38%  232 aa  MTNN_SHIF8 RecName:
    1::229     4e-44  38%  232 aa  MTNN_SHIDS RecName:
    1::229     4e-44  38%  232 aa  MTNN_SHIB3 RecName:
    1::229     4e-44  38%  232 aa  MTNN_ECOUT RecName:
    1::229     4e-44  38%  232 aa  MTNN_ECOSM RecName:
    1::229     4e-44  38%  232 aa  MTNN_ECOSE RecName:
    1::229     4e-44  38%  232 aa  MTNN_ECOLU RecName:
    1::229     4e-44  38%  232 aa  MTNN_ECOLI RecName:
    1::229     4e-44  38%  232 aa  MTNN_ECOLC RecName:
    1::229     4e-44  38%  232 aa  MTNN_ECOL6 RecName:
    1::229     4e-44  38%  232 aa  MTNN_ECOL5 RecName:
    1::229     4e-44  38%  232 aa  MTNN_ECOK1 RecName:
    1::229     4e-44  38%  232 aa  MTNN_ECODH RecName:
    1::229     4e-44  38%  232 aa  MTNN_ECOBW RecName:
    1::229     4e-44  38%  232 aa  MTNN_ECO8A RecName:
    1::229     4e-44  38%  232 aa  MTNN_ECO81 RecName:
    1::229     4e-44  38%  232 aa  MTNN_ECO7I RecName:
    1::229     4e-44  38%  232 aa  MTNN_ECO5E RecName:
    1::229     4e-44  38%  232 aa  MTNN_ECO57 RecName:
    1::229     4e-44  38%  232 aa  MTNN_ECO55 RecName:
    1::229     4e-44  38%  232 aa  MTNN_ECO45 RecName:
    1::229     4e-44  38%  232 aa  MTNN_ECO27 RecName:
    1::229     4e-44  38%  232 aa  MTNN_ECO24 RecName:
    1::229     5e-44  38%  232 aa  MTNN_SHIBS RecName:
    2::213     2e-43  39%  228 aa  MTNN_STAES RecName:
    2::213     2e-43  39%  228 aa  MTNN_STAEQ RecName:
   32::228     2e-43  43%  228 aa  MTNN_STACT RecName:
    1::229     2e-43  38%  232 aa  MTNN_ECOHS RecName:
    1::230     2e-43  41%  231 aa  MTNN_BACCN RecName:
    1::231     4e-43  42%  232 aa  MTNN_PHOPR RecName:
    1::230     7e-43  41%  231 aa  MTNN_BACWK RecName:
    1::229     9e-43  39%  233 aa  MTNN_SERP5 RecName:
    1::230     9e-43  41%  231 aa  MTNN_BACCZ RecName:
    1::230     9e-43  41%  231 aa  MTNN_BACCR RecName:
    1::230     9e-43  41%  231 aa  MTNN_BACC7 RecName:
    1::230     9e-43  41%  231 aa  MTNN_BACC4 RecName:
    1::230     9e-43  41%  231 aa  MTNN_BACC3 RecName:
    1::230     9e-43  41%  231 aa  MTNN_BACC1 RecName:
    1::230     9e-43  41%  231 aa  MTNN_BACC0 RecName:
    1::230     9e-43  41%  231 aa  MTNN_BACAN RecName:
    1::230     9e-43  41%  231 aa  MTNN_BACAH RecName:
    1::230     9e-43  41%  231 aa  MTNN_BACAC RecName:
    1::230     9e-43  41%  231 aa  MTNN_BACAA RecName:
    1::230     1e-42  41%  231 aa  MTNN_BACHK RecName:
    1::230     1e-42  41%  231 aa  MTNN_BACC2 RecName:
    1::229     4e-42  40%  229 aa  MTNN_MANSM RecName:
    1::230     5e-42  40%  230 aa  MTNN_TOLAT RecName:
    1::231     6e-42  40%  231 aa  MTNN_BACLD RecName:
    1::228     8e-42  41%  231 aa  MTNN_BACP2 RecName:
    1::229     1e-41  39%  237 aa  MTNN_HAMD5 RecName:
    1::226     7e-41  38%  230 aa  MTNN_HAEPS RecName:
    3::230     9e-41  38%  231 aa  MTNN_BACHD RecName:
    1::230     6e-40  38%  231 aa  MTNN_BACSU RecName:
    1::230     1e-39  38%  231 aa  MTNN_BACA2 RecName:
    1::230     1e-39  37%  232 aa  MTNN_THICR RecName:
    2::228     1e-39  40%  228 aa  MTNN_STAS1 RecName:
    1::230     1e-38  38%  234 aa  MTNN_DESPS RecName:
    1::231     2e-38  38%  231 aa  MTNN_DESAD RecName:
    4::229     5e-38  38%  231 aa  MTNN_MARMS RecName:
    1::229     5e-38  36%  231 aa  MTNN_BACSK RecName:
    3::228     8e-37  38%  232 aa  MTNN_ACTP7 RecName:
    3::228     8e-37  38%  232 aa  MTNN_ACTP2 RecName:
    1::211     8e-36  36%  232 aa  MTNN_BUCAI RecName:
    3::228     8e-36  37%  232 aa  MTNN_ACTPJ RecName:
    1::211     1e-35  36%  232 aa  MTNN_BUCAT RecName:
    1::211     1e-35  36%  232 aa  MTNN_BUCA5 RecName:
    3::231     2e-35  38%  235 aa  MTNN_CHRSD RecName:
    1::229     3e-34  33%  229 aa  MTNN_BAUCH RecName:
    3::228     4e-34  37%  232 aa  MTNN_HAEDU RecName:
    1::220     8e-34  36%  231 aa  MTNN_PSYIN RecName:
    4::227     5e-31  33%  231 aa  MTNN_HELPY RecName: Full=MTA/SAH nucleosidase;       
    3::230     7e-30  31%  230 aa  MTNN_HELPJ RecName: Full=MTA/SAH nucleosidase;       
    1::174     2e-27  36%  235 aa  MTNN_BUCAP RecName:
   10::175     3e-25  34%  252 aa  MTNN_BUCBP RecName:
    5::236     8e-23  32%  255 aa  MTNN_MYCTU RecName: Full=MTA/SAH nucleosidase;       
    5::236     8e-23  32%  255 aa  MTNN_MYCBO RecName: Full=MTA/SAH nucleosidase;       
    1::226     1e-19  33%  269 aa  MTNN_TREPA RecName: Full=MTA/SAH nucleosidase;       
   22::181     4e-08  32%  238 aa  DEOD_LACCB RecName: Full=Purine nucleoside phosphorylase deoD-type;
   22::181     4e-08  32%  238 aa  DEOD_LACC3 RecName: Full=Purine nucleoside phosphorylase deoD-type;
    4::213     3e-07  26%  217 aa  MTNN_THEMA RecName: Full=MTA/SAH nucleosidase;       
   42::167     6e-07  23%  515 aa  FIB_SPICI RecName: Full=Fibril protein;
   48::206     1e-06  26%  237 aa  DEOD_STRSY RecName: Full=Purine nucleoside phosphorylase deoD-type;
   48::206     1e-06  26%  237 aa  DEOD_STRS2 RecName: Full=Purine nucleoside phosphorylase deoD-type;
   22::181     1e-06  29%  237 aa  DEOD_DICNV RecName: Full=Purine nucleoside phosphorylase deoD-type;
   23::106     2e-06  35%  241 aa  DEOD1_VIBCH RecName: Full=Purine nucleoside phosphorylase deoD-type
   49::204     2e-06  28%  232 aa  DEOD_BACLD RecName: Full=Purine nucleoside phosphorylase deoD-type;
   22::204     3e-06  26%  236 aa  DEOD_LACRJ RecName: Full=Purine nucleoside phosphorylase deoD-type;
   22::204     3e-06  26%  236 aa  DEOD_LACRD RecName: Full=Purine nucleoside phosphorylase deoD-type;
   42::204     3e-06  28%  234 aa  DEOD_ANOFW RecName: Full=Purine nucleoside phosphorylase deoD-type;
   31::183     4e-06  26%  238 aa  DEOD_MYCGE RecName: Full=Purine nucleoside phosphorylase deoD-type;
   42::204     4e-06  27%  234 aa  DEOD_BACST RecName: Full=Purine nucleoside phosphorylase deoD-type;
   34::217     2e-05  26%  239 aa  DEOD_PECCP RecName: Full=Purine nucleoside phosphorylase deoD-type;
   34::204     2e-05  28%  233 aa  DEOD_LISMO RecName: Full=Purine nucleoside phosphorylase deoD-type;
   34::204     2e-05  28%  233 aa  DEOD_LISMH RecName: Full=Purine nucleoside phosphorylase deoD-type;
   34::204     2e-05  28%  233 aa  DEOD_LISMF RecName: Full=Purine nucleoside phosphorylase deoD-type;
   34::204     2e-05  28%  233 aa  DEOD_LISMC RecName: Full=Purine nucleoside phosphorylase deoD-type;
   34::204     2e-05  28%  233 aa  DEOD_LISW6 RecName: Full=Purine nucleoside phosphorylase deoD-type;
   34::204     2e-05  28%  233 aa  DEOD_LISIN RecName: Full=Purine nucleoside phosphorylase deoD-type;
   34::217     2e-05  26%  239 aa  DEOD_ERWCT RecName: Full=Purine nucleoside phosphorylase deoD-type;
   59::132     2e-05  30%  312 aa  BSPB_POPDE RecName: Full=Bark storage protein B;Flags: Precursor;
   42::207     3e-05  26%  238 aa  DEOD_MYCPN RecName: Full=Purine nucleoside phosphorylase deoD-type;
   59::132     3e-05  30%  312 aa  BSPA_POPDE RecName: Full=Bark storage protein A;Flags: Precursor;
   49::204     3e-05  26%  232 aa  DEOD_BACA2 RecName: Full=Purine nucleoside phosphorylase deoD-type;
   34::106     3e-05  36%  238 aa  DEOD1_VIBF1 RecName: Full=Purine nucleoside phosphorylase deoD-type
   34::206     5e-05  25%  236 aa  DEOD_SHEDO RecName: Full=Purine nucleoside phosphorylase deoD-type;
   49::180     5e-05  27%  233 aa  DEOD_BACSU RecName: Full=Purine nucleoside phosphorylase deoD-type;
   36::206     6e-05  26%  238 aa  DEOD_XENNE RecName: Full=Purine nucleoside phosphorylase deoD-type;
   48::205     1e-04  33%  236 aa  DEOD_STRZP RecName: Full=Purine nucleoside phosphorylase deoD-type;
   48::205     1e-04  33%  236 aa  DEOD_STRZJ RecName: Full=Purine nucleoside phosphorylase deoD-type;
   48::205     1e-04  33%  236 aa  DEOD_STRPJ RecName: Full=Purine nucleoside phosphorylase deoD-type;
   48::205     1e-04  33%  236 aa  DEOD_STRP7 RecName: Full=Purine nucleoside phosphorylase deoD-type;
   48::205     1e-04  33%  236 aa  DEOD_STRP4 RecName: Full=Purine nucleoside phosphorylase deoD-type;
   48::205     1e-04  33%  236 aa  DEOD_STRP2 RecName: Full=Purine nucleoside phosphorylase deoD-type;
   42::206     1e-04  26%  235 aa  DEOD_OCEIH RecName: Full=Purine nucleoside phosphorylase deoD-type;
   36::111     1e-04  32%  234 aa  DEOD_LACLS RecName: Full=Purine nucleoside phosphorylase deoD-type;
   36::111     1e-04  32%  234 aa  DEOD_LACLM RecName: Full=Purine nucleoside phosphorylase deoD-type;
   36::111     1e-04  32%  234 aa  DEOD_LACLA RecName: Full=Purine nucleoside phosphorylase deoD-type;
   62::170     1e-04  27%  253 aa  UDP_KLEAE RecName: Full=Uridine phosphorylase;       
   48::207     2e-04  28%  237 aa  DEOD_STRPF RecName: Full=Purine nucleoside phosphorylase deoD-type;
   33::225     2e-04  26%  238 aa  DEOD_HAES1 RecName: Full=Purine nucleoside phosphorylase deoD-type;
   43::206     2e-04  26%  239 aa  DEOD_KLEP3 RecName: Full=Purine nucleoside phosphorylase deoD-type;
   42::106     2e-04  31%  235 aa  DEOD_GEOSW RecName: Full=Purine nucleoside phosphorylase deoD-type;
   48::205     3e-04  33%  236 aa  DEOD_STRPI RecName: Full=Purine nucleoside phosphorylase deoD-type;
   48::205     3e-04  32%  237 aa  DEOD_STRGC RecName: Full=Purine nucleoside phosphorylase deoD-type;
   36::206     3e-04  25%  239 aa  DEOD_ERWT9 RecName: Full=Purine nucleoside phosphorylase deoD-type;
   42::106     3e-04  32%  234 aa  DEOD_DINSH RecName: Full=Purine nucleoside phosphorylase deoD-type;
   42::205     3e-04  27%  235 aa  DEOD_CLOP1 RecName: Full=Purine nucleoside phosphorylase deoD-type;
   49::106     3e-04  36%  239 aa  DEOD1_VIBPA RecName: Full=Purine nucleoside phosphorylase deoD-type
   62::170     4e-04  27%  253 aa  UDP_ECOLI RecName: Full=Uridine phosphorylase;       
   48::205     4e-04  33%  236 aa  DEOD_STRZT RecName: Full=Purine nucleoside phosphorylase deoD-type;
   48::205     4e-04  33%  236 aa  DEOD_STRPS RecName: Full=Purine nucleoside phosphorylase deoD-type;
   48::207     4e-04  23%  237 aa  DEOD_STRPG RecName: Full=Purine nucleoside phosphorylase deoD-type;
   33::105     4e-04  31%  238 aa  DEOD_HAES2 RecName: Full=Purine nucleoside phosphorylase deoD-type;
   42::106     4e-04  31%  236 aa  DEOD_GEOTN RecName: Full=Purine nucleoside phosphorylase deoD-type;
   49::206     4e-04  26%  234 aa  DEOD_COLP3 RecName: Full=Purine nucleoside phosphorylase deoD-type;
   42::205     4e-04  27%  235 aa  DEOD_CLOPS RecName: Full=Purine nucleoside phosphorylase deoD-type;
   42::205     4e-04  26%  235 aa  DEOD_BACCN RecName: Full=Purine nucleoside phosphorylase deoD-type;
   36::206     5e-04  25%  241 aa  DEOD_YERE8 RecName: Full=Purine nucleoside phosphorylase deoD-type;
   48::207     5e-04  28%  237 aa  DEOD_STRPC RecName: Full=Purine nucleoside phosphorylase deoD-type;
   48::207     5e-04  28%  237 aa  DEOD_STRPB RecName: Full=Purine nucleoside phosphorylase deoD-type;
   33::105     5e-04  32%  238 aa  DEOD_MANSM RecName: Full=Purine nucleoside phosphorylase deoD-type;
   17::205     5e-04  21%  233 aa  DEOD_HELPJ RecName: Full=Purine nucleoside phosphorylase deoD-type;
   17::205     5e-04  21%  233 aa  DEOD_HELAH RecName: Full=Purine nucleoside phosphorylase deoD-type;
   49::221     5e-04  24%  234 aa  DEOD_BUCAT RecName: Full=Purine nucleoside phosphorylase deoD-type;
   49::221     5e-04  24%  234 aa  DEOD_BUCAI RecName: Full=Purine nucleoside phosphorylase deoD-type;
   49::221     5e-04  24%  234 aa  DEOD_BUCA5 RecName: Full=Purine nucleoside phosphorylase deoD-type;
   42::205     5e-04  26%  235 aa  DEOD_BACCZ RecName: Full=Purine nucleoside phosphorylase deoD-type;
   62::170     7e-04  26%  253 aa  UDP_SALTY RecName: Full=Uridine phosphorylase;       
   62::170     7e-04  26%  253 aa  UDP_SALTI RecName: Full=Uridine phosphorylase;       
   34::206     7e-04  26%  239 aa  DEOD_SALTY RecName: Full=Purine nucleoside phosphorylase deoD-type;
   34::206     7e-04  26%  239 aa  DEOD_SALHS RecName: Full=Purine nucleoside phosphorylase deoD-type;
   42::106     7e-04  32%  234 aa  DEOD_ROSDO RecName: Full=Purine nucleoside phosphorylase deoD-type;
   36::206     7e-04  26%  238 aa  DEOD_PROMH RecName: Full=Purine nucleoside phosphorylase deoD-type;
   33::105     7e-04  28%  238 aa  DEOD_HAEDU RecName: Full=Purine nucleoside phosphorylase deoD-type;
   49::206     7e-04  23%  236 aa  DEOD_BUCAP RecName: Full=Purine nucleoside phosphorylase deoD-type;
   42::205     7e-04  26%  235 aa  DEOD_BACWK RecName: Full=Purine nucleoside phosphorylase deoD-type;
   42::205     7e-04  26%  235 aa  DEOD_BACHK RecName: Full=Purine nucleoside phosphorylase deoD-type;
   42::205     7e-04  26%  235 aa  DEOD_BACCQ RecName: Full=Purine nucleoside phosphorylase deoD-type;
   42::205     7e-04  26%  235 aa  DEOD_BACCE RecName: Full=Purine nucleoside phosphorylase deoD-type;
   42::205     7e-04  26%  235 aa  DEOD_BACC7 RecName: Full=Purine nucleoside phosphorylase deoD-type;
   42::205     7e-04  26%  235 aa  DEOD_BACC4 RecName: Full=Purine nucleoside phosphorylase deoD-type;
   42::205     7e-04  26%  235 aa  DEOD_BACC3 RecName: Full=Purine nucleoside phosphorylase deoD-type;
   42::205     7e-04  26%  235 aa  DEOD_BACC2 RecName: Full=Purine nucleoside phosphorylase deoD-type;
   42::205     7e-04  26%  235 aa  DEOD_BACC1 RecName: Full=Purine nucleoside phosphorylase deoD-type;
   42::205     7e-04  26%  235 aa  DEOD_BACC0 RecName: Full=Purine nucleoside phosphorylase deoD-type;
   42::205     7e-04  26%  235 aa  DEOD_BACAN RecName: Full=Purine nucleoside phosphorylase deoD-type;
   42::205     7e-04  26%  235 aa  DEOD_BACAH RecName: Full=Purine nucleoside phosphorylase deoD-type;
   42::205     7e-04  26%  235 aa  DEOD_BACAC RecName: Full=Purine nucleoside phosphorylase deoD-type;
   42::205     7e-04  26%  235 aa  DEOD_BACAA RecName: Full=Purine nucleoside phosphorylase deoD-type;
   42::110     9e-04  28%  237 aa  DEOD_STRU0 RecName: Full=Purine nucleoside phosphorylase deoD-type;
   34::206     9e-04  23%  236 aa  DEOD_SHEFN RecName: Full=Purine nucleoside phosphorylase deoD-type;
   43::206     9e-04  25%  239 aa  DEOD_SALG2 RecName: Full=Purine nucleoside phosphorylase deoD-type;
   43::182     9e-04  28%  236 aa  DEOD_HAHCH RecName: Full=Purine nucleoside phosphorylase deoD-type;
    1::230

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKIGIIAAMPEELAYLVQHLDNAQEQVVLGNTYHTGTIASHEVVLVESGIGKVMSAMSVAILADHFQVDA
MTNN_LISW6      MTIGIIGAMEEEVELLKNTMPHVEEVVIGGAKFYVGEIAGKEVVLLESGIGKVNAAIGTTLLADRFKPEI
MTNN_LISMO      MTIGIIGAMEEEVELLKNSMSSVEEIVIGGAKFYIGEIASKEVVLLESGIGKVNAALGTTLMADRFKPEV
MTNN_LISMF      MTIGIIGAMEEEVELLKNSMPSVEEIVIGGAKFYVGEIAGKEVVLLESGIGKVNAALGTTLMADRFKPEV
MTNN_LISMC      MTIGIIGAMEEEVELLKNSMPSVEEIVIGGAKFYVGEIAGKEVVLLESGIGKVNAALGTTLMADRFKPEV
MTNN_LISMH      MTIGIIGAMEEEVELLKNSMPSVEEIVIGGAKFYVGEVAGKEVVLLESGIGKVNAALGTTLMADRFKPEV
MTNN_LISIN      MTIGIIGAMEEEVELLKNTMPSIEEVIIGGAKFYIGEIAGKEVVLLESGIGKVNAALGTTLLADRFKPEI
MTNN_SHEWM      MKVGIIGAMEPEVAHLIASMDNAESQTIAGIEFVAGTLDGKEVIVTRSGIGKVAASIATTLLIEKYTPDA
MTNN_ENTS8      MKAGIIGAMEEEVTLLRDKIDNRQTLTIAGCEIYTGTLNGVDVALLKSGIGKVSAAMGATLLLEHCKPDV
MTNN_SHESH      MKIGIIGAMEPEVAHLVESMENPSSTTIAGIEFVAGQLAGKDVVVTRSGIGKVTASIATTLLIEKYAPDA
MTNN_SHESA      MKIGIIGAMEPEVAHLIAAMTNASSQTIAGIEFIAGTLAGKDVVVTRSGIGKVAASIATTLLIEKYAPDA
MTNN_AERHH      MKVGIIGAMEQEVALLRSQMSNPTTLQLGGCEFYQGTLAGKEVILTRSGIGKVAASVATSLLLEKFAPDC
MTNN_SHEDO      MKIGIIGAMEPEVAHLIQSLTSAEHSLIAGIEFISGQIAGKDVVITRSGIGKVAASIATTLLIEKFAVTQ
MTNN_SHESR      MKIGIIGAMEPEVAHLIAAMTNASSQTIAGIEFIAGTLAGKDVVVTRSGIGKVAASIATTLLIEKYAPDA
MTNN_SHESM      MKIGIIGAMEPEVAHLIAAMTNASSQTIAGIEFIAGTLAGKDVVVTRSGIGKVAASIATTLLIEKYAPDA
MTNN_SHELP      MKIGIIGAMEPEVAHLIASMTDTQTQTIAGIEFVAGQLEGKEVIVTRSGIGKVTASVATTLLIEKYAPDY
MTNN_HAES2      MKVGIVGAMAQEVEILASLIENKNVVHIAGCTIYQGNIQDKEVALLQSGIGKVAAAMGTTLLLQMFKPDI
MTNN_SHEB8      MKIGIIGAMEPEVAHLIAAMTNATSQTIAGIEFIAGTLAGKDVVVTRSGIGKVAASIATTLLIEKYAPDA
MTNN_SHEB5      MKIGIIGAMEPEVAHLIAAMTNATSQTIAGIEFIAGTLAGKDVVVTRSGIGKVAASIATTLLIEKYAPDA
MTNN_SHEB9      MKIGIIGAMEPEVAHLIAAMTNATSQTIAGIEFIAGTLAGKDVVVTRSGIGKVAASIATTLLIEKYAPDA
MTNN_SHEB2      MKIGIIGAMEPEVAHLIAAMTNATSQTIAGIEFIAGTLAGKDVVVTRSGIGKVAASIATTLLIEKYAPDA
MTNN_ALISL      MKIGIIGAMEQEVAILKEQINGLATTIKAGCTFHTGTLNGAEVVLLQSGIGKVAAAVGTTLLISDHNVDV
MTNN_SHESW      MKIGIIGAMEPEVAHLIAAMTNATSQTIAGIEFIAGTLAGKDVVVTRSGIGKVAASIATTLLIEKYTPDA
MTNN_SHEPC      MKIGIIGAMEPEVAHLIAAMTNATSQTIAGIEFIAGTLAGKDVVVTRSGIGKVAASIATTLLIEKYAPDA
MTNN_ESCF3      MKIGIIGAMEEEVTLLRDKIENRQTCTMGGVEIYTGQLNGTEVALLKSGIGKVAAAMGATLLIDHFKPDV
MTNN_SHEFN      MKIGIIGAMEPEVVHLVQAIVDPVHTTIAGIEFISGSIAGKDVVVTRSGIGKVAASIATTLLIEKFAATH
MTNN_OCEIH      MTIGIIGAMDEEIALLKQQMKDMEELEVAGCYFYTGHLHDKSVVLLLSGIGKVNAAMATTILHERFSPSM
MTNN_SALTY      MKIGIIGAMEEEVTLLRDKIDNRQTITLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDV
MTNN_SALTI      MKIGIIGAMEEEVTLLRDKIDNRQTITLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDV
MTNN_SALSV      MKIGIIGAMEEEVTLLRDKIDNRQTITLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDV
MTNN_SALPK      MKIGIIGAMEEEVTLLRDKIDNRQTITLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDV
MTNN_SALPC      MKIGIIGAMEEEVTLLRDKIDNRQTITLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDV
MTNN_SALPB      MKIGIIGAMEEEVTLLRDKIDNRQTITLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDV
MTNN_SALDC      MKIGIIGAMEEEVTLLRDKIDNRQTITLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHSKPDV
MTNN_SALCH      MKIGIIGAMEEEVTLLRDKIDNRQTITLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDV
MTNN_SALA4      MKIGIIGAMEEEVTLLRDKIDNRQTITLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDV
MTNN_HAES1      MKVGIVGAMAQEVEILASLIENKNVVHIAGCTIYQGNIQDKEVALLQSGIGKVAAAMGTTLLLQMFKPDI
MTNN_SHEON      MKIGIIGAMEPEVAHLIAAMTNTSSQTIADIEFIAGTLAGKDVVVTRSGIGKVAASIATTLLIEKYAPDA
MTNN_SALNS      MKIGIIGAMEEEVTLLRDKIDNRQTITLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDV
MTNN_SALHS      MKIGIIGAMEEEVTLLRDKIDNRQTITLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDV
MTNN_SALG2      MKIGIIGAMEEEVTLLRDKIDNRQTITLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDV
MTNN_SALEP      MKIGIIGAMEEEVTLLRDKIDNRQTITLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDV
MTNN_VIBFM      MKIGIIGAMEQEVAILKDKIEGLSTVTKAGCTFYTGTLNGADVVLLQSGIGKVAAAVGTTLLIAEHNVDV
MTNN_VIBF1      MKIGIIGAMEQEVAILKDKIEGLSTVTKAGCTFYTGTLNGADVVLLQSGIGKVAAAVGTTLLIAEHNVDV
MTNN_VIBFI      MKIGIIGAMEQEVAILKDKIEGLSTITKAGCTFYTGTLNGADVVLLQSGIGKVAAAVGTTLLIAEHNVDV
MTNN_AERS4      MKVGIIGAMEQEVALLRSQMNEPTTLQLGGCEFYQGKLAGKEVILTRSGIGKVAASVATSLLLEKFAPDC
MTNN_VIBVY      MKVGIIGAMQQEVAILKEAMTNAQTVNKAGCTFYSGQINGVEVVLLQSGIGKVAAAIGTTILLDEYQPDM
MTNN_VIBVU      MKVGIIGAMQQEVAILKEAMTNAQTVNKAGCTFYSGQINGVEVVLLQSGIGKVAAAIGTTILLDEYQPDM
MTNN_STAHJ      --IGIIGAMEEEVAILKDKLTDMNEISVAHVKFYRGKLNSKEVVLTQSGIGKVNAAISTTLIIEKFNPKL
MTNN_SHEHH      MKIGIIGAMEPEVAHLVESMENPSSTTIAGIEFVAGQLAGKDVIVTRSGIGKVTASIATTLLIEKYAPDV
MTNN_LYSSC      MKIAVIGAMEEEVELLRASLNNAQRTTIAGSEYTTGTYEGKEVVLLKSGIGKVNAAMSTTILLHEFKPDV
MTNN_KLEP7      MKIGIIGAMEEEVTLLRDKIENRQTITIGGSEIYTGQLHGVDVALLKSGIGKVAAAMGATLLLERCQPDV
MTNN_STAAB      --IGIIGAMEEEVTILKNKLTQLSEISVAHVKFYTGILKDREVVITQSGIGKVNAAISTTLLINKFKPDI
MTNN_SHEPA      MKIGIIGAMEPEVAHLVESMEKPSSTTIAGIEFVAGQLAGKEVIVTRSGIGKVTASIATTLLIEKYAPDA
MTNN_YERPY      MKVGIIGAMEEEVTLLRDRIENRQTLARAGCEIYTGQLNGIDVALLKSGIGKVAAAMGTTLLLEHCQPDL
MTNN_YERPS      MKVGIIGAMEEEVTLLRDRIENRQTLARAGCEIYTGQLNGIDVALLKSGIGKVAAAMGTTLLLEHCQPDL
MTNN_YERPB      MKVGIIGAMEEEVTLLRDRIENRQTLARAGCEIYTGQLNGIDVALLKSGIGKVAAAMGTTLLLEHCQPDL
MTNN_YERP3      MKVGIIGAMEEEVTLLRDRIENRQTLARAGCEIYTGQLNGIDVALLKSGIGKVAAAMGTTLLLEHCQPDL
MTNN_VIBHB      MKVGIIGAMEQEVTILKEAMTNCQTVSKAGCTFFSGQINGVDVVLLQSGIGKVAAAVGTTILLDEYQPDV
MTNN_VIBCM      MKIGIIGAMQQEVAILKDLIEDVQEVNQAGCTFYSGQIQGVDVVLLQSGIGKVSAALGTALLISQYAPDV
MTNN_VIBCH      MKIGIIGAMQQEVAILKDLIEDVQEVNQAGCTFYSGQIQGVDVVLLQSGIGKVSAALGTALLISQYAPDV
MTNN_VIBC3      MKIGIIGAMQQEVAILKDLIEDVQEVNQAGCTFYSGQIQGVDVVLLQSGIGKVSAALGTALLISQYAPDV
MTNN_STAAW      --IGIIGAMEEEVTILKNKLTQLSEISVAHVKFYTGILKDREVVITQSGIGKVNAAISTTLLINKFKPDV
MTNN_STAAT      --IGIIGAMEEEVTILKNKLTQLSEISVAHVKFYTGILKDREVVITQSGIGKVNAAISTTLLINKFKPDV
MTNN_STAAS      --IGIIGAMEEEVTILKNKLTQLSEISVAHVKFYTGILKDREVVITQSGIGKVNAAISTTLLINKFKPDV
MTNN_STAAN      --IGIIGAMEEEVTILKNKLTQLSEISVAHVKFYTGILKDREVVITQSGIGKVNAAISTTLLINKFKPDV
MTNN_STAAM      --IGIIGAMEEEVTILKNKLTQLSEISVAHVKFYTGILKDREVVITQSGIGKVNAAISTTLLINKFKPDV
MTNN_STAAE      --IGIIGAMEEEVTILKNKLTQLSEISVAHVKFYTGILKDREVVITQSGIGKVNAAISTTLLINKFKPDV
MTNN_STAAC      --IGIIGAMEEEVTILKNKLTQLSEISVAHVKFYTGILKDREVVITQSGIGKVNAAISTTLLINKFKPDV
MTNN_STAA9      --IGIIGAMEEEVTILKNKLTQLSEISVAHVKFYTGILKDREVVITQSGIGKVNAAISTTLLINKFKPDV
MTNN_STAA8      --IGIIGAMEEEVTILKNKLTQLSEISVAHVKFYTGILKDREVVITQSGIGKVNAAISTTLLINKFKPDV
MTNN_STAA3      --IGIIGAMEEEVTILKNKLTQLSEISVAHVKFYTGILKDREVVITQSGIGKVNAAISTTLLINKFKPDV
MTNN_STAA2      --IGIIGAMEEEVTILKNKLTQLSEISVAHVKFYTGILKDREVVITQSGIGKVNAAISTTLLINKFKPDV
MTNN_STAA1      --IGIIGAMEEEVTILKNKLTQLSEISVAHVKFYTGILKDREVVITQSGIGKVNAAISTTLLINKFKPDV
MTNN_STAAR      --IGIIGAMEEEVTILKNKLTQLSEISVAHVKFYTGILKDREVVITQSGIGKVNAAISTTLLINKFKPDI
MTNN_ERWCT      MKVGIIGAMEQEVTLLRDRIENRQTFQRAGCEIYTGQINGVEVALLKSGIGKVSAALGTTLLLEHSKPDV
MTNN_CITK8      MKIGIIGAMEEEVTLLRDKIENRQTITLGGCEIYTGQLNGTEIALLKSGIGKVAAALGATLLLERCKPDV
MTNN_KLEP3      MKIGIIGAMEEEVTLLRDKIENRQTITIGGSEIYTGQLHGVDVALLKSGIGKVAAATGATLLLERCQPDV
MTNN_ANOFW      MNIAIIGAMEEEVAILREKIANRTETTVANCSFYSGTLDGANVVLLKSGIGKVNAAMSTTILLERFAPDV
MTNN_YERPP      MKVGIIGAMEEEVTLLRDRIENRQTLARAGCEIYTGQLNGIDVALLKSGIGKVAAAMGTTLLLEHCQPDL
MTNN_YERPN      MKVGIIGAMEEEVTLLRDRIENRQTLARAGCEIYTGQLNGIDVALLKSGIGKVAAAMGTTLLLEHCQPDL
MTNN_YERPG      MKVGIIGAMEEEVTLLRDRIENRQTLARAGCEIYTGQLNGIDVALLKSGIGKVAAAMGTTLLLEHCQPDL
MTNN_YERPE      MKVGIIGAMEEEVTLLRDRIENRQTLARAGCEIYTGQLNGIDVALLKSGIGKVAAAMGTTLLLEHCQPDL
MTNN_YERPA      MKVGIIGAMEEEVTLLRDRIENRQTLARAGCEIYTGQLNGIDVALLKSGIGKVAAAMGTTLLLEHCQPDL
MTNN_YERE8      MKVGIIGAMEEEVTLLRDKIENRQTLSRAGCEIYTGQLNGIDVALLKSGIGKVSAAMGTTLLLEHCQPDI
MTNN_EXISA      MKVGIIGAMEEEVNLLRNELTERVDTEIANYHFYEGYLGNMQVVILKSGIGKVNAAIGTTLLIDKFKPDV
MTNN_SALAR      MKIGIIGAMEEEVTLLRDKIENRQTLTLGGCEIYTGQLNGTDVALLKSGIGKVAAALGATLLLEHCKPDV
MTNN_PECCP      MKVGIIGAMEQEVTLLRDRIENRQTFQRAGCEIYTGQINGVDVALLKSGIGKVSAALGTTLLLEHSKPDV
MTNN_ENT38      MKIGIIGAMEEEVTLLRDKIENCQTLSLGGCEIYTGQLNGTDVALLKSGIGKVAAALGATLLLERCKPDV
MTNN_SHEAM      MKIGIIGAMEPEVAHLIASLENPVVSQIAGIEFTQGELNGKQVIVTRSGIGKVAAALATTLLIDKFAPDY
MTNN_ACTSZ      MKIGIVGAMAQEVEILAGLMTDKTEHKIGSAVVFEGEVNGKSVVLLQSGIGKVAAAIGTTVLLQGFKPDV
MTNN_SODGM      MKIGIIGAMEQEVALLRDRIDHSTLCQQAGCEIYMGQLHGVEVALVKSGIGKVSAALGTTLLLDHFKPEL
MTNN_PASMU      MKIGIVGAMAQEVQMLADLMQDKRVTQVASCTIYEGMIHGKAVALLQSGIGKVAAAIGATLLLEMCKPDL
MTNN_PSEHT      MNVGIIGAMEPEVKILREAMQNPQTLTKAGFTFYTGELAGNTVTLVQSGIGKVASTIATTLLIDNFAPDC
MTNN_SALPA      MKIGIIGAMEEEVTLLRDKIDNRQTITLGGCEIYTGQLNGTEVALLKSGIGKVXXXXXXXXXXXHCKPDV
MTNN_PROMH      MRVGVIGAMEQEVKLLREQIENCEIVSRGGCEIYTGKINGVDVALLKSGIGKVAAAIGTTLLLEHFRPDV
MTNN_ERWT9      MKAGIIGAMEQEVTLLRDKIENRQTLTLAGCEIYTGTLNGVDVALLKSGIGKVSAALGTTLLLELCKPDV
MTNN_VIBPA      MKVGIIGAMEQEVTILKEAMTNCQTVNKAGCTFFSGQINDVDVVLLQSGIGKVAAAVGTTILLDEYQPDV
MTNN_HAEIE      MKIGIVGAMAQEVEILKNLMADRTETRVASAVIFEGKINGKDVVLLQSGIGKVAAAIGTTALLQLAKPDL
MTNN_VIBSL      MKIGIIGAMEQEVAILKAAISDITEVNKGGCTFFSGQLNGVDVVLLQSGIGKVAAAVGTSILLSEYQPDV
MTNN_GEOSW      MKIAIIGAMEEEVTILRDKIEEREETVIANCEFSTGRLNGADVILLKSGIGKVNAAMSTAILLERFRPDY
MTNN_COLP3      MKAGIIGAMEPEVAILKEKLTDAKSTEHAGYTFHQGQLDGSDVVIVQSGIGKVAAALATAILIDRFQVDY
MTNN_PHOLL      MKVGVIGAMEQEVTLLRNQIEDRQTLSRGGCEIYTGKLNGVEIALLKSGIGKVSAAIGTTLLLEHCQPDV
MTNN_EXIS2      MPIAIIGAMEEEVNLLRNELSERKDTVIANYHFYEGLLNSVPVVILKSGIGKVNAAIGTTLLLDHFKPSS
MTNN_GEOKA      MKAAIIGAMEEEVAILRSRMEGCEETVIAGCEFSKGRLDGVEAVLLKSGIGKVNAAMGTTLLLDHFRPDF
MTNN_GEOTN      MKAAIIGAMEEEVAILRSRMEEREEVVIAGCEFSTGRLDGVEAVLLKSGIGKVNAAMGTTLLLDRFRPDF
MTNN_HAEIN      MKIGIVGAMAQEVEILKNLMADRTETRVASAVIFEGKINGKDVALLQSGIGKVAAAIGTTALLQLAKPDC
MTNN_HAEIG      MKIGIVGAMAQEVEILKNLMADRTETRVASAVIFEGKINGKDVALLQSGIGKVAAAIGTTALLQLAKPDC
MTNN_HAEI8      MKIGIVGAMAQEVEILKNLMADRTETRVASAVIFEGKINGKDIALLQSGIGKVAAAIGTTALLQLAKPDC
MTNN_EDWI9      MKVGIIGAMEQEVTLLRDRIENRQTLRLASGEIYTGRLHGVEVALLKSGIGKVSAAMGTTLLLDHCRPDV
MTNN_SHEPW      MKIGIIGAMEPEVAHLVESMENSTSTTIAGIEFVAGQLAGQEVIVTRSGIGKVTASIATTLLIEKYAPDA
MTNN_SHISS      MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDV
MTNN_SHIFL      MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDV
MTNN_SHIF8      MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDV
MTNN_SHIDS      MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDV
MTNN_SHIB3      MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDV
MTNN_ECOUT      MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDV
MTNN_ECOSM      MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDV
MTNN_ECOSE      MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDV
MTNN_ECOLU      MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDV
MTNN_ECOLI      MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDV
MTNN_ECOLC      MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDV
MTNN_ECOL6      MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDV
MTNN_ECOL5      MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDV
MTNN_ECOK1      MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDV
MTNN_ECODH      MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDV
MTNN_ECOBW      MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDV
MTNN_ECO8A      MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDV
MTNN_ECO81      MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDV
MTNN_ECO7I      MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDV
MTNN_ECO5E      MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDV
MTNN_ECO57      MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDV
MTNN_ECO55      MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDV
MTNN_ECO45      MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDV
MTNN_ECO27      MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDV
MTNN_ECO24      MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDV
MTNN_SHIBS      MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHGKPDV
MTNN_STAES      --IGIIGAMEEEVTILKRKLNDMNEINIAHVKFYVGKLNHKEVVLTQSGIGKVNASISTTLLIEKFNPEV
MTNN_STAEQ      --IGIIGAMEEEVTILKRKLNDMNEINIAHVKFYVGKLNHKEVVLTQSGIGKVNASISTTLLIEKFNPEV
MTNN_STACT      --------------------------------FYKGYIDNQEVVLTLSGIGKVNAAISTTLLINTFSPDV
MTNN_ECOHS      MKIGIIGAMEEEVTLLRDKIEKRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDV
MTNN_BACCN      MRIAVIGAMEEEVRILRDKLEQAEIESVAGCEFTKGMLVGHEVILLKSGIGKVNAAMSTTILLERYQPEK
MTNN_PHOPR      MKIGIIGAMEQEVTILKEQLTDCETHHKAGCIFYTGNLNGADVVLLQSGIGKVAAAVGTAVLLEAFQPDA
MTNN_BACWK      MRIAVIGAMEEEVRILRDKLEQAETETVAGCEFTKGLLAGHEVILLKSGIGKVNAAMSTTILLEKYKPEK
MTNN_SERP5      MKVGIIGAMEQEVTLLRDQIENRQTIQRAGCEIYTGQIGGVDVALLKSGIGKVSAAMGTTLLLEHCKPDL
MTNN_BACCZ      MRIAVIGAMEEEVRILRDKLEQAETETVAGCEFTKGQLAGHEVILLKSGIGKVNAAMSTTILLERYKPEK
MTNN_BACCR      MRIAVIGAMEEEVRILRDKLEQAETETVAGCEFTKGLLAGHEVILLKSGIGKVNAAMSTTILLEKYKPEK
MTNN_BACC7      MRIAVIGAMEEEVRILRDKLEQAETETVAGCEFTKGQLAGHEVILLKSGIGKVNAAMSTTILLERYKPEK
MTNN_BACC4      MRIAVIGAMEEEVRILRDKLEQAETETVAGCEFTKGLLAGHEVILLKSGIGKVNAAMSTTILLEKYKPEK
MTNN_BACC3      MRIAVIGAMEEEVRILRDKLEQAETETVAGCEFTKGQLAGHEVILLKSGIGKVNAAMSTTILLERYKPEK
MTNN_BACC1      MRIAVIGAMEEEVRILRDKLEQAETETVAGCEFTKGQLAGHEVILLKSGIGKVNAAMSTTILLERYKPEK
MTNN_BACC0      MRIAVIGAMEEEVRILRDKLEQAETETVAGCEFTKGQLAGHEVILLKSGIGKVNAAMSTTILLERYKPEK
MTNN_BACAN      MRIAVIGAMEEEVRILRDKLEQAETETVAGCEFTKGQLAGHEVILLKSGIGKVNAAMSTTILLERYKPEK
MTNN_BACAH      MRIAVIGAMEEEVRILRDKLEQAETETVAGCEFTKGQLAGHEVILLKSGIGKVNAAMSTTILLERYKPEK
MTNN_BACAC      MRIAVIGAMEEEVRILRDKLEQAETETVAGCEFTKGQLAGHEVILLKSGIGKVNAAMSTTILLERYKPEK
MTNN_BACAA      MRIAVIGAMEEEVRILRDKLEQAETETVAGCEFTKGQLAGHEVILLKSGIGKVNAAMSTTILLERYKPEK
MTNN_BACHK      MRIAVIGAMEEEVRILRDKLEQAETETVAGCEFTKGQLAGHEVILLKSGIGKVNAAMSTTILLEKYKPEK
MTNN_BACC2      MRIAVIGAMEEEVRILRDKLEQAETETVAGCEFTKGLLAGHEVILLKSGIGKVNAAMSTTILLEKYKPEK
MTNN_MANSM      MKIGIVGAMKQEVEILANLMRNQTVTQVAGCTIYEGLINGKQVALLQSGIGKVAAAIGTTALLQLAKPDV
MTNN_TOLAT      MKIGIIGAMEPEVAILREQISNMETLSIAGCEFYRGELAGHDVILTRSGIGKVAASIATTILLDRYAPDC
MTNN_BACLD      MKIAVIGAMEEEVTILRSKLEQTNREVIANCEFTSGFYEGKEVVLLKSGIGKVNAAMSTTILLDRFKPDV
MTNN_BACP2      MKIAVIGAMEEEVTILRDQLKNATQENIAGCEFTTGVYEDKEVILLKSGIGKVNAAVSTTLLLDRFQPDY
MTNN_HAMD5      MKVGIIGAMKEEVTLLCQKIQSCQTLTRAGCSIYSGFLGETNVVLLQSGIGKTSAALGTTLLLEYFQPDI
MTNN_HAEPS      MKIGIIGAMAQEVEILLGYMAEPKLTEIAGCKIYEGKINNTDIALLQSGIGKTAAAMGTALLLQLTKPEM
MTNN_BACHD      -KIGIIGAMDEEVELLKSKLSNCSERTIAECEFYTGTIEGKEIVLLKSGIGKVNAAIGTTLLIQLFQPTA
MTNN_BACSU      MRLAVIGAMEEEVTILRNKLENAKTETIAHCEFTTGEYEGTEVILLKSGIGKVNAAISTTLLLDRYKPDY
MTNN_BACA2      MKLAVIGAMEEEVTILRSKLKDAKQEMIAHCEFTTGSYEGVEVILLKSGIGKVNAAISTTLLLDRFKPDY
MTNN_THICR      MKVAIIGAMEEEVALLRNQIQNLKTEIHGGFEYYLGQINAIDVILLRSGIGKVNAAIGTALLIKLYEPDY
MTNN_STAS1      --IGIIGAMEEEVAILKDKIVNLEIINVAHVVFYKGRLHDKEVILTQSGIGKVNVAISTTLLINRFHPDL
MTNN_DESPS      MKVGIIAAMEEELTLLVDRLDNCEE-VQLGHCYYTGQINGVEVGLMRCGIGKVNAAIGTTLMIDKLKPKC
MTNN_DESAD      MKIGIIAAMEEELVLLVNKLDEPKTENFGQFTYHTGRINGVEVALFLCGIGKVNAAVGATLLLDKFKPDY
MTNN_MARMS      --IGLIGAMDEEVAVIKAWMTDVREQTIAGCDFFVGRFEGKDVVLLKSGIGKVNAAVSTTLLLSQFEPEY
MTNN_BACSK      MKIGIIGAMEEEVNFLRDKMENRVATTIANCEFTEGQIGAVQVVLTRCGIGKVNAALATTLLNDRFQPDA
MTNN_ACTP7      LKIGIIGAMAQEVEILRNLMVEAKVIEIAGCKIYDGKINNTQVALLQSGIGKVAAAVGTALLLELTKPDV
MTNN_ACTP2      LKIGIIGAMAQEVEILRNLMVEAKVIEIAGCKIYDGKINNTQVALLQSGIGKVAAAVGTALLLELTKPDV
MTNN_BUCAI      MKIGIIGAINQETERLKKIIHFYIEKKI--NTYYIGKFKSHDVFLIKSGIGKVSASVATMILIDLYKPDT
MTNN_ACTPJ      LKIGIIGAMAQEVEILRNLMVEAKVIKMAGCKIYDGKINNTKVALLQSGIGKVSAAIGTTLLLELTKPDM
MTNN_BUCAT      MKIGIIGAINQETERLKKIIHFYIEKKI--NTYYIGKFKSHDVFLIKSGIGKVSASIATMILIDLYKPDT
MTNN_BUCA5      MKIGIIGAINQETERLKKIIHFYIEKKI--NTYYIGKFKSHDVFLIKSGIGKVSASIATMILIDLYKPDT
MTNN_CHRSD      -KIAIIGAMAEEVERLASHLENRQTRQHAGSTFHSGHLHGVEVVILQSGIGKVNAAVGTTQLLEAYQPDA
MTNN_BAUCH      MIIGVIGAMEQEVMLLSKQLAKLNIWQQARCNIYSGWLHGKKVVLVQSGIGKVSAALGCTLLLTNFEATL
MTNN_HAEDU      LKIGIIGAMAQEIEILRKLMTDVSVLEIAGCKIYEGKINNTCVSLLQSGIGKVSAAMGTTLLLELTKPNM
MTNN_PSYIN      MKIGIIGAMDEEVSILKAKLNNMETTIIAGCEFYQGELNGKQVILTKSGIGKXXXXXXXXXXXERFNPGQ
MTNN_HELPY      -KIGILGAMREEITPILELFGVDFEEIPLGNVFHKGVYHNKEIIVAYSKIGKVHSTLTTTSMILAFGVQK
MTNN_HELPJ      -KIGILGAMREEITPILELFGVDFEEIPLGNVFHKGVYHNKEIIVAYSKIGKVHSTLTTTSMILAFGVQK
MTNN_BUCAP      MKIGIIGAXXXXXXXXXXXXXXXXXXXXXXXXXYTGTFKKIEIFLILSGIGKVSASMSTTISINLFQPDF
MTNN_BUCBP      -RIGIIAALQQEVQILFNKLKNYKINKISNITFYIGNIHNIHVVLAKSGVGKVFSGITCALLLQKYKVKF
MTNN_MYCTU      --VGVICAIPQELAYLRGVLVDAKRQQVAQILFDSGQLDAHRVVLAAAGMGKVNTGLTATLLADRFGCRT
MTNN_MYCBO      --VGVICAIPQELAYLRGVLVDAKRQQVAQILFDSGQLDAHRVVLAAAGMGKVNTGLTATLLADRFGCRT
MTNN_TREPA      MTVGVFAALGEEVARVRECLGGVGTERA-GLTFYVVSVGALQVVYVCGGVGKVNAALCTQLLISEFGARV
DEOD_LACCB      ---------PLRAQYIAENLDNAQRYNTVRNAFFTGTFEGRRVSVQATGMGIPSISIYVNELIQDYGVKT
DEOD_LACC3      ---------PLRAQYIAENLDNAQRYNTVRNAFFTGTFEGRRVSVQATGMGIPSISIYVNELIQDYGVKT
MTNN_THEMA      ----VLGVFKIEVEPMLKEMEVLEKGRLLKRYYQRGVVGRNEVVVSYGFIGKVEAALVTQAFLDRFNIDA
FIB_SPICI       -------------------------------------------IIATVGYGKANAAMTITYLLEKYPLQT
DEOD_STRSY      ---------------------------------YTGTYKGHRVSVMGTGMGIPSISIYAHELINEYGVKK
DEOD_STRS2      ---------------------------------YTGTYKGHRVSVMGTGMGIPSISIYAHELINEYGVKK
DEOD_DICNV      ---------PLRAQFIAHHLKNAQERAMLG---FTGEYQQHKLSVMGHGMGIPSCSIYAKELITEYGVKN
DEOD1_VIBCH     ---------PLRAKYIAENLDNAVQVCDVRNMFYTGTYKGRKISVMGHGMGIPSCSIYVTELIKDYGVKK
DEOD_BACLD      ----------------------------------TGTYKGKRVSVQGTGMGVPSISIYVNELIRSYDVKN
DEOD_LACRJ      ---------PLRAKYIAENLENVKQVNSVRNAFYTGEYKGHRISVQGSGMGIPSMSIYINELVREFGVKT
DEOD_LACRD      ---------PLRAKYIAENLENVKQVNSVRNAFYTGEYKGHRISVQGSGMGIPSMSIYINELVREFGVKT
DEOD_ANOFW      ---------------------------VRGMLGFTGTYKGHRISVQGTGMGVPSISIYVTELMQSYNVQT
DEOD_MYCGE      -----------------QFLDQAKVNEVRGMFAYTGQYKSKTVTVMGHGMGIPSIGIYSYELMNFYEVET
DEOD_BACST      ---------------------------VRGMLGFTGTYKGHRISVQGTGMGVPSISIYITELMQSYNVQT
DEOD_PECCP      -------------------LENARENNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYAKELITEFGVKK
DEOD_LISMO      ------------------------EDVVLFNQVRTGTYKGEKVSVMGTGMGIPSISIYVNELIQSYDVKN
DEOD_LISMH      ------------------------EDVVLFNQVRTGTYKGEKVSVMGTGMGIPSISIYVNELIQSYDVKN
DEOD_LISMF      ------------------------EDVVLFNQVRTGTYKGEKVSVMGTGMGIPSISIYVNELIQSYDVKN
DEOD_LISMC      ------------------------EDVVLFNQVRTGTYKGEKVSVMGTGMGIPSISIYVNELIQSYDVKN
DEOD_LISW6      ------------------------EDVVLFNQVRTGTYKGEKVSVMGTGMGIPSISIYVNELIQSYDVKN
DEOD_LISIN      ------------------------EDVVLFNQVRTGTYKGEKVSVMGTGMGIPSISIYVNELIQSYDVKN
DEOD_ERWCT      -------------------LDDARENNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYAKELITEFGVKK
BSPB_POPDE      ---------------------------IAGRRFHSGTLNGSSIVYVKTGSHSVNMATTLQILLARFSIHG
DEOD_MYCPN      ---------------------------VRGMLAFTGQYKGKTITIMGHGMGIPSIGIYSYELMKFYEVNT
BSPA_POPDE      ---------------------------IAGRRFHSGTLNGSSIVYVKTGSPSVNMATTLQILLVRFNIHG
DEOD_BACA2      ----------------------------------TGTYNGKKVSVQGTGMGVPSISIYVNELIQSYDVQN
DEOD1_VIBF1     -------------------LDDVVQVCDVRNMYFTGTYKGRKISVMGHGMGIPSCSIYMTELIKDFGVKK
DEOD_SHEDO      -------------------LENVEQVTDVRNMLFTGTYKGKRISVMGSGMGIPSASIYAYELIKEYGVKN
DEOD_BACSU      ----------------------------------TGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQN
DEOD_XENNE      --------------------DARQVNNVRGMLGFTGTYKGRRISVMGHGMGIPSCSIYAKELITEFGVKK
DEOD_STRZP      ---------------------------------YTGTYKGHRVSVMGTGMGMPSISIYARELIVDYGVKK
DEOD_STRZJ      ---------------------------------YTGTYKGHRVSVMGTGMGMPSISIYARELIVDYGVKK
DEOD_STRPJ      ---------------------------------YTGTYKGHRVSVMGTGMGMPSISIYARELIVDYGVKK
DEOD_STRP7      ---------------------------------YTGTYKGHRVSVMGTGMGMPSISIYARELIVDYGVKK
DEOD_STRP4      ---------------------------------YTGTYKGHRVSVMGTGMGMPSISIYARELIVDYGVKK
DEOD_STRP2      ---------------------------------YTGTYKGHRVSVMGTGMGMPSISIYARELIVDYGVKK
DEOD_OCEIH      ---------------------------VRGMYGYTGTYKGERVSVQGTGMGVPSISIYVNELIQSYDVKK
DEOD_LACLS      --------------------DAVQFNQVRGMLGFTGTYKGHRVSVMGTGMGIPSISIYANELITEYGVKR
DEOD_LACLM      --------------------DAVQFNQVRGMLGFTGTYKGHRVSVMGTGMGIPSISIYANELITEYGVKR
DEOD_LACLA      --------------------DAVQFNQVRGMLGFTGTYKGHRVSVMGTGMGIPSISIYANELITEYGVKR
UDP_KLEAE       ------------------------------------------VIVCSTGIGGPSTSIAVEELA-HVGVRT
DEOD_STRPF      ---------------------------------YTGTYKGHRVSVMGTGMGMPSISIYARELIVDYGVKT
DEOD_HAES1      -------------------LENAQEVTNIRNMLYTGTYKGRKISVMGHGMGIPSCSIYAKELITEYGVKK
DEOD_KLEP3      ---------------------------VRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKK
DEOD_GEOSW      ---------------------------VRGMLGFTGTYKGHRISVQGTGMGVPSISIYVNELIQSYGVQT
DEOD_STRPI      ---------------------------------YTGTYKGHCVSVMGTGMGMPSISIYARELIVDYGVKK
DEOD_STRGC      ---------------------------------YTGTYKGHRVSVMGTGMGMPSISIYARELIVDYGVKK
DEOD_ERWT9      --------------------DAVEVNNVRGMLGYTGTYKGRKISVMGHGMGIPSCSIYAKELITEFGVKK
DEOD_DINSH      ---------------------------VRGMLGFTGTWCGHRVTIHGSGMGMPSLSIYANELITEYGAQT
DEOD_CLOP1      ---------------------------VRGMLGYTGTYKGKKISVQGTGMGVPSISIYVNELIRDYGVKN
DEOD1_VIBPA     ---------------------------------YTGTYKGRKISVMGHGMGIPSCSIYATELIKDFGVKK
UDP_ECOLI       ------------------------------------------VIVCSTGIGGPSTSIAVEELAQ-LGIRT
DEOD_STRZT      ---------------------------------YTGTYKGHCVSVMGTGMGMPSISIYARELIVDYGVKK
DEOD_STRPS      ---------------------------------YTGTYKGHCVSVMGTGMGMPSISIYARELIVDYGVKK
DEOD_STRPG      ---------------------------------YTGTYKGHRVSVMGTGMGMPSISIYARELIVDYGVKT
DEOD_HAES2      -------------------LENAQEVTNVRNMLYTGTYKGRKISVMGHGMGIPSCSIYAKELITEYGVKK
DEOD_GEOTN      ---------------------------VRGMLGFTGTYKGHRISVQGTGMGVPSISIYVNELIQSYGVKT
DEOD_COLP3      ---------------------------------YTGTYKGKRVSVMGSGMGVPSISIYATELYKDYGVEK
DEOD_CLOPS      ---------------------------VRGMLGYTGTYKGKRISVQGTGMGVPSISIYVNELIRDYGVKN
DEOD_BACCN      ---------------------------VRGMLGFTGTYKGKRVSVQGTGMGVPSISIYVNELIQSYGVKN
DEOD_YERE8      --------------------DVKQVNDVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYAKELITDFGVKK
DEOD_STRPC      ---------------------------------YTGTYKGHRVSVMGTGMGMPSISIYARELIVDYGVKT
DEOD_STRPB      ---------------------------------YTGTYKGHRVSVMGTGMGMPSISIYARELIVDYGVKT
DEOD_MANSM      -------------------LENAKEVTNVRNMLYTGTYKGRPVSVMGHGMGIPSCSIYTKELITEYGVKK
DEOD_HELPJ      ----LLCGDPLRVSYIAKNLQDAKEITNVRNMLFSGKYKGKGISLMGHGMGIASCTIYVTELIKTYQVKE
DEOD_HELAH      ----ILCGDPLRVSYIAKNLQDAREITNVRNMLFSGKYKGKEISLMGHGMGIASCTIYVTELVKTYQVKE
DEOD_BUCAT      ---------------------------------YTGFYKNRKISIMSHGIGIPSASLYTRELIIEFNVKK
DEOD_BUCAI      ---------------------------------YTGFYKNRKISIMSHGIGIPSASLYTRELIIEFNVKK
DEOD_BUCA5      ---------------------------------YTGFYKNRKISIMSHGIGIPSASLYTRELIIEFNVKK
DEOD_BACCZ      ---------------------------VRGMLGFTGTYKGKRVSVQGTGMGVPSISIYVNELIQSYGVKN
UDP_SALTY       ------------------------------------------VIVCSTGIGGPSTSIAVEELAQ-LGIRT
UDP_SALTI       ------------------------------------------VIVCSTGIGGPSTSIAVEELAQ-LGIRT
DEOD_SALTY      -------------------LENVRENNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKK
DEOD_SALHS      -------------------LENVRENNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKK
DEOD_ROSDO      ---------------------------VRGMLGFTGTYKGNRVTIQGSGMGMPSLSIYANELISSYNAQT
DEOD_PROMH      --------------------DVRQVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYAKELITDFGVKV
DEOD_HAEDU      -------------------LENAEQVTNVRNMFYTGTYKGRRISIMGHGMGIPSCSIYAKELITEYGVKK
DEOD_BUCAP      ---------------------------------YTGYYKNKKISVMSHGMGIPSASLYVRELILEYNVKK
DEOD_BACWK      ---------------------------VRGMLGFTGTYKGKRVSVQGTGMGVPSISIYVNELIQSYGVKN
DEOD_BACHK      ---------------------------VRGMLGFTGTYKGKRVSVQGTGMGVPSISIYVNELIQSYGVKN
DEOD_BACCQ      ---------------------------VRGMLGFTGTYKGKRVSVQGTGMGVPSISIYVNELIQSYGVKN
DEOD_BACCE      ---------------------------VRGMLGFTGTYKGKRVSVQGTGMGVPSISIYVNELIQSYGVKN
DEOD_BACC7      ---------------------------VRGMLGFTGTYKGKRVSVQGTGMGVPSISIYVNELIQSYGVKN
DEOD_BACC4      ---------------------------VRGMLGFTGTYKGKRVSVQGTGMGVPSISIYVNELIQSYGVKN
DEOD_BACC3      ---------------------------VRGMLGFTGTYKGKRVSVQGTGMGVPSISIYVNELIQSYGVKN
DEOD_BACC2      ---------------------------VRGMLGFTGTYKGKRVSVQGTGMGVPSISIYVNELIQSYGVKN
DEOD_BACC1      ---------------------------VRGMLGFTGTYKGKRVSVQGTGMGVPSISIYVNELIQSYGVKN
DEOD_BACC0      ---------------------------VRGMLGFTGTYKGKRVSVQGTGMGVPSISIYVNELIQSYGVKN
DEOD_BACAN      ---------------------------VRGMLGFTGTYKGKRVSVQGTGMGVPSISIYVNELIQSYGVKN
DEOD_BACAH      ---------------------------VRGMLGFTGTYKGKRVSVQGTGMGVPSISIYVNELIQSYGVKN
DEOD_BACAC      ---------------------------VRGMLGFTGTYKGKRVSVQGTGMGVPSISIYVNELIQSYGVKN
DEOD_BACAA      ---------------------------VRGMLGFTGTYKGKRVSVQGTGMGVPSISIYVNELIQSYGVKN
DEOD_STRU0      ---------------------------IRGMLGYTGTYKGHRVSVMGTGMGMPSISIYARELIVDYGVKT
DEOD_SHEFN      -------------------LENVEQVTDVRNMLFTGTYKGKRISVMGSGMGIPSCSIYAHELIKDYGVKN
DEOD_SALG2      ---------------------------VRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKK
DEOD_HAHCH      ---------------------------VRGMLGYTGEYRGRMLSVMGSGMGVPSISIYAHELFTQFNVKN


                         .         .         *         .         .         .         .:140
query           LINTGSAGAVAEGIAVGDVVIADKLAYHDVDVTAFGYAYGQMAQQPLYFESDKTFVAQIQESLSQLDQNW
MTNN_LISW6      IINTGSAGGMAEGLAVGDVIISDRLAYGDVDVTEFGYTYGQVPRMPAFYQGDAVLLKKAEDYFSQSENKA
MTNN_LISMO      IINTGSAGGMAEGLAVGDVIISDRLAYGDVDVTEFGYTYGQVPRMPAFYQGDAVLLKKAEEYFATSENKA
MTNN_LISMF      IINTGSAGGMAEGLAVGDVIISDRLAYGDVDVTEFGYTYGQVPRMPAFYQGDAVLLKKAEEYFAASENKA
MTNN_LISMC      IINTGSAGGMAEGLAVGDVIISDRLAYGDVDVTEFGYTYGQVPRMPAFYQGDAVLLKKAEEYFAASENKA
MTNN_LISMH      IINTGSAGGMAEGLAVGDVIISDRLAYGDVDVTEFGYTYGQVPRMPAFYQGDAVLLKKAEEYFAASENKA
MTNN_LISIN      IINTGSAGGIGEGLAIGDVIISDRLAYGDVDVTEFGYTYGQVPRMPAFYQGDAVLLKKAEDYFADSENKA
MTNN_SHEWM      VINTGSAGGFVDTLAIGDIVISSEVRHHDVDVTAFGYEIGQMAQQPAAFMPDEKLKAAANKAVASLGEVK
MTNN_ENTS8      IINTGSAGGLAPSLKVGDIVVSDEVRYHDADVTAFGYEYGQMAGCPAAFKADEKLIAAAQETIEKLNLHA
MTNN_SHESH      IINTGSAGGFADELAIGDIVISSEVRHHDVDVTAFGYEIGQMAQQPAAFIPDTALVTAAQKAVASLGEVK
MTNN_SHESA      VINTGSAGGFADSLSIGDIVISSEVRHHDVDVTAFGYEIGQMAQQPAAFIPAPYLVEAANKAIAQLGEVK
MTNN_AERHH      VINTGSAGGFAQDLHIGDVVIASEMRFHDVDVTAFGYEMGQMAQQPAAFPCDETLIAVAQDCIAEQGKHT
MTNN_SHEDO      VVNTGSAGGFVDSLKIGDIVISSEVRHHDVDVTAFGYEIGQMAQQPAAFIPDAALVEAAKKAVSALGEVK
MTNN_SHESR      VINTGSAGGFVDSLSIGDIVISSEVRHHDVDVTAFGYEIGQMAQQPAAFIPAPYLVEAANKAIKQLGEVK
MTNN_SHESM      VINTGSAGGFVDSLSIGDIVISSEVRHHDVDVTAFGYEIGQMAQQPAAFIPAPYLVEAANKAIKQLGEVK
MTNN_SHELP      VINTGSAGGFVDSLAIGDIVISSEVRHHDVDVTAFGYEIGQMAQQPAAFMPDRTLVEAAKKAVADLGEVK
MTNN_HAES2      VINTGSAGGVSSGLKVGDVVVSTQTVYHDADVTAFGYAKGQLPACPPAFISDPKLTALVENVAEQQGINL
MTNN_SHEB8      VINTGSAGGFVDTLAIGDIVISSEVRHHDVDVTAFGYEIGQMAQQPAAFVPAAHLVEAANKAIAQLGEVK
MTNN_SHEB5      MINTGSAGGFVDTLAIGDIVISSEVRHHDVDVTAFGYEIGQMAQQPAAFIPAAHLVEAANKAIAQLGEVK
MTNN_SHEB9      VINTGSAGGFVDTLAIGDIVISSEVRHHDVDVTAFGYEIGQMAQQPAAFIPAAHLVEAANKAIAQLGEVK
MTNN_SHEB2      VINTGSAGGFVDTLAIGDIVISSEVRHHDVDVTAFGYEIGQMAQQPAAFIPAAHLVEAANKAIAQLGEVK
MTNN_ALISL      VLNTGSAGGFDSSLNLGDVVISTEVRHHDADVTAFGYEMGQMAQQPAAFKADEKLMAVAEKALTQMDKHA
MTNN_SHESW      VINTGSAGGFVDTLAIGDIVISSEVRHHDVDVTAFGYEIGQMAQQPAAFIPAAHLVEAANKAIAQLGEVK
MTNN_SHEPC      VINTGSAGGFVDTLAIGDIVISSEVRHHDVDVTAFGYEIGQMAQQPAAFIPAAHLVEAANKAIAQLGEVK
MTNN_ESCF3      IINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAEACIAEHNLNA
MTNN_SHEFN      VINTGSAGGFVDSLAIGDIVISSEVRHHDVDVTAFGYEIGQMAQQPAAFMPDSTLVNAAKSAVAELGEVK
MTNN_OCEIH      IINTGSAGGFASDLQVGDVVISEEVLHHDVDATAFDYVYGQVPGMPATYKADQRLVELSSEVMKDIEINS
MTNN_SALTY      IINTGSAGGLASTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAESCIRELNLNA
MTNN_SALTI      IINTGSAGGLASTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAESCIRELNLNA
MTNN_SALSV      IINTGSAGGLASTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAESCIRELNLNA
MTNN_SALPK      IINTGSAGGLASTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAESCIRELNLNA
MTNN_SALPC      IINTGSAGGLASTLKVGDIVVSDETRYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAESCIRELNLNA
MTNN_SALPB      IINTGSAGGLASTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAESCIRELNLNA
MTNN_SALDC      IINTGSAGGLASTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAESCIRELNLNA
MTNN_SALCH      IINTGSAGGLASTLKVGDIVVSDETRYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAESCIRELNLNA
MTNN_SALA4      IINTGSAGGLASTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAESCIRELNLNA
MTNN_HAES1      VINTGSAGGVSSGLKVGDVVVSTQTVYHDADVTAFGYAKGQLPACPPAFISDPKLTALVANVAKQQGINL
MTNN_SHEON      VINTGSAGGFVDSLSIGDIVISSEVRHHDVDVTAFGYEIGQMAQQPAAFIPAPYLVEAANKAIAQLGEVR
MTNN_SALNS      IINTGSAGGLASTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAESCIRELNLNA
MTNN_SALHS      IINTGSAGGLASTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAESCIRELNLNA
MTNN_SALG2      IINTGSAGGLASTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAESCIRELNLNA
MTNN_SALEP      IINTGSAGGLASTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAESCIRELNLNA
MTNN_VIBFM      VLNTGSAGGFDSSLNLGDVVISTEVRHHDADVTAFGYEMGQMAQQPAAFIADEKLITTAEQALTEMDKHA
MTNN_VIBF1      VLNTGSAGGFDSSLNLGDVVISTEVRHHDADVTAFGYEMGQMAQQPAAFIADEKLITTAEQALTEMDKHA
MTNN_VIBFI      VLNTGSAGGFDSSLNLGDVVISTEVRHHDADVTAFGYEMGQMAQQPAAFIADEKLITTAEQALTEMDKHA
MTNN_AERS4      VINTGSAGGFAQDLHIGDMVIADEMRFHDVDVTAFGYEMGQMAQQPAAFPCDGKLIAVAQDCIAEQGKHT
MTNN_VIBVY      VLNTGSAGGFDSSLNLGDVVISTEVRHHDADVTAFGYEMGQMAGQPAAFLADEKLMNLAEKALEQMDQHA
MTNN_VIBVU      VLNTGSAGGFDSSLNLGDVVISTEVRHHDADVTAFGYEMGQMAGQPAAFLADEKLMNLAEKALEQMDQHA
MTNN_STAHJ      IINTGSAGALDESLSVGDMLISNDVVYHDVDATAFGYKLGQIPQMPLEFKSDQELLKSVETVINKKNYNA
MTNN_SHEHH      IINTGSAGGFADELAIGDIVISSEVRHHDVDVTAFGYEIGQMAQQPAAFIPDXXXXXXXXXXXXSLGEVK
MTNN_LYSSC      VINTGSAGGYDEALEVGAVVISDEVRHHDVDVTIFGYEIGQMAGMPAAYKSDERLMKVAEEAVKAVEHQY
MTNN_KLEP7      IINTGSAGGLASTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADEKLVAAAESCIKALDLNA
MTNN_STAAB      IINTGSAGALDESLNVGDVLISDDVKYHDADATAFGYEYGQIPQMPVAFQSSKPLIEKVSQVVQQQQLTA
MTNN_SHEPA      IINTGSAGGFADDLAIGDIVISSEVRHHDVDVTAFGYEIGQMAQQPAAFIPDXXXXXXXXXXXXSLGEVK
MTNN_YERPY      VINTGSAGGLASSLKVGDIVVSNEVRYHDADVTAFGYEPGQMAGCPAAFVADEDLIALAENCIQQLKLNA
MTNN_YERPS      VINTGSAGGLASSLKVGDIVVSNEVRYHDADVTAFGYEPGQMAGCPAAFVADEDLIALAENCIQQLKLNA
MTNN_YERPB      VINTGSAGGLASSLKVGDIVVSNEVRYHDADVTAFGYEPGQMAGCPAAFVADEDLIALAENCIQQLKLNA
MTNN_YERP3      VINTGSAGGLASSLKVGDIVVSNEVRYHDADVTAFGYEPGQMAGCPAAFVADEDLIALAENCIQQLKLNA
MTNN_VIBHB      VINTGSAGGFDSSLNLGDVVISTEVRHHDTDVTAFGYEMGQMAGQPAAFKADEKLMDLAEKALAQM-ENT
MTNN_VIBCM      VINTGSAGGFDASLNVGDVVISSEVRHHDADVTAFGYEIGQMAGQPAAFKADEKLMTVAEQALAQL-PNT
MTNN_VIBCH      VINTGSAGGFDASLNVGDVVISSEVRHHDADVTAFGYEIGQMAGQPAAFKADEKLMTVAEQALAQL-PNT
MTNN_VIBC3      VINTGSAGGFDASLNVGDVVISSEVRHHDADVTAFGYEIGQMAGQPAAFKADEKLMTVAEQALAQL-PNT
MTNN_STAAW      IINTGSAGALDESLNVGDVLISDDVKYHDADATAFGYEYGQIPQMPVAFQSSKPLIEKVSQVVQQQQLTA
MTNN_STAAT      IINTGSAGALDESLNVGDVLISDDVKYHDADATAFGYEYGQIPQMPVAFQSSKPLIEKVSQVVQQQQLTA
MTNN_STAAS      IINTGSAGALDESLNVGDVLISDDVKYHDADATAFGYEYGQIPQMPVAFQSSKPLIEKVSQVVQQQQLTA
MTNN_STAAN      IINTGSAGALDESLNVGDVLISDDVKYHDADATAFGYEYGQIPQMPVAFQSSKPLIEKVSQVVQQQQLTA
MTNN_STAAM      IINTGSAGALDESLNVGDVLISDDVKYHDADATAFGYEYGQIPQMPVAFQSSKPLIEKVSQVVQQQQLTA
MTNN_STAAE      IINTGSAGALDESLNVGDVLISDDVKYHDADATAFGYEYGQIPQMPVAFQSSKPLIEKVSQVVQQQQLTA
MTNN_STAAC      IINTGSAGALDESLNVGDVLISDDVKYHDADATAFGYEYGQIPQMPVAFQSSKPLIEKVSQVVQQQQLTA
MTNN_STAA9      IINTGSAGALDESLNVGDVLISDDVKYHDADATAFGYEYGQIPQMPVAFQSSKPLIEKVSQVVQQQQLTA
MTNN_STAA8      IINTGSAGALDESLNVGDVLISDDVKYHDADATAFGYEYGQIPQMPVAFQSSKPLIEKVSQVVQQQQLTA
MTNN_STAA3      IINTGSAGALDESLNVGDVLISDDVKYHDADATAFGYEYGQIPQMPVAFQSSKPLIEKVSQVVQQQQLTA
MTNN_STAA2      IINTGSAGALDESLNVGDVLISDDVKYHDADATAFGYEYGQIPQMPVAFQSSKPLIEKVSQVVQQQQLTA
MTNN_STAA1      IINTGSAGALDESLNVGDVLISDDVKYHDADATAFGYEYGQIPQMPVAFQSSKPLIEKVSQVVQQQQLTA
MTNN_STAAR      IINTGSAGALDESLNVGDVLISDDVKYHDADATAFGYEYGQVPQMPVAFQSSKPLIEKVSQVVQQQQLTA
MTNN_ERWCT      VINTGSAGGLASTLNVGDIVISDEVRYHDADVTAFGYEPGQMAGCPAAFPADEKFIALAQDAIDDLQLNA
MTNN_CITK8      IINTGSAGGLAPTLTVGDIVVSDEARYHDADVTAFGYEFGQLPGCPAGFKADDALIAAAESCIAKLNLNA
MTNN_KLEP3      IINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLVAAAEDCIKALDLNA
MTNN_ANOFW      VINTGSAGGFAPSLNVGDIVISTEVVHHDVDVTAFGYAYGQVPGMPARYAADERLIQAAETSAAHIDIQV
MTNN_YERPP      VINTGSAGGLDSSLKVGDIVVSNEVRYHDADVTAFGYEPGQMAGCPAAFVADEDLIALAENCIQQLKLNA
MTNN_YERPN      VINTGSAGGLDSSLKVGDIVVSNEVRYHDADVTAFGYEPGQMAGCPAAFVADEDLIALAENCIQQLKLNA
MTNN_YERPG      VINTGSAGGLDSSLKVGDIVVSNEVRYHDADVTAFGYEPGQMAGCPAAFVADEDLIALAENCIQQLKLNA
MTNN_YERPE      VINTGSAGGLDSSLKVGDIVVSNEVRYHDADVTAFGYEPGQMAGCPAAFVADEDLIALAENCIQQLKLNA
MTNN_YERPA      VINTGSAGGLDSSLKVGDIVVSNEVRYHDADVTAFGYEPGQMAGCPAAFVADEDLIALAENCIQQLKLNA
MTNN_YERE8      VINTGSAGGLASSLKVGDIVVSTEVRYHDADVTAFGYEPGQMAGCPAAFIADLKLIELAESCIKQLDLNA
MTNN_EXISA      VINTGSAGGFKKGMKVGDVVVSTEVRHHDVDVTAFGYEYGQVPGMPPAYEADAKLVSVCKDVIENLDVNV
MTNN_SALAR      IINTGSAGGLASTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAEYCIRELNLNA
MTNN_PECCP      VINTGSAGGLAPSLNVGDIVVSDEVRYHDADVTAFGYEPGQMAGCPAAFAADEKLIALAQEAIADLQLNA
MTNN_ENT38      IINTGSAGGLAPSLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDNLIAAAESCIAELNLNA
MTNN_SHEAM      VINTGSAGGFVDSLTIGDVVIGSEVRYHDVDVTAFGYEIGQMAQQPAAFVCDAHLVEAAKNAVAKLGEKT
MTNN_ACTSZ      VINTGSAGGVAQGLKVGDIVISTETAYHDADVTAFGYAKGQLPACPATFKSDEKLTALAEKIAQKQGRRV
MTNN_SODGM      VINTGSAGGLAPSLKVGDIVVSHEVRYHDVDVTAFGYEPGQMAQCPASFNAAPSLVALAEESVDRLGMHA
MTNN_PASMU      VINTGSAGGVATGLNVGDIVISDETVYHDADVTAFGYAKGQLPACPARFQSDEKLVQLAEKIAVQQQQQV
MTNN_PSEHT      VINTGSAGGFDPSLNVGDVVISSEVRHHDVDVTAFGYEIGQVPQMPAGFAAHPKLVAAAEQTIAQIDVKT
MTNN_SALPA      IINTGSAGGLASTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAESCIRELNLNA
MTNN_PROMH      VINTGSAGGLDAKLNVGDIVVSTEVRYHDADVTAFGYEPGQMAQCPPAFIADPKLVNIAQECIGSLKLNA
MTNN_ERWT9      VINTGSAGGLAATLKVGDIVVSDEVRYHDADVTAFGYEAGQMAGCPAAFKADEKLITAVEQCIHQLDLHA
MTNN_VIBPA      VINTGSAGGFDSSLNLGDVVISTEVRHHDADVTAFGYEIGQMAGQPAAFKADEKLMDLAEKALEQM-ANT
MTNN_HAEIE      VINTGSAGGVAKGLKVGDIVISDETRYHDADVTAFGYEKGQLPANPAAFLSDKKLADLAQEIAEKQGQSV
MTNN_VIBSL      VLNTGSAGGFDSTLNLGDVVISTEVRHHDADVTAFGYEIGQMAGQPAAFKADDKLMAVAEQALAQMDKHA
MTNN_GEOSW      VINTGSAGGFLSTLNVGDVVISNEVVHHDVDVTAFGYEYGQVPGMPARYKADETLVKIAEQNAKQIDIQV
MTNN_COLP3      VVNTGSAGGFDASLKVGDIVVSSEVRYHDVDLTAFGYEIGQLPANPAAFMPHDDLVAAAKKGIEQLSQTA
MTNN_PHOLL      IINTGSAGGLDPKLQIGDIVVSREVRYHDTDVTAFGYEPGQMAQCPAAFVADDQLIDLAEKCIHSLNLNA
MTNN_EXIS2      VINTGSAGGFRAGLKVGDVVVSTEVRHHDVDVTAFGYEYGQVPGMPAAYTADPKLIATAEAVIERMDARV
MTNN_GEOKA      VINTGSAGGFLPSLRVGDLVISEEVVHHDVDVTAFGYAYGQVPGLPARYRXXXXXXXXXXXXXXRLDLQA
MTNN_GEOTN      VINTGSAGGFLPSLRVGDLVISDEVVHHDVDVTAFGYAYGQVPGLPAYRXXXXXXXXXXXXXXXXXXXXX
MTNN_HAEIN      VINTGSAGGVAKGLKVGDIVISDETRYHDADVTAFGYEKGQLPANPAAFLSDKKLADLAQEIAEKQGQSV
MTNN_HAEIG      VINTGSAGGVAKGLKVGDIVISDETRYHDADVTAFGYEKGQLPANPAAFLSDKKLADLAQEIAEKQGQSV
MTNN_HAEI8      VINTGSAGGVAKGLKVGDIVISDETRYHDADVTAFGYEKGQLPANPAAFLSDKKLADLAQEMAEKQGQSV
MTNN_EDWI9      VINTGSAGGLASTLRVGDIVISDEVRYHDADVTAFGYQPGQMAGCPXXXXXXXXXXXXXERCIIALQLNA
MTNN_SHEPW      IINTGSAGGFADDLAIGDIVISSEVRHHDVDVTAFGYEIGQMAQQPAAFLPDXXXXXXXXXXXXSLGEVK
MTNN_SHISS      IINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLXXXXXXXXXXXXXXX
MTNN_SHIFL      IINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLXXXXXXXXXXXXXXX
MTNN_SHIF8      IINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLXXXXXXXXXXXXXXX
MTNN_SHIDS      IINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLXXXXXXXXXXXXXXX
MTNN_SHIB3      IINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLXXXXXXXXXXXXXXX
MTNN_ECOUT      IINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLXXXXXXXXXXXXXXX
MTNN_ECOSM      IINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLXXXXXXXXXXXXXXX
MTNN_ECOSE      IINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLXXXXXXXXXXXXXXX
MTNN_ECOLU      IINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLXXXXXXXXXXXXXXX
MTNN_ECOLI      IINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLXXXXXXXXXXXXXXX
MTNN_ECOLC      IINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLXXXXXXXXXXXXXXX
MTNN_ECOL6      IINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLXXXXXXXXXXXXXXX
MTNN_ECOL5      IINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLXXXXXXXXXXXXXXX
MTNN_ECOK1      IINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLXXXXXXXXXXXXXXX
MTNN_ECODH      IINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLXXXXXXXXXXXXXXX
MTNN_ECOBW      IINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLXXXXXXXXXXXXXXX
MTNN_ECO8A      IINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLXXXXXXXXXXXXXXX
MTNN_ECO81      IINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLXXXXXXXXXXXXXXX
MTNN_ECO7I      IINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLXXXXXXXXXXXXXXX
MTNN_ECO5E      IINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLXXXXXXXXXXXXXXX
MTNN_ECO57      IINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLXXXXXXXXXXXXXXX
MTNN_ECO55      IINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLXXXXXXXXXXXXXXX
MTNN_ECO45      IINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLXXXXXXXXXXXXXXX
MTNN_ECO27      IINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLXXXXXXXXXXXXXXX
MTNN_ECO24      IINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLXXXXXXXXXXXXXXX
MTNN_SHIBS      IINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLXXXXXXXXXXXXXXX
MTNN_STAES      VINTGSAGALDQTLSIGDILVSNHVLYHDANATAFGYEYGQIPQMPKTYTTDPTLLKKTMHVLEQQQLNG
MTNN_STAEQ      VINTGSAGALDQTLSIGDILVSNHVLYHDANATAFGYEYGQIPQMPKTYTTDPTLLKKTMHVLEQQQLNG
MTNN_STACT      ILNTGSAGALDHSLNIGDVLISTEATYHDADATAFGYELGQIPNMPIAYAADDDLVTLAQSVVEQQEMNG
MTNN_ECOHS      IINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLXXXXXXXXXXXXXXX
MTNN_BACCN      VINTGSAGGFHHALNVGDVVISTEVRHHDVDVTAFNYEYGQVPGMPPGFKADKELVALAEQCMKE-EENI
MTNN_PHOPR      VLNTGSAGGFDSSLTLGDVVISTEVRYHDADVTAFGYEIGQMAQQPAAFISDEKLILTAEQALSMADMHA
MTNN_BACWK      VINTGSAGGFHHSLNVGDVVISTEVRHHDVDVTAFNYEYGQVPGMPPGFKADEALVA-LAEKCMQAEENI
MTNN_SERP5      VINTGSAGGLASTLKVGDIVVSEEVRYHDADVTAFGYEPGQMAGCPAAFVADDALIALAESCIKQLNLNA
MTNN_BACCZ      VINTGSAGGFHHSLNVGDVVISTEVRHHDVDVTAFNYEYGQVPGMPPGFKADEALVA-LAEKCMQAEENI
MTNN_BACCR      VINTGSAGGFHHSLNVGDVVISTEVRHHDVDVTAFNYEYGQVPGMPPGFKADEALVA-LAEKCMQAEENI
MTNN_BACC7      VINTGSAGGFHHSLNVGDVVISTEVRHHDVDVTAFNYEYGQVPGMPPGFKADEALVA-LAEKCMQAEENI
MTNN_BACC4      VINTGSAGGFHHSLNVGDVVISTEVRHHDVDVTAFNYEYGQVPGMPPGFKADEALVA-LAEKCMQAEENI
MTNN_BACC3      VINTGSAGGFHHSLNVGDVVISTEVRHHDVDVTAFNYEYGQVPGMPPGFKADEALVA-LAEKCMQAEENI
MTNN_BACC1      VINTGSAGGFHHSLNVGDVVISTEVRHHDVDVTAFNYEYGQVPGMPPGFKADEALVA-LAEKCMQAEENI
MTNN_BACC0      VINTGSAGGFHHSLNVGDVVISTEVRHHDVDVTAFNYEYGQVPGMPPGFKADEALVA-LAEKCMQAEENI
MTNN_BACAN      VINTGSAGGFHHSLNVGDVVISTEVRHHDVDVTAFNYEYGQVPGMPPGFKADEALVA-LAEKCMQAEENI
MTNN_BACAH      VINTGSAGGFHHSLNVGDVVISTEVRHHDVDVTAFNYEYGQVPGMPPGFKADEALVA-LAEKCMQAEENI
MTNN_BACAC      VINTGSAGGFHHSLNVGDVVISTEVRHHDVDVTAFNYEYGQVPGMPPGFKADEALVA-LAEKCMQAEENI
MTNN_BACAA      VINTGSAGGFHHSLNVGDVVISTEVRHHDVDVTAFNYEYGQVPGMPPGFKADEALVA-LAEKCMQAEENI
MTNN_BACHK      VINTGSAGGFHHSLNVGDVVISTEVRHHDVDVTAFNYEYGQVPGMPPGFKADEALVA-LAEKCMQAEENI
MTNN_BACC2      VINTGSAGGFHHSLNVGDVVISTEVRHHDVDVTAFNYEYGQVPGMPPGFKADEALVA-LAEKCMQTEENI
MTNN_MANSM      VLNTGSAGGVADGLKVGDIVISTETAYHDADVTAFGYAKGQLPACPATFISDEKLTALAKQVAQAQGHNV
MTNN_TOLAT      VINTGSAGGFDPELRVGDVVISDEVRHHDVNVTAFGYEPGQLPQQPAAFISDSKLIEVATQVMHQLPEQS
MTNN_BACLD      VINTGSAGGFHHSLNVGDIVISTEVRHHDVDVTAFDYEYGQVPNLPAAYKADNALIQAAEDEASELGHQV
MTNN_BACP2      VINTGSAGGFHHTLNVGDIVISTDVRHHDVDVTIFNYEYGQVPGLPAAFVADEKLVKLAEESALEIDHQV
MTNN_HAMD5      LINTGSAAGLWPDLKIGDIVISTEVRYHDVNVTAFGYEWGQMALCPPAFFADKKLIEIVLECVKNLNLNA
MTNN_HAEPS      VINTGSAGGLDANLNVGDIVISTEVRHHDIDVTAFGYEKGQLPANPAAFMANEQLAQIAIKETEKAGFNA
MTNN_BACHD      IINTGSAGGLDSSLHVGDLAISTEVRYNDVDATVFGYEFGQVPQMPAFYQPDDMLIDIAIEAAKTVGIPS
MTNN_BACSU      VINTGSAGGFHHTLNVGDVVISTDVRHHDVDVTAFDYEYGQVPGLPAAYAADEKLISITEEAVSELDGQV
MTNN_BACA2      VINTGSAGGFHHTLNVGDVVISTDVRHHDVDVTAFDYEYGQVPGLPAAYKADEKLISITEEAVSELNGQV
MTNN_THICR      VINTGSAGGFHTDLEVGDIVISQSVCHHDVDVTPFGYARGQVPGHPECYLADIHLIDIAKRSIDALQEVT
MTNN_STAS1      IINTGSAGALDKSLGVGDIIVSDMVAYHDADARAFGYQLGQIPQMPAQFVADSHLIELAKEAIN--DQKW
MTNN_DESPS      LINTGVAGGFINEMNVGDIVISSSVRHHDADATAFGYELGQIPDMPSEFQADRRLVEMATKVNLKSKARI
MTNN_DESAD      LINTGVAGAFPGNINIGDIVVSSEVRHYDADATAFDYEMGQIPQMPAAYQXXXXXXXXXXXXWINEDSSV
MTNN_MARMS      VINIGSAGGFDPELQVGDVVISDQVVHHDVDVTGFGYLMGQVPNMPATYAADETLVAEAKAALQKVTQQA
MTNN_BACSK      IINTGVAGGLNASMAVGDLVISTEVRYHDVDATVFGYEYGQVPGMVPAYLPDXXXXXXXXXXXQKVGFHS
MTNN_ACTP7      IINTGSAGGLDANLNVGDIVISTEVRHHDADVTAFGYEKGQLPANPAAFLPNEQLVSVALKETQTAGFNA
MTNN_ACTP2      IINTGSAGGLDANLNVGDIVISTEVRHHDADVTAFGYEKGQLPANPAAFLPNEQLVSVALKETQTAGFNA
MTNN_BUCAI      IINSGSAGSLQSFLKIGDIIIPKKTCYYDVDLTNFGYTRGQIPGYPKEFTVNEKICNFFKKNADKYQLKY
MTNN_ACTPJ      VINTGSAGGLDANLNVGDIVISTEVRHHDADVTAFGYEKGQLPANPAAFLPNEQLVSVALKETQTAGFNA
MTNN_BUCAT      IINSGSAGSLQSFLKIGDIIIPKKTCYYDVDLTNFGYTRGQIPGYPKEFTVNEKICNFFKKNADKYQLKY
MTNN_BUCA5      IINSGSAGSLQSFLKIGDIIIPKKTCYYDVDLTNFGYTRGQIPGYPKEFTVNEKICNFFKKNADKYQLKY
MTNN_CHRSD      VINTGSAXXXXXXXXXXXXXISSEVRHHDVDAVVFGYEYGQVPQMPAAYAPDPHLVNVARECIEGLGERV
MTNN_BAUCH      VINIGSAGGLSPALAVGDIIVSEEVQYHDVNVTAFGYDKGQMAQYPLLFPASPSLVALTKQLTEHTNINV
MTNN_HAEDU      VINTGSAGGLAENLNVGDIVISTEVRHYDVDVTAFGYEIGQLPANPAAFLPNEQLVNMALKETKTAGVNA
MTNN_PSYIN      VINTGSAGGYDTTLNVGDIVISTEVRFHDVDLTAFGYEIGQMAQLPAAFPADKNLIFAAQKAAETITHKT
MTNN_HELPY      VLFSGVAGSLVKDLKINDLLVAIQLVQHDVDLSAFDHPLGFIPESAIFIETSESLNALAKEVANEQHIVL
MTNN_HELPJ      VLFSGVAGSLVKDLKINDLLVATQLVQHDVDLSAFDHPLGFIPESAIFIETSGSLNALAKKIANEQHIAL
MTNN_BUCAP      IINSGSAGSLNACLKIGDIIIPKKTCYYDVDLTNFGYSKGQIPEYPQTFKTNKNLREILKEIAVEFKFKF
MTNN_BUCBP      IINIGSAGSLNKNLKPGSIIIPTNVCYHDVNLTAFGYSIGQIKNCPKTFLSNTLMLKLTEKYLFENKIKY
MTNN_MYCTU      IVFTGVAGGLDPELCIGDIVIADRVVQHDTDERLRPYQPGHIPTERLGYPVDPAVIDRVKHRLDGFQPRI
MTNN_MYCBO      IVFTGVAGGLDPELCIGDIVIADRVVQHDTDERLRPYQPGHIPTERLGYPVDPAVIDRVKHRLDGFQPRI
MTNN_TREPA      LINTGIAGALDERLCVFDVLVSVDAVQHDVDVTAFGYQKGRIPRMDSVEWTANTYLVREAFDLCTRDPEW
DEOD_LACCB      LIRVGTAGGMGENVKVRDVVLAQSSTDSSIILNTFGAG--------LYFAPLADF-NLLREAANLADTSY
DEOD_LACC3      LIRVGTAGGMGENVKVRDVVLAQSSTDSSIILNTFGAG--------LYFAPLADF-NLLREAANLADTSY
MTNN_THEMA      VFLTGNAXXXXXXXXXXXXXXXSYVEY-DFE-TALG---------------DEGIIVSGSEDLAYSNREI
FIB_SPICI       ILNVDLALSTNDKHDTGDTTISTKFIYRDADLTVFDIKYGQIVNEPESFQFDGEFAKVVKDFKLGLTE--
DEOD_STRSY      LIRVGTAGSLNEDVHVRELVLAQAAATNSINIDWPEYDLPQIADFDLL---DKAY-----HIAKELNMTT
DEOD_STRS2      LIRVGTAGSLNEDVHVRELVLAQAAATNSINIDWPEYDLPQIADFDLL---DKAY-----HIAKELNMTT
DEOD_DICNV      LIRVGSCGAVLDEIKLHDVIIALSAA-TDSNVNRLRFRHYDFAATADYSIFSALIAAAAQQNITA-----
DEOD1_VIBCH     IIRVGSCGAVNEGIKVRDVVI-------------------------------------------------
DEOD_BACLD      LIRVGSCGAIRKDVNVRDVILA---MTSSTDSQINRVAFGSIDFAPC---ADFGLLKAAYDAASERNIPV
DEOD_LACRJ      IIRVGSCGGIAPDVHVRDVLLAQGSSTDSVTVNTFGFHYAPLA--------DFKLLDTAYHVAGKLGIET
DEOD_LACRD      IIRVGSCGGIAPDVHVRDVLLAQGSSTDSVTVNTFGFHYAPLA--------DFKLLDTAYHVAGKLGIET
DEOD_ANOFW      LIRVGTCGAIQKDVKVRDVILA---MTSSTDSQMNRMTFGGIDYAPANFDLLKTAYEIGKEKGLQL----
DEOD_MYCGE      IIRIGSCGALAPQLKLKDLVIASKAWSESIYAKDMGV---EIPEDKILF-ATSSLVELAKETAIKNKLDF
DEOD_BACST      LIRVGTCGAIQKDVKVRDVILA---MTSSTDSQMNRMTFGGIDYAPANFDLLKTAYEIGKEKGLQL----
DEOD_PECCP      IIRVGSCGAVREDVKLRDVVIVNRMRFKDHDYAAI---------------ADFDMVRNAVDAAKARDVSV
DEOD_LISMO      LIRVGTMGGIQADVKVRDVVIA-QAASTDSQINRNTFAGVDFAPVADFSLLKKAYDAGIEKGLS-----L
DEOD_LISMH      LIRVGTMGGIQADVKVRDVVIA-QAASTDSQINRNTFAGVDFAPVADFSLLKKAYDAGIEKGLS-----L
DEOD_LISMF      LIRVGTMGGIQADVKVRDVVIA-QAASTDSQINRNTFAGVDFAPVADFSLLKKAYDAGIEKGLS-----L
DEOD_LISMC      LIRVGTMGGIQADVKVRDVVIA-QAASTDSQINRNTFAGVDFAPVADFSLLKKAYDAGIEKGLS-----L
DEOD_LISW6      LIRVGTMGGIQADVKVRDVVIA-QAASTDSQINRNTFAGVDFAPVADFSLLKKAYDAGVEKGLS-----L
DEOD_LISIN      LIRVGTMGGIQADVKVRDVVIA-QAASTDSQINRNTFAGVDFAPVADFSLLKKAYDAGVEKGLS-----L
DEOD_ERWCT      IIRVGSCGAVREDVKLRDVVIVNRMRFKDHDYAAI---------------ADFDMVRNAVDAAKARDVSV
BSPB_POPDE      VIYFGNAGSLDKKTMVGDVSVPQAVAFTGV----------------------------------------
DEOD_MYCPN      IIRIGSCGALQGSLNLQDLIIAAKAWSESI------YANDMGVEVP----ADKILMASPQKTANQLQLAF
BSPA_POPDE      VIYFGNAGSLDKKTMVGDVSVPQAVAFTGV----------------------------------------
DEOD_BACA2      LIRVGSCGAIRNDVKVRDVILA---MTSSTDSQMNRVAFGSVDYAPC---ADFELLNKAYQEAQKNNLPV
DEOD1_VIBF1     VIRVGSCGAVNEGIKVRDVVI-------------------------------------------------
DEOD_SHEDO      LIRVGTCGAISTDVKVRDVIIANRLRFKDHDFAAI---------------ADYSLLSAVVDSAKEHGTQI
DEOD_BACSU      LIRVGSCGAIRKDVKVRDVILA---MTSSTDSQMNRVAFGSVDFAPC---ADFELLKNAYDAAKDKGVPV
DEOD_XENNE      IIRIGSCGAVSEDVKIRDVVIVNRMRFKDHDFAAI---------------ADFDLVRHAVDAAKAKNINT
DEOD_STRZP      LIRVGTAGSLNEEVHVRELVLAQAAATNSNIVRNDQYDFPQIASFDLL---DKAY-----HIAKELGMTT
DEOD_STRZJ      LIRVGTAGSLNEEVHVRELVLAQAAATNSNIVRNDQYDFPQIASFDLL---DKAY-----HIAKELGMTT
DEOD_STRPJ      LIRVGTAGSLNEEVHVRELVLAQAAATNSNIVRNDQYDFPQIASFDLL---DKAY-----HIAKELGMTT
DEOD_STRP7      LIRVGTAGSLNEEVHVRELVLAQAAATNSNIVRNDQYDFPQIASFDLL---DKAY-----HIAKELGMTT
DEOD_STRP4      LIRVGTAGSLNEEVHVRELVLAQAAATNSNIVRNDQYDFPQIASFDLL---DKAY-----HIAKELGMTT
DEOD_STRP2      LIRVGTAGSLNEEVHVRELVLAQAAATNSNIVRNDQYDFPQIASFDLL---DKAY-----HIAKELGMTT
DEOD_OCEIH      LIRVGTCGAIQKDVNVRDVILANRLIFNGID-------YAPIADFELL---KNAYDAGVDKGL-----HL
DEOD_LACLS      LIRVGTAGSVNEDVHIRDLVIGQAAA--------------------------------------------
DEOD_LACLM      LIRVGTAGSVNEDVHIRDLVIGQAAA--------------------------------------------
DEOD_LACLA      LIRVGTAGSVNEDVHIRDLVIGQAAA--------------------------------------------
UDP_KLEAE       FLRIGTTGAIQPHINVGDVLVTTGSVRLDGASLHFA---------PMEFPADFACTTALVEAAKSIGATT
DEOD_STRPF      LIRVGTAGAIDPEVHVRELVLAQAAATNS-NIIRNDFPEFDFPQIADFGLLDKAY-----HIAREMGVTT
DEOD_HAES1      IIRVGSCGAVNMDVKIRDVIIVNRIRFKDNDFAAI--ADFGMAQAAVQAAKNKGIDVKV-----------
DEOD_KLEP3      IIRVGSCGAVREDVKLRDVVIVNRLRFKDHDFAAI---------------ADFGMVRNAVDAAKALGVDA
DEOD_GEOSW      LIRVGTCGAIQKDVNVRDVILA------------------------------------------------
DEOD_STRPI      LIRVGTAGSLNEEVHVRELVLAQAAATNSNIVRNDQYDFPQIASFDLL---DKAY-----HIAKELGMTT
DEOD_STRGC      LIRVGTAGSLNEDVHVRELVLAQAAATNSNIIRNDQYDFPQIASFDLL---DKAY-----HIAKDLGMTT
DEOD_ERWT9      IIRVGSCGAVRTDVKLRDVVIVNRMRFKDHDFAAI---------------ADFDMVRNAVDAAQALGVKA
DEOD_DINSH      LIRIGSTGAMQNHVALRDVILA------------------------------------------------
DEOD_CLOP1      LIRVGTAGGMQEDIKVRDLVLA-MSSHTDSAINKVRFNGLDFAPTASFKLLKAAYDTAVEKGYSP-----
DEOD1_VIBPA     IIRVGSCGAVNEDIKVRDVVI-------------------------------------------------
UDP_ECOLI       FLRIGTTGAIQPHINVGDVLVT--TASVRLDGASLHFA-------PLEFPAVADFTTALVEAAKSIGATT
DEOD_STRZT      LIRVGTAGSLNEEVHVRELVLAQAAATNSNIVRNDQYDFPQIASFDLL---DKAY-----HIAKKLGMTT
DEOD_STRPS      LIRVGTAGSLNEEVHVRELVLAQAAATNSNIVRNDQYDFPQIASFDLL---DKAY-----HIAKKLGMTT
DEOD_STRPG      LIRVGTAGAIDPEVHVRELVLAQAAATNS-NIIRNDFPEFDFPQIADFGLLDKAY-----HIAREMGVTT
DEOD_HAES2      IIRVGSCGAVNMDVKIRDVII-------------------------------------------------
DEOD_GEOTN      LIRVGTCGAIQPDVRVRDVILA------------------------------------------------
DEOD_COLP3      IIRIGSCGAXXXGMAASTDSNVNRQRFHNVDFAAC---------------ADFSLLKSVVDTAEKLGKPV
DEOD_CLOPS      LIRVGTAGGMQEDIKVRDLVLA-MSSHTDSAINKVRFNGLDFAPTASFKLLKAAYDTAVEKGYSP-----
DEOD_BACCN      LIRVGTCGAIQKDVKVRDVIIA-MTACTDSNINRLTFPGFDFAPAANFDLLKKAYDAGTEKGL-----HI
DEOD_YERE8      IIRVGSCGAVREDVKLRDVVIVNRLRFKDHDYAAI---------------ADFDMTRNAVDAAKAKGLNV
DEOD_STRPC      LIRVGTAGAIDPEVHVRELVLAQAAATNS-NIIRNDFPEFDFPQIADFGLLDKAY-----HIAREMGVTT
DEOD_STRPB      LIRVGTAGAIDPEVHVRELVLAQAAATNS-NIIRNDFPEFDFPQIADFGLLDKAY-----HIAREMGVTT
DEOD_MANSM      IIRVGSCGAVRNDVKVRDVII-------------------------------------------------
DEOD_HELPJ      LLRIGTCGAISPKVGLKDIVMATG-ASTDSKTNRVRFLNHDLSATP-----DFELSLRAYQTAKRLGIDL
DEOD_HELAH      LLRIGTCGAISPKVGLRDIIMVTG-ASTDSKTNRIRFLNHDLSATP-----DFELSLRAYQTAKRLEIDL
DEOD_BUCAT      IIRIGTCGAVRDDIKLRDIVISNRIRFNDHDFAAI---------------ADFDMIYNXXXXXXXXXXXX
DEOD_BUCAI      IIRIGTCGAVRDDIKLRDIVISNRIRFNDHDFAAI---------------ADFDMIYNXXXXXXXXXXXX
DEOD_BUCA5      IIRIGTCGAVRDDIKLRDIVISNRIRFNDHDFAAI---------------ADFDMIYNXXXXXXXXXXXX
DEOD_BACCZ      LIRVGTCGAIQKDVKVRDVIIA-MTACTDSNMNRLTFPGFDFAPAANFDLLKKAYDAGTEKGL-----HV
UDP_SALTY       FLRIGTTGAIQPHINVGDVLVT--TASVRLDGASLHFA-------PMEFPADFACTTALVEAAKSIGATT
UDP_SALTI       FLRIGTTGAIQPHINVGDVLVT--TASVRLDGASLHFA-------PMEFPADFACTTALVEAAKSIGATT
DEOD_SALTY      IIRVGSCGAVRMDVKLRDVVIVNRIRFKDHDFAAI---------------ADFDMVRNAVDAAKALGVDA
DEOD_SALHS      IIRVGSCGAVRMDVKLRDVVIVNRIRFKDHDFAAI---------------ADFDMVRNAVDAAKALGVDA
DEOD_ROSDO      LIRIGSCGGMQPHVAVRDVIIA------------------------------------------------
DEOD_PROMH      IIRVGSCGAVLPDVELRDVVIVNRLRFKDQDFAAI---------------ADFELVQNAVSAAKAKDIKV
DEOD_HAEDU      IIRVGSCGAVRADVKLRDIVI-------------------------------------------------
DEOD_BUCAP      IIRVGTCGTIQNNIKLRDIVIS-MGASTDSKINRINHDYAAIADFEMIFHAFST--------AKKMNFKV
DEOD_BACWK      LIRVGTCGAIQKDVKVRDVIIA-MTACTDSNMNRLTFPGFDFAPAANFDLLKKAYDAGTEKGL-----HV
DEOD_BACHK      LIRVGTCGAIQKDVKVRDVIIA-MTACTDSNMNRLTFPGFDFAPAANFDLLKKAYDAGTEKGL-----HV
DEOD_BACCQ      LIRVGTCGAIQKDVKVRDVIIA-MTACTDSNMNRLTFPGFDFAPAANFDLLKKAYDAGTEKGL-----HV
DEOD_BACCE      LIRVGTCGAIQKDVKVRDVIIA-MTACTDSNMNRLTFPGFDFAPAANFDLLKKAYDAGTEKGL-----HV
DEOD_BACC7      LIRVGTCGAIQKDVKVRDVIIA-MTACTDSNMNRLTFPGFDFAPAANFDLLKKAYDAGTEKGL-----HV
DEOD_BACC4      LIRVGTCGAIQKDVKVRDVIIA-MTACTDSNMNRLTFPGFDFAPTANFDLLKKAYDAGTEKGL-----HV
DEOD_BACC3      LIRVGTCGAIQKDVKVRDVIIA-MTACTDSNMNRLTFPGFDFAPAANFDLLKKAYDAGTEKGL-----HV
DEOD_BACC2      LIRVGTCGAIQKDVKVRDVIIA-MTACTDSNMNRLTFPGFDFAPAANFDLLKKAYDAGTEKGL-----HV
DEOD_BACC1      LIRVGTCGAIQKDVKVRDVIIA-MTACTDSNMNRLTFPGFDFAPAANFDLLKKAYDAGTEKGL-----HV
DEOD_BACC0      LIRVGTCGAIQKDVKVRDVIIA-MTACTDSNMNRLTFPGFDFAPAANFDLLKKAYDAGTEKGL-----HV
DEOD_BACAN      LIRVGTCGAIQKDVKVRDVIIA-MTACTDSNMNRLTFPGFDFAPAANFDLLKKAYDAGTEKGL-----HV
DEOD_BACAH      LIRVGTCGAIQKDVKVRDVIIA-MTACTDSNMNRLTFPGFDFAPAANFDLLKKAYDAGTEKGL-----HV
DEOD_BACAC      LIRVGTCGAIQKDVKVRDVIIA-MTACTDSNMNRLTFPGFDFAPAANFDLLKKAYDAGTEKGL-----HV
DEOD_BACAA      LIRVGTCGAIQKDVKVRDVIIA-MTACTDSNMNRLTFPGFDFAPAANFDLLKKAYDAGTEKGL-----HV
DEOD_STRU0      LIRVGTAGSIDPNVHVRELVLAQAAA--------------------------------------------
DEOD_SHEFN      LIRVGTCGAISTDVKVRDVIIVNRLRFKDNDFAAI---------------ADYSLLSAVVDSAKAHGTKI
DEOD_SALG2      IIRVGSCGAVRMDVKLSDVVIVNRIRFKDHDFAAI---------------ADFDMVRNAVDAAKALGVDA
DEOD_HAHCH      IVRIGSCGSIRDEVKVRDIVITDSLVNR---VRLNHYDFAAIA--------DYDLLEPVVNAARRREARF


                         +         .         .         .         .         *         .:210
query           HFGLIATGDSFVAGNDKIEAIKSHFPEVLAVEMEGXXXXXXXXXLNLPVLVIRAMSDNANHEANIFFDEF
MTNN_LISW6      VYGLVITNDSFIMRPDQHELIRTFFPDVKAVEMEAAAIAQVAYQFDIPFLIIRAISDLANQEATISFDEF
MTNN_LISMO      VYGLVVTNDSFIMRPDQHEIIRTFFPDVKAVEMEAAAIAQVAYQFDIPFLIIRAISDLANQEATISFDEF
MTNN_LISMF      VYGLVVTNDSFIMRPDQHETIRTFFPDVKAVEMEAAAIAQVAYQFDIPFLIIRAISDLANQEATISFDEF
MTNN_LISMC      VYGLVVTNDSFIMRPDQHETIRTFFPDVKAVEMEAAAIAQVAYQFDIPFLIIRAISDLANQEATISFDEF
MTNN_LISMH      VYGLVVTNDSFIMRPDQHETIRTFFPDVKAVEMEAAAIAQVAYQFDIPFLIIRAISDLANQEATISFDEF
MTNN_LISIN      VYGLVITNDSFIMRPDQHEIIRTFFPDVKAVEMEAAAIAQVAYQFDIPFLIIRAISDLANQEATMSFDEF
MTNN_SHEWM      AIGLICTGDSFICDPVRTKTMLEHFPTMAACEMEGAAIAQVCHQFAVPFVVIRSLSDNANNDSPVDFDSY
MTNN_ENTS8      VRGLVVSGDAFINGSVNLAKIRHNFPQAIAVEMEATAIGHVCHNFGVPFVVVRAISDVADQQSHLSFEEF
MTNN_SHESH      AIGLICTGDSFICDPVRTKTMLEHFPTMAACEMEGAAIAQVCHQFDVPFVVIRSLSDNANNDSPVDFDEY
MTNN_SHESA      AIGLICTGDSFICDPVRTKTMLEHFPTMAACEMEGAAIAQVCHQFGVPFVVIRSLSDNANNDSPVDFDSY
MTNN_AERHH      KVGLICTGDQFMCKPDAIAKARADFPQMLAVEMEGAAIGQVCHMFKVPYLVVRAMSDIAGKEQVESFDAF
MTNN_SHEDO      AIGLICTGDSFICDPERTKVMRANFPTMAACEMEGAAIAQVCHQFKVPFVVIRSLSDNANNDSPVDFDSY
MTNN_SHESR      AIGLICTGDSFICDPVRTKTMLEHFPTMAACEMEGAAIAQVCHQFGMPFVVIRSLSDNANNDSPVDFDSY
MTNN_SHESM      AIGLICTGDSFICDPVRTKTMLEHFPTMAACEMEGAAIAQVCHQFGVPFVVIRSLSDNANNDSPVDFDSY
MTNN_SHELP      AIGLICTGDSFICDPERTKVMLNNFPTMAACEMEGAAIAQVCHQFKVPFVVIRSLSDNANNDSPVDFDSY
MTNN_HAES2      TSGLICSGDSFINSAEKLAWIKANFPEVVAIEMEATAIAQVCHKFNIPFVVIRAISDVGDGEASISFEEF
MTNN_SHEB8      AIGLICTGDSFICDPIRTQAMLKNFPTMAACEMEGAAIAQVCHQFGVPFVVIRSLSDNANNDSPVDFDSY
MTNN_SHEB5      AIGLICTGDSFICDPVRTQAMLKNFPTMAACEMEGAAIAQVCHQFGVPFVVIRSLSDNANNDSPVDFDSY
MTNN_SHEB9      AIGLICTGDSFICDPVRTQAMLKNFPTMAACEMEGAAIAQVCHQFGVPFVVIRSLSDNANNDSPVDFDSY
MTNN_SHEB2      AIGLICTGDSFICDPVRTQAMLKNFPTMAACEMEGAAIAQVCHQFGVPFVVIRSLSDNANNDSPVDFDSY
MTNN_ALISL      VRGLICTGDAFVCTPERQAFIRSHFPSVIAVEMEASAIAQTCHQFSVPFVVVRAISDVADKESPMSFEEF
MTNN_SHESW      AIGLICTGDSFICDPVRTQAMLKNFPTMAACEMEGAAIAQVCHQFGVPFVVIRSLSDNANNDSPVDFDSY
MTNN_SHEPC      AIGLICTGDSFICDPVRTQAMLKNFPTMAACEMEGAAIAQVCHQFGVPFVVIRSLSDNANNDSPVDFDSY
MTNN_ESCF3      VRGLIVSGDAFINGSVSLAKIRHNFPQAIAVEMEATAIAHVCHNFKVPFVVVRAISDVADQQSHISFDEF
MTNN_SHEFN      AIGLICTGDSFICDPVRTKVMRENFPTMAACEMEGAAIAQVCHQFNVPFVVIRSLSDNANNDSPVDFDSY
MTNN_OCEIH      RIGVIATGDSFMQRKDQTDIVKQRFPGMLALEMEAASIAQVCYRYNTPFVITRALSDIAGQESSVSFDQF
MTNN_SALTY      VRGLIVSGDAFINGSVGLAKIRHNFPDAVAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEF
MTNN_SALTI      VRGLIVSGDAFINGSVGLAKIRHNFPDAVAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEF
MTNN_SALSV      VRGLIVSGDAFINGSVGLAKIRHNFPDAVAVEMEATAIAHVCYNFNVPFVVVRAISDVADQQSHLSFDEF
MTNN_SALPK      VRGLIVSGDAFINGSVGLAKIRHNFPDAVAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEF
MTNN_SALPC      VRGLIVSGDAFINGSVGLAKIRHNFPDAVAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEF
MTNN_SALPB      VRGLIVSGDAFINGSVGLAKIRHNFPDAVAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEF
MTNN_SALDC      VRGLIVSGDAFINGSVGLAKIRHNFPDAVAVEMEATAIAHVCYNFNVPFVVVRAISDVADQQSHLSFDEF
MTNN_SALCH      VRGLIVSGDAFINGSVGLAKIRHNFPDAVAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEF
MTNN_SALA4      VRGLIVSGDAFINGSVGLAKIRHNFPDAVAVEMEATAIAHVCYNFNVPFVVVRAISDVADQQSHLSFDEF
MTNN_HAES1      TSGLICSGDSFINSAEKLAWIKANFPEVVAIEMEATAIAQVCHKFNIPFVVIRAISDVGDGEASMSFEEF
MTNN_SHEON      AIGLICTGDSFICDPVRTKTMLEHFPTMAACEMEGAAIAQVCHQFGVPFVVIRSLSDNANNDSPVDFDAY
MTNN_SALNS      VRGLIVSGDAFINGSVGLAKIRHNFPDAVAVEMEATAIAHVCYNFSVPFVVVRAISDVADQQSHLSFDEF
MTNN_SALHS      VRGLIVSGDAFINGSVGLAKIRHNFPDAVAVEMEATAIAHVCYNFSVPFVVVRAISDVADQQSHLSFDEF
MTNN_SALG2      VRGLIVSGDAFINGSVGLAKIRHNFPDAVAVEMEATAIAHVCYNFSVPFVVVRAISDVADQQSHLSFDEF
MTNN_SALEP      VRGLIVSGDAFINGSVGLAKIRHNFPDAVAVEMEATAIAHVCYNFSVPFVVVRAISDVADQQSHLSFDEF
MTNN_VIBFM      VRGLICTGDVFVCTPERQEFIRTHFPSVIAVEMEASAIAQTCHQFNTPFVVVRAISDVADKESPMSFDEF
MTNN_VIBF1      VRGLICTGDVFVCTPERQEFIRTHFPSVIAVEMEASAIAQTCHQFNTPFVVVRAISDVADKESPMSFDEF
MTNN_VIBFI      VRGLICTGDVFVCTPERQEFIRTHFPSVIAVEMEASAIAQTCHQFNTPFVVVRAISDVADKESPMSFDEF
MTNN_AERS4      KVGLICTGDQFMCKPDAIAKARADFPQMLAVEMEGAAIGQVCHMFKVPYLVVRAMSDIAGKEQVESFDAF
MTNN_VIBVY      VRGLICTGDAFVCTAERQAFIRQHFPSVIAVEMEASAIAQTCHQFKVPFVVVRAISDVADKESPMSFEEF
MTNN_VIBVU      VRGLICTGDAFVCTAERQAFIRQHFPSVIAVEMEASAIAQTCYQFKVPFVVVRAISDVADKESPMSFEEF
MTNN_STAHJ      KIGQIVSGDSFIGSVDQRLTIKRQFPEAMAVEMEATAIAQTCHQFHVPFIVTRAVSDLANGKADISFEEF
MTNN_SHEHH      AIGLICTGDSFICDPVRTKTMLENFPTMAACEMEGAAIAQVCHQFGVPFVVIRSLSDNANNDSPVDFDEY
MTNN_LYSSC      GIGLICSGDAFMNDPERVEAVRHHFPXXXXXXXXXXXXXXVCYQFATPFVVIRALSDIAGKESNISFDEF
MTNN_KLEP7      VRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFKVPFVVVRAISDVADQQSHLSFEEF
MTNN_STAAB      KVGLIVSGDSFIGSVEQRQKIKKAFPNAMAVEMEATAIAQTCYQFNVPFVVVRAVSDLANGEAEISFEAF
MTNN_SHEPA      AIGLICTGDSFICDPVRTKTMLENFPTMAACEMEGAAIAQVCHQFDVPFVVIRSLSDNANNDSPVDFDEY
MTNN_YERPY      VRGLICSGDAFINGAEPLARIRAAFPTVAAVEMEAAAIGHVCYLFNTPFVVVRAISDVADQASHLSFEEF
MTNN_YERPS      VRGLICSGDAFINGAEPLARIRAAFPTVAAVEMEAAAIGHVCYLFNTPFVVVRAISDVADQASHLSFEEF
MTNN_YERPB      VRGLICSGDAFINGAEPLARIRAAFPTVAAVEMEAAAIGHVCYLFNTPFVVVRAISDVADQASHLSFEEF
MTNN_YERP3      VRGLICSGDAFINGAEPLARIRAAFPTVAAVEMEAAAIGHVCYLFNTPFVVVRAISDVADQASHLSFEEF
MTNN_VIBHB      HAGLICTGDAFVCTAERQEFIRKHFPSVIAVEMEASAIAQTCHQFNTPFVVVRAISDVADKESPMSFEEF
MTNN_VIBCM      HAGLICTGDAFVCTAERQQFIRQHFPSVVAVEMEASAIAQTCHQFKVPFVVVRAISDVADKESPLSFEEF
MTNN_VIBCH      HAGLICTGDAFVCTAERQQFIRQHFPSVVAVEMEASAIAQTCHQFKVPFVVVRAISDVADKESPLSFEEF
MTNN_VIBC3      HAGLICTGDAFVCTAERQQFIRQHFPSVVAVEMEASAIAQTCHQFKVPFVVVRAISDVADKESPLSFEEF
MTNN_STAAW      KVGLIVSGDSFIGSVEQRQKIKKAFPNAMAVEMEATAIAQTCYQFNVPFVVVRAVSDLANGEAEMSFEAF
MTNN_STAAT      KVGLIVSGDSFIGSVEQRQKIKKAFPNAMAVEMEATAIAQTCYQFNVPFVVVRAVSDLANGEAEMSFEAF
MTNN_STAAS      KVGLIVSGDSFIGSVEQRQKIKKAFPNAMAVEMEATAIAQTCYQFNVPFVVVRAVSDLANGEAEMSFEAF
MTNN_STAAN      KVGLIVSGDSFIGSVEQRQKIKKAFPNAMAVEMEATAIAQTCYQFNVPFVVVRAVSDLANGEAEMSFEAF
MTNN_STAAM      KVGLIVSGDSFIGSVEQRQKIKKAFPNAMAVEMEATAIAQTCYQFNVPFVVVRAVSDLANGEAEMSFEAF
MTNN_STAAE      KVGLIVSGDSFIGSVEQRQKIKKAFPNAMAVEMEATAIAQTCYQFNVPFVVVRAVSDLANGEAEMSFEAF
MTNN_STAAC      KVGLIVSGDSFIGSVEQRQKIKKAFPNAMAVEMEATAIAQTCYQFNVPFVVVRAVSDLANGEAEMSFEAF
MTNN_STAA9      KVGLIVSGDSFIGSVEQRQKIKKAFPNAMAVEMEATAIAQTCYQFNVPFVVVRAVSDLANGEAEMSFEAF
MTNN_STAA8      KVGLIVSGDSFIGSVEQRQKIKKAFPNAMAVEMEATAIAQTCYQFNVPFVVVRAVSDLANGEAEMSFEAF
MTNN_STAA3      KVGLIVSGDSFIGSVEQRQKIKKAFPNAMAVEMEATAIAQTCYQFNVPFVVVRAVSDLANGEAEMSFEAF
MTNN_STAA2      KVGLIVSGDSFIGSVEQRQKIKKAFPNAMAVEMEATAIAQTCYQFNVPFVVVRAVSDLANGEAEMSFEAF
MTNN_STAA1      KVGLIVSGDSFIGSVEQRQKIKKAFPNAMAVEMEATAIAQTCYQFNVPFVVVRAVSDLANGEAEMSFEAF
MTNN_STAAR      KVGLIVSGDSFIGSVEQRQKIKKAFPNAMAVEMEATAIAQTCYQFNVPFVVVRAVSDLANGEAEMSFEAF
MTNN_ERWCT      VRGLVVSGDAFINGAEPLARIRTTFPKAIAVEMEATAIAHVCHQFGTPFVVVRAISDVADKASHLSFDEF
MTNN_CITK8      VRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEF
MTNN_KLEP3      VRGLIVSGDAFINGSVALAKIRHNFPQAIAVEMEATAIAHVCHNFKVPFVVVRAISDVADQQSHLSFEEF
MTNN_ANOFW      AKGLIATGDSFMHDPARVDFVRTQFPDLYAVEMEAAAIAQVCHQFNVPFVVIRALSDIAGKESNVSFEQF
MTNN_YERPP      VRGLICSGDAFINGAEPLARIRAAFPTVAAVEMEAAAIGHVCYLFNTPFVVVRAISDVADQASHLSFEEF
MTNN_YERPN      VRGLICSGDAFINGAEPLARIRAAFPTVAAVEMEAAAIGHVCYLFNTPFVVVRAISDVADQASHLSFEEF
MTNN_YERPG      VRGLICSGDAFINGAEPLARIRAAFPTVAAVEMEAAAIGHVCYLFNTPFVVVRAISDVADQASHLSFEEF
MTNN_YERPE      VRGLICSGDAFINGAEPLARIRAAFPTVAAVEMEAAAIGHVCYLFNTPFVVVRAISDVADQASHLSFEEF
MTNN_YERPA      VRGLICSGDAFINGAEPLTRIRAAFPTVAAVEMEAAAIGHVCYLFNTPFVVVRAISDVADQASHLSFEEF
MTNN_YERE8      VRGLICSGDAFINGAAPLARIRTTFPSVAAVEMEAAAIGHVCYLFKTPFVVVRAISDVADQESHLSFDEF
MTNN_EXISA      HQGLIVTGDSFINDSKRVADILGHFDGVAAVEMEAAPIAQTCYQFGVPFVVTRSISDSADEEANLSFDEF
MTNN_SALAR      VRGLIVSGDAFINGSVGLAKIRHNFPNAVAVEMEATAIAHVCYNFKVPFVVVRAISDVADQQSHLNFDEF
MTNN_PECCP      VRGLVVSGDAFINGAEPLARIRTTFPKAIAVEMEATAIAHVCHQFAVPFVVVRAISDVADKASHLSFDEF
MTNN_ENT38      VRGLIVSGDAFINGSVGLAKIRHNFPNAIAVEMEATAIAHVCHNFSVPFVVVRAISDVADQQSHLSFDEF
MTNN_SHEAM      VAGLICTGDSFICDPVRTAKMQADFPTMAACEMEGAAIGQVCHQFATPFVVIRSLSDNANNDSPVDFESY
MTNN_ACTSZ      KQGLICSGDSFIAGGERLAQIKADFPPVTAVEMEAAAIAHVCHAFGVPFVVVRAISDAGDGEAGMSFEEF
MTNN_SODGM      VRGLVVSGDAFINDADGLAHIRQTFPQAIAVEMEATAIAHVCHQFAVPFVVVRAISDVADQASHLSFDEF
MTNN_PASMU      KRGLICSGDSFIQGGTPLAQIKADFPTVMAVEMEATAIAQVCHAFNVPFVVVRAISDSGDGEASMSFEEF
MTNN_PSEHT      LVGLICTGDIFMCDPIRIEKARSDFPTMLAVEMEGASIAQTCHTLNTPFVVIRSMSDIAGKESPQSFEEY
MTNN_SALPA      VRGLIVSGDAFINGSVGLAKIRHNFPDAVAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEF
MTNN_PROMH      VRGLICSGDAFINGAEPLARIRRTFPEVVAVEMESTAIGHVCHQFDTPFVVVRAISDVADKESHLSFDEF
MTNN_ERWT9      VRGLVVSGDAFINGAAPLAHIRNTFPQAIAVEMEATAIGHVCHQFGTPFVVVRAISDVADQQSHLSFDEF
MTNN_VIBPA      HAGLICTGDAFVCTAERQAFIRENFPSVIAVEMEASAIAQTCHQFNTPFVVVRAISDVADKESPMSFEEF
MTNN_HAEIE      KRGLICSGDSFINSEDKITQIKADFPNVTGVEMEATAIAQVCYAFNVPFVVVRAISDGGDGKASISFEEF
MTNN_VIBSL      VRGLICTGDAFVCTAERQEFIRKHFPSVVAVEMEASAIAQACHQFQVPFVVVRAISDVADKESPMSFEEF
MTNN_GEOSW      VTGLIATGDSFMNDPARVEFVRSKFPELCXXXXXXXXXXQVCTQFAVPFVIIRALSDIAGKESNVSFEQF
MTNN_COLP3      GTGLITTGDTFMTKEEDVAKARANFPTMAAVEMEGAAIAQACLQLKTPFVVIRSLSDIAGKESPHTFEEY
MTNN_PHOLL      VRGLICSGDAFINGAEPLARIRATFPQVTAVEMEAAAIGHVCHQYNTPFVVVRAISDVADKESHISFDEF
MTNN_EXIS2      VHGLIVTGDSFIHDTERSNLIKTNFPDVAAVEMEAAPIAQVCHQFDVPFVVTRSISDSADEEASLSFDEF
MTNN_GEOKA      VTGLIATGDSFMNDPKRVEFVRGQFPELCAVEMEAAAIAQVCVQFGTPFVIIRALSDIAGEESGVSFEQF
MTNN_GEOTN      XIGLIATGDSFMNDPKRVEFVRGQFPELCAVEMEAAAIAQVCVQFGTPFVIIRALSDIAGEESNVSFEQF
MTNN_HAEIN      KRGLICSGDSFINSEDKIAQIKADFPNVTGVEMEATAIAQVCYAFNVPFVVVRAISDGGDGKASMSFEEF
MTNN_HAEIG      KRGLICSGDSFINSEDKITQIQADFPNVMGVEMEATAIAQVCYAFNVPFVVVRAISDGGDGKASMSFEEF
MTNN_HAEI8      KRGLICSGDSFINSEDKIAQIQADFPNVMGVEMEATAIAQVCYAFNVPFVVVRAISDGGDGKASMSFEEF
MTNN_EDWI9      VRGLICSGDAFINGAEPLARIRRTFPQVAAVEMEAAAIGHVCHAFQTPFVVVRAISDVADQESHISFDEF
MTNN_SHEPW      AIGLICTGDSFICDPVRTKTMLENFPTXXXXXXXXXXXXQVCHQFAVPFVVIRSLSDNANDDSAVDFDEY
MTNN_SHISS      VRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEF
MTNN_SHIFL      VRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEF
MTNN_SHIF8      VRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEF
MTNN_SHIDS      VRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEF
MTNN_SHIB3      VRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEF
MTNN_ECOUT      VRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEF
MTNN_ECOSM      VRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEF
MTNN_ECOSE      VRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEF
MTNN_ECOLU      VRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEF
MTNN_ECOLI      VRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEF
MTNN_ECOLC      VRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEF
MTNN_ECOL6      VRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEF
MTNN_ECOL5      VRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEF
MTNN_ECOK1      VRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEF
MTNN_ECODH      VRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEF
MTNN_ECOBW      VRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEF
MTNN_ECO8A      VRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEF
MTNN_ECO81      VRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEF
MTNN_ECO7I      VRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEF
MTNN_ECO5E      VRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEF
MTNN_ECO57      VRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEF
MTNN_ECO55      VRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEF
MTNN_ECO45      VRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEF
MTNN_ECO27      VRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEF
MTNN_ECO24      VRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEF
MTNN_SHIBS      VRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEF
MTNN_STAES      KVGMIVSGDSFIGSSEQRQKIKQQFPEAMAVEMEATAIAQTCYQFKVPFIVTRAVSDLANGKADISFEEF
MTNN_STAEQ      KVGMIVSGDSFIGSSEQRQKIKQQFPEAMAVEMEATAIAQTCYQFKVPFIVTRAVSDLANGKADISFEEF
MTNN_STACT      KLGLIVSGDSFIGEVSQRETIKTNFPDAMAVEMEATAIAQTCYQFKVPFIITRAVSDLANGEANMTFDEF
MTNN_ECOHS      VRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEF
MTNN_BACCN      QVGMIATGDSFMSDPNRVAAIRGKFENLYXXXXXXXXXXQVCHQYNVPFVIIRALSDIAGKESNVSFDQF
MTNN_PHOPR      VRGLICTGDAFVCTPEKQAFIRDNFPTXXXXXXXXXXXXXXCHQFNVPFVVVRAISDVADKESPMSFEEF
MTNN_BACWK      QVGMIATGDSFMSDPNRVAAIRDKFEDLYXXXXXXXXXXQVCHQYEVPFVIIRALSDIAGKESNVSFDQF
MTNN_SERP5      VRGLICSGDAFINGAEPLARIRATFPNXXXXXXXXXXXGHVCHLFGTPFVVVRAISDVADSESHMSFEEF
MTNN_BACCZ      QVGMIATGDSFMSDPNRVAAIRDKFENLYXXXXXXXXXXQVCHQYEVPFVIIRALSDIAGKESNVSFDQF
MTNN_BACCR      QVGMIATGDSFMSDPNRVAAIRDKFENLYXXXXXXXXXXQVCHQYEIPFVIIRALSDIAGKESNVSFDQF
MTNN_BACC7      QVGMIATGDSFMSDPNRVAAIRDKFENLYXXXXXXXXXXQVCHQYEVPFVIIRALSDIAGKESNVSFDQF
MTNN_BACC4      QVGMIATGDSFMSDPNRVAAIRDKFENLYXXXXXXXXXXQVCHQYEIPFVIIRALSDIAGKESNVSFDQF
MTNN_BACC3      QVGMIATGDSFMSDPNRVAAIRDKFENLYXXXXXXXXXXQVCHQYEVPFVIIRALSDIAGKESNVSFDQF
MTNN_BACC1      QVGMIATGDSFMSDPNRVAAIRDKFENLYXXXXXXXXXXQVCHQYEVPFVIIRALSDIAGKESNVSFDQF
MTNN_BACC0      QVGMIATGDSFMSDPNRVAAIRDKFENLYXXXXXXXXXXQVCHQYEVPFVIIRALSDIAGKESNVSFDQF
MTNN_BACAN      QVGMIATGDSFMSDPNRVAAIRDKFENLYXXXXXXXXXXQVCHQYEVPFVIIRALSDIAGKESNVSFDQF
MTNN_BACAH      QVGMIATGDSFMSDPNRVAAIRDKFENLYXXXXXXXXXXQVCHQYEVPFVIIRALSDIAGKESNVSFDQF
MTNN_BACAC      QVGMIATGDSFMSDPNRVAAIRDKFENLYXXXXXXXXXXQVCHQYEVPFVIIRALSDIAGKESNVSFDQF
MTNN_BACAA      QVGMIATGDSFMSDPNRVAAIRDKFENLYXXXXXXXXXXQVCHQYEVPFVIIRALSDIAGKESNVSFDQF
MTNN_BACHK      QVGMIATGDSFMSDPNRVAAIRDKFENLYXXXXXXXXXXQVCHQYEVPFVIIRALSDIAGKESNVSFDQF
MTNN_BACC2      QVGMIATGDSFMSDPNRVAAIRDKFENLYXXXXXXXXXXQVCHQYEVPFVIIRALSDIAGKESNVSFDQF
MTNN_MANSM      KRGLICSGDSFIAGGERLAQIKADFPNVTAVEMEAAAIAQVCHXXXXXXXXXXAISDAGDGQAGMSFEEF
MTNN_TOLAT      RIGLICTGDQFMCDPDHIEQVRQTFPXXXXXXXXXXXXXQVCHQFKVPFVVIRSLSDIAGTESPSTFEEY
MTNN_BACLD      VKGTIATGDSFMSDPDRVAFIRGKFEDLYXXXXXXXXXXQVSYQFNTPFVVIRALSDIAGKESEISFDQF
MTNN_BACP2      AKGTIATGDSFMNDPNRVAFVREKFPELYXXXXXXXXXXQVCQLFGTPFVVVRALSDIAGKESNVSFDQF
MTNN_HAMD5      VQGLICSGDAFINGDQALDRIRTFFPKXXXXXXXXXXXXQVCHQFETPFVVIRAISDVADQASHLSFEQF
MTNN_HAEPS      VSGLICSGDLFVNGNDMIARIRNDFPSVKAVEMEAASIAQVCHAFQVPFVVVRAISDVADKESHLSFDEF
MTNN_BACHD      KKGLILSGDSFMSDAALVEQLKRRFNYPLCSEMEAGAIAQVCHRFGVPFVIIRSLSDIAGAEAKVSYDEF
MTNN_BACSU      AKGTIATGDSFMNDPKRVEEVRARFSDLYXXXXXXXXXXQVCHQFKTPFVVIRALSDIAGKESHVSFDQF
MTNN_BACA2      AKGTIATGDSFMNDPKRVEDVRAKFADLYXXXXXXXXXXQVCHQFKTPFVVIRALSDIAGKESDVSFDKF
MTNN_THICR      HMGLIATGDRFMHLPEDVATTREYFPDMIACEMEAAAVAQTCHAFETPFVIIRSLSDIAGKENAVTFEQY
MTNN_STAS1      KSGLIVSGDSFIGTAEQRADIKTNFPXXXXXXXXXXXXXXXCYQFNLPFIITRAISDLADGDAGITFEAF
MTNN_DESPS      FEGPVFSGDSFIHTTEQVENILKNFPQIMAVEMEGASIAQTSHLFNIPFVLIRSISDKVRETKSATYTQS
MTNN_DESAD      HQGPVLSGDSFIHTPQQISQIEQKFPDVMAVEMEGAAIAQTGFLFNVPFILIRSISDKVHEDSSAIYEQS
MTNN_MARMS      KVGLIGTGDSFMNDPVRVEAVRALFPXXXXXXXXXXXXXQVCFKFGTPFVVVRSLSDIAGKESPQSFEEY
MTNN_BACSK      EEGLIVTGDSFMGEETRVNEVKTLFPAAYCAEMEAGAIAQVCHQFQTPFVIIRALSDVAGQDAKMSYDTF
MTNN_ACTP7      VSGLICSGDVFVNGAEKIAQIRQDFPNXXXXXXXXXXXXQVCHAFNVPFVVVRAISDVADKESHLSFDEF
MTNN_ACTP2      VSGLICSGDVFVNGAEKIAQIRQDFPNXXXXXXXXXXXXQVCHAFNVPFVVVRAISDVADKESHLSFDEF
MTNN_BUCAI      IKGLILSGDTFVRENESIKILKKQFPSAIAVEMESSAIAQVCYKFNIPLIIIKSISDESDNNATVNFKEN
MTNN_ACTPJ      VSGLICSGDVFVNGAEKIAQIRQDFPNXXXXXXXXXXXXQVCHAFNVPFVVVRAISDVADKESHLSFDEF
MTNN_BUCAT      IKGLILSGDTFVRENESIKILKKQFPSAIAVEMESSAIAQVCYKFNIPLIIIKSISDASDNNATVNFKEN
MTNN_BUCA5      IKGLILSGDTFVRENESIKILKKQFPSAIAVEMESSAIAQVCYKFNIPLIIIKSISDASDNNATVNFKEN
MTNN_CHRSD      AEGLICTGDIFMADKAAVDQARERFPSMLXXXXXXXXXXQTCHLYGCPFVVIRALSDIAGKESDLSFQAF
MTNN_BAUCH      VCGQIISGDIFINGGQELYKLKRRFPQAIAVDMEVTAIAQICYLFAVPFVGIRVITDIADSVSHKSFKDN
MTNN_HAEDU      VAGLICSGDRFVNGAEQITTIRQHFDXXXXXXXXXXXXXXXCYAFEVPFVVVRAISDIADKCSHLSFEEF
MTNN_PSYIN      IQGLICTGDIFMADPTKAEIARHNFPTXXXXXXXXXXXXQVCYQFKVPFVIIRSLSDIAGKKSELSFEQY
MTNN_HELPY      KEGVIASGDQFVHSKERKEFLVSEF-KASAVEMEGASVAFVCQKFGVPCCVLRSISDNADEEANMSFDAF
MTNN_HELPJ      KEGVIASGDQFVHSKERKEFLVSEF-KASAVEMEGASVAFVCQKFGVPCCVLRSISDNADEKAGMSFDEF
MTNN_BUCAP      LTGLLVTGDSFIRKSNCIKKIKNQFSSAIGVDME------------------------------------
MTNN_BUCBP      QKKLMISGDIFIDTCEKKSLLKKRFPK-------------------------------------------
MTNN_MYCTU      YYGTILTGDQYL-HCERTRNRLHHELGGMAVEMEGGAVAQICASFDIPWLVIRALSDLAGADSGVDFNRF
MTNN_MYCBO      YYGTILTGDQYL-HCERTRNRLHHELGGMAVEMEGGAVAQICASFDIPWLVIRALSDLAGADSGVDFNRF
MTNN_TREPA      TEGAVASGDLFVSDAQTRARIIREF-GAHGVEMEGAAFAHVASVNGVPFVIIRCISDGAGAEQDV-----
DEOD_LACCB      HVGNVLGEDRFY--NDEMDRQKLIDYEVLATEME------------------------------------
DEOD_LACC3      HVGNVLGEDRFY--NDEMDRQKLIDYEVLATEME------------------------------------
MTNN_THEMA      KTGLIASGDAFVTVKEKAEEIKRR-TGALCVDMDSAAVAKVCYENEKKFLAIKTIVDICGRETEEEFRKN
FIB_SPICI       --GVTGTADMLIYNSKQFKEMVDKYGHTIDV---------------------------------------
DEOD_STRSY      HVGNVLSSDSFYSPKLFSRNLELGQLGVKAVEMEAAALYYLGAKFGVQTLAIMTISDS------------
DEOD_STRS2      HVGNVLSSDSFYSPKLFSRNLELGQLGVKAVEMEAAALYYLGAKFGVQTLAIMTISDS------------
DEOD_DICNV      RVGTVFSTDSFYHADTELMDLLKRF-HILGVEME------------------------------------
DEOD1_VIBCH     ----------------------------------------------------------------------
DEOD_BACLD      TAGNVFTADQFYNDDSQIEKLAKH--GVLAVEMETTALYTLAAKFGRKALSILTVSDH------------
DEOD_LACRJ      KVGDIFAADRFY--NDELDMEKLRDYGILGTEMESAGLYLLAAKLHFRALSVLTVSD-------------
DEOD_LACRD      KVGDIFAADRFY--NDELDMEKLRDYGILGTEMESAGLYLLAAKLHFRALSVLTVSD-------------
DEOD_ANOFW      KVGSVFTADMFYNENAQFEKLARY--GVLAVEMETTALYTLAAKFGRKALSVLTVSDH------------
DEOD_MYCGE      HEGLVFCEDAFYQTRKDVISLAKE-KNSLAVEME------------------------------------
DEOD_BACST      KVGSVFTADMFYNENAQFEKLARY--GVLAVEMETTALYTLAAKFGRKALSVLTVSDH------------
DEOD_PECCP      RVGNIFSADLFYTPDPQMFDVMEKY-GILGVEMEAAGIYGVAAEFGAKALAICTVSDHIRTGAQTTSEE-
DEOD_LISMO      KVGNVFSADRFY--NDQLDKQQLADYGVLGIEMEAAALYTLAQKYGRRALAILTVSDH------------
DEOD_LISMH      KVGNVFSADRFY--NDQLDKQQLADYGVLGIEMEAAALYTLAQKYGRRALAILTVSDH------------
DEOD_LISMF      KVGNVFSADRFY--NDQLDKQQLADYGVLGIEMEAAALYTLAQKYGRRALAILTVSDH------------
DEOD_LISMC      KVGNVFSADRFY--NDQLDKQQLADYGVLGIEMEAAALYTLAQKYGRRALAILTVSDH------------
DEOD_LISW6      KVGNVFSADRFY--NDQLDKQQLADYGVLGIEMEAAALYTLAQKYGRRALAILTVSDH------------
DEOD_LISIN      KVGNVFSADRFY--NDQLDKQQLADYGVLGIEMEAAALYTLAQKYGRRALAILTVSDH------------
DEOD_ERWCT      RVGNIFSADLFYTPDPQMFDVMEKY-GILGVEMEAAGIYGVAAEFGAKALAICTVSDHIRTGAQTTSEE-
BSPB_POPDE      ----------------------------------------------------------------------
DEOD_MYCPN      HEGLVFCEDAFHQIRKDVLKLAQE-KHALAVEMEAHALYANAMLLNKQALTMLTVSDS------------
BSPA_POPDE      ----------------------------------------------------------------------
DEOD_BACA2      AVGSVFTADQFYNEDSQIEKLARY--GVLGVEMETTALYTLAAKYGKKALSILTVSDH------------
DEOD1_VIBF1     ----------------------------------------------------------------------
DEOD_SHEDO      RVGNVFSADLFYTPDPQMFDVMEKM-GVLGVEMEAAGLYGVAHELGAKALCVVTVSDH------------
DEOD_BACSU      TVGSVFTADQFYNDDSQIEKLAKY--GVLGVEME------------------------------------
DEOD_XENNE      RVGNIFSVDLFYSPDPQMFDVMEKY-GILGVEMEAAGIYGVAAEFGAKALAICTVSDH------------
DEOD_STRZP      HVGNVLSSDVFYS-NYFEKNIELGKWGVKAVEMEXXXXXXXXXQYHVDALAIMTISDS------------
DEOD_STRZJ      HVGNVLSSDVFYS-NYFEKNIELGKWGVKAVEMEXXXXXXXXXQYHVDALAIMTISDS------------
DEOD_STRPJ      HVGNVLSSDVFYS-NYFEKNIELGKWGVKAVEMEXXXXXXXXXQYHVDALAIMTISDS------------
DEOD_STRP7      HVGNVLSSDVFYS-NYFEKNIELGKWGVKAVEMEXXXXXXXXXQYHVDALAIMTISDS------------
DEOD_STRP4      HVGNVLSSDVFYS-NYFEKNIELGKWGVKAVEMEXXXXXXXXXQYHVDALAIMTISDS------------
DEOD_STRP2      HVGNVLSSDVFYS-NYFEKNIELGKWGVKAVEMEXXXXXXXXXQYHVDALAIMTISDS------------
DEOD_OCEIH      RVGNVFTSDTFYRDNQQVNELLAKY-QVLAIEMESTALYTLAAKYGRQALSVLTVSDH------------
DEOD_LACLS      ----------------------------------------------------------------------
DEOD_LACLM      ----------------------------------------------------------------------
DEOD_LACLA      ----------------------------------------------------------------------
UDP_KLEAE       HIGVTASSDTFYPGQERYD---------------------------------------------------
DEOD_STRPF      HVGNVLSSDVFYTNMPERNMVLGKL-GVKAIEMEXXXXXXXXXQHHVKALGIMTISDNLN----------
DEOD_HAES1      --GNLFSADLFYTPDPEMFDVMEKY-GILGVEMEAAGIYGVAAEFKAKALTICTVSDHSAEERQLTFNEM
DEOD_KLEP3      RVGNIFSADLFYTPDPSMFDVMEKY-GILGVEMEAAGIYGVAAEFGAKALTICTVSDH------------
DEOD_GEOSW      ----------------------------------------------------------------------
DEOD_STRPI      HVGNVLSSDVFYS-NYFEKNIELGKWGVKAVEMEXXXXXXXXXQYHVDALAIMTISDS------------
DEOD_STRGC      HVGNVLSSDVFYS-NYFEKNIELGKWGVKAVEMEXXXXXXXXXQHHVDALAIMTISDS------------
DEOD_ERWT9      RVGNIFSADLFYTPDPQMFDVMEKY-GVLGVEMEAAGIYGVAAEFGAKALAICTVSDH------------
DEOD_DINSH      ----------------------------------------------------------------------
DEOD_CLOP1      KVGSVFTADSFY--NDNPEAWKQWAKGTLAVEMETAALYTLAAKYGVNALTILTISDH------------
DEOD1_VIBPA     ----------------------------------------------------------------------
UDP_ECOLI       HVGVTASSDTFYPGQERYD---------------------------------------------------
DEOD_STRZT      HVGNVLSSDVFYS-NYFEKNIELGKWGVKAVEMEXXXXXXXXXQYHVDALAIMTISDS------------
DEOD_STRPS      HVGNVLSSDVFYS-NYFEKNIELGKWGVKAVEMEXXXXXXXXXQYHVDALAIMTISDS------------
DEOD_STRPG      HVGNVLSSDVFYTNMPERNMALGKL-GVKAIEMEAAALYYLATQHHVKALGIMTISDNLN----------
DEOD_HAES2      ----------------------------------------------------------------------
DEOD_GEOTN      ----------------------------------------------------------------------
DEOD_COLP3      HVGNIFTADLFYTPQPEKFATMEKY-GILAVEMEAAGLYGVAAEYGKKALTVLTVSDH------------
DEOD_CLOPS      KVGSVFTADSFY--NDNPEAWKQWAKGTLAVEMETAALYTLAAKYGVNALTILTISDH------------
DEOD_BACCN      RVGNVLTADVFYRESDMVKKLGDY--GVLAVEMETTALYTLAAKYGVNALSVLTVSDH------------
DEOD_YERE8      RVGNLFSADLFYTPDPQMFDVMKKY-GILGVEMEAAGIYGVAAEFGAKALTICTVSDH------------
DEOD_STRPC      HVGNVLSSDVFYTNMPERNMALGKL-GVKAIEMEXXXXXXXXXQHHVKALGIMTISDNLN----------
DEOD_STRPB      HVGNVLSSDVFYTNMPERNMALGKL-GVKAIEMEXXXXXXXXXQHHVKALGIMTISDNLN----------
DEOD_MANSM      ----------------------------------------------------------------------
DEOD_HELPJ      KIGNVFSSDFFYSFETHAFGLMAQYNH-LAIEMEAAGLYATAMELNAKALCLCSVSDH------------
DEOD_HELAH      KVGNIFTSDFFYSFETHAFDLLAKYNH-LGIEMEAAGLYATAMELSAKALCLCSVSDH------------
DEOD_BUCAT      XXGNFFTTDSFYNDDKKMLNILKKY-NIIGVDMETAGIYGVASELKVQALSICTVSDHITNK------EF
DEOD_BUCAI      XXGNFFTTDSFYNDDKKMLNILKKY-NIIGVDMETAGIYGVASELKVQALSICTVSDHITNK------EF
DEOD_BUCA5      XXGNFFTTDSFYNDDKKMLNILKKY-NIIGVDMETAGIYGVASELKVQALSICTVSDHITNK------EF
DEOD_BACCZ      RVGNVLTADVFYRESDMVKKLADY--GVLAVEMETTALYTLAAKYGVNALSVLTVSDH------------
UDP_SALTY       HVGVTASSDTFYPGQERYD---------------------------------------------------
UDP_SALTI       HVGVTASSDTFYPGQERYD---------------------------------------------------
DEOD_SALTY      RVGNLFSADLFYSPDGEMFDVMEKY-GVLGVEMEAAGIYGVAAEFGAKALTICTVSDH------------
DEOD_SALHS      RVGNLFSADLFYSPDGEMFDVMEKY-GVLGVEMEAAGIYGVAAEFGAKALTICTVSDH------------
DEOD_ROSDO      ----------------------------------------------------------------------
DEOD_PROMH      RVGNIFSADLFYSPDPEMFDVMEKY-GILGVEMEAAGIYGVAAEYGARALTICTVSDH------------
DEOD_HAEDU      ----------------------------------------------------------------------
DEOD_BUCAP      HIGNFFTTDSFTESEDMLKILKKY--NIIGIDMETAGIYAVAAELKAQALSICTVSDH------------
DEOD_BACWK      RVGNVLTADVFYRESDMVKKLGDY--GVLAVEMETTALYTLAAKYGVNALSVLTVSDH------------
DEOD_BACHK      RVGNVLTADVFYRESDMVKKLGDY--GVLAVEMETTALYTLAAKYGVNALSVLTVSDH------------
DEOD_BACCQ      RVGNVLTADVFYRESDMVKKLGDY--GVLAVEMETTALYTLAAKYGVNALSVLTVSDH------------
DEOD_BACCE      RVGNVLTADVFYRESDMVKKLGDY--GVLAVEMETTALYTLAAKYGVNALSVLTVSDH------------
DEOD_BACC7      RVGNVLTADVFYRESDMVKKLGDY--GVLAVEMETTALYTLAAKYGVNALSVLTVSDH------------
DEOD_BACC4      RVGNVLTADVFYRESDMVKKLGDY--GVLAVEMETTALYTLAAKYGVNALSVLTVSDH------------
DEOD_BACC3      RVGNVLTADVFYRESDMVKKLGDY--GVLAVEMETTALYTLAAKYGVNALSVLTVSDH------------
DEOD_BACC2      RVGNVLTADVFYRESDMVKKLGDY--GVLAVEMETTALYTLAAKYGVNALSVLTVSDH------------
DEOD_BACC1      RVGNVLTADVFYRESDMVKKLGDY--GVLAVEMETTALYTLAAKYGVNALSVLTVSDH------------
DEOD_BACC0      RVGNVLTADVFYRESDMVKKLGDY--GVLAVEMETTALYTLAAKYGVNALSVLTVSDH------------
DEOD_BACAN      RVGNVLTADVFYRESDMVKKLGDY--GVLAVEMETTALYTLAAKYGVNALSVLTVSDH------------
DEOD_BACAH      RVGNVLTADVFYRESDMVKKLGDY--GVLAVEMETTALYTLAAKYGVNALSVLTVSDH------------
DEOD_BACAC      RVGNVLTADVFYRESDMVKKLGDY--GVLAVEMETTALYTLAAKYGVNALSVLTVSDH------------
DEOD_BACAA      RVGNVLTADVFYRESDMVKKLGDY--GVLAVEMETTALYTLAAKYGVNALSVLTVSDH------------
DEOD_STRU0      ----------------------------------------------------------------------
DEOD_SHEFN      RVGNVFSADLFYTPDPQMFDVMEKM-GILGVEMEAAGLYGVAHELGAKALCVVTVSDH------------
DEOD_SALG2      RVGNLFSADLFYSPDGEMFDVMEKY-GVLGVEMEAAGIYGVAAEFGAKALTICTVSDH------------
DEOD_HAHCH      HVGALFTTDLFYAADPGLERLSAH--GVKAVEME------------------------------------


                         .         .         .         +         .         .         .:280
query           IIEAGRRSAQVLLTFLKALD
MTNN_LISW6      IHLAAKQSATCIIELLKTI-
MTNN_LISMO      IHLAAKQSATCIIELLKTI-
MTNN_LISMF      IHLAARQSATCIIELLKTI-
MTNN_LISMC      IHLAAKQSATCIIELLKTI-
MTNN_LISMH      IHLAAKQSATCIIELLKTI-
MTNN_LISIN      IHLAAKQSAICIIELLKTI-
MTNN_SHEWM      IVKAGHHSALMVMSLLKHL-
MTNN_ENTS8      LAVAAKQSSLMVETLLTSLN
MTNN_SHESH      LVKAGHHSALMVIALLEQL-
MTNN_SHESA      IVKAGYHSALMVMLLLEQLD
MTNN_AERHH      IEVAGKHSAEVIIKMLGKL-
MTNN_SHEDO      IIKAGHHSAMMVVALLTEL-
MTNN_SHESR      IVKAGYHSALMVMLLLEQLD
MTNN_SHESM      IVKAGYHSALMVMLLLEQLD
MTNN_SHELP      LVKAGHHSALMVISLLKHL-
MTNN_HAES2      LPLAARQSSSMVLKILQSL-
MTNN_SHEB8      IVKAGYHSALMVMLLLEQLN
MTNN_SHEB5      IVKAGYHSALMVMLLLEQLN
MTNN_SHEB9      IVKAGYHSALMVMLLLEQLN
MTNN_SHEB2      IVKAGYHSALMVMLLLEQLN
MTNN_ALISL      LPLAAESSSEMVMKMVTLL-
MTNN_SHESW      IVKAGYHSALMVMLLLEQL-
MTNN_SHEPC      IVKAGYHSALMVMLLLEQL-
MTNN_ESCF3      LAVAAKQSSLMVETLVQKL-
MTNN_SHEFN      IIKAGMHSAMMVIALLQQL-
MTNN_OCEIH      LQTAGKNAAQLIINMVKKI-
MTNN_SALTY      LAVAAKQSTLMVETLVQKL-
MTNN_SALTI      LAVAAKQSTLMVETLVQKL-
MTNN_SALSV      LAVAAKQSTLMVETLVQKL-
MTNN_SALPK      LAVAAKQSTLMVETLVQKL-
MTNN_SALPC      LAVAAKQSTLMVETLVQKL-
MTNN_SALPB      LAVAAKQSTLMVETLVQKL-
MTNN_SALDC      LAVAAKQSTLMVETLVQKL-
MTNN_SALCH      LAVAAKQSTLMVETLVQKL-
MTNN_SALA4      LAVAAKQSTLMVETLVQKL-
MTNN_HAES1      LPLAAKQSSSMVLKILQSL-
MTNN_SHEON      IVKAGYHSALMVMLLLEQLE
MTNN_SALNS      LAVAAKQSTLMVETLVQKL-
MTNN_SALHS      LAVAAKQSTLMVETLVQKL-
MTNN_SALG2      LAVAAKQSTLMVETLVQKL-
MTNN_SALEP      LAVAAKQSTLMVETLVQKL-
MTNN_VIBFM      LPLAAQSSSEMVLNMVTLL-
MTNN_VIBF1      LPLAAQSSSEMVLNMVTLL-
MTNN_VIBFI      LPLAAQSSSEMVLNMVTLL-
MTNN_AERS4      IEVAGQHSAEMIIKMLGKL-
MTNN_VIBVY      LPLAAKSSSEMVFKMLELL-
MTNN_VIBVU      LPLAAKSSSEMVFKMLELL-
MTNN_STAHJ      LGEAAKSSSSIVESLIKVL-
MTNN_SHEHH      IVKAGHHSALMVIALLKQL-
MTNN_LYSSC      LPVAAKHSTQVVLKAIASL-
MTNN_KLEP7      LAVAARQSTLMVENLVQNL-
MTNN_STAAB      LEKAAVSSSQTVEALVSQL-
MTNN_SHEPA      IVKAGHHSALMVIALLEQL-
MTNN_YERPY      LVVAAKQSTLMIEAMLTTL-
MTNN_YERPS      LVVAAKQSTLMIEAMLTTL-
MTNN_YERPB      LVVAAKQSTLMIEAMLTTL-
MTNN_YERP3      LVVAAKQSTLMIEAMLTTL-
MTNN_VIBHB      LPLAAKSSSEMVCKMLE---
MTNN_VIBCM      LPLAAKSSSAMVLKMVELL-
MTNN_VIBCH      LPLAAKSSSAMVLKMVELL-
MTNN_VIBC3      LPLAAKSSSAMVLKMVELL-
MTNN_STAAW      LEKAAVSSSQTVEALVSQL-
MTNN_STAAT      LEKAAVSSSQTVEALVSQL-
MTNN_STAAS      LEKAAVSSSQTVEALVSQL-
MTNN_STAAN      LEKAAVSSSQTVEALVSQL-
MTNN_STAAM      LEKAAVSSSQTVEALVSQL-
MTNN_STAAE      LEKAAVSSSQTVEALVSQL-
MTNN_STAAC      LEKAAVSSSQTVEALVSQL-
MTNN_STAA9      LEKAAVSSSQTVEALVSQL-
MTNN_STAA8      LEKAAVSSSQTVEALVSQL-
MTNN_STAA3      LEKAAVSSSQTVEALVSQL-
MTNN_STAA2      LEKAAVSSSQTVEALVSQL-
MTNN_STAA1      LEKAAVSSSQTVEALVSQL-
MTNN_STAAR      LEKAAVSSSQTVEALVSQL-
MTNN_ERWCT      LSVAAQQSTRMVEAILAKL-
MTNN_CITK8      LAVAAKQSSLMVETLVQKL-
MTNN_KLEP3      LAVAARQSTLMVENLVQNL-
MTNN_ANOFW      LQKAALHSSELVQLMVNELN
MTNN_YERPP      LVVAAKQSTLMIKAMLTTL-
MTNN_YERPN      LVVAAKQSTLMIKAMLTTL-
MTNN_YERPG      LVVAAKQSTLMIKAMLTTL-
MTNN_YERPE      LVVAAKQSTLMIKAMLTTL-
MTNN_YERPA      LVVAAKQSTLMIKAMLTTL-
MTNN_YERE8      LVVAAKQSTLMIEAMLTSL-
MTNN_EXISA      LETASINSAKMVMAVTKRLE
MTNN_SALAR      LAVAAKQSTLMVETLVQKL-
MTNN_PECCP      LSVAAQQSTRMVEAILAKL-
MTNN_ENT38      LAVAAKQSTIMVETLVQKL-
MTNN_SHEAM      LVKAGHHSALMVMALIEGL-
MTNN_ACTSZ      LPIAAKQSCEMVLGMLAELE
MTNN_SODGM      LTVAAQSSSRLVEEMVQAL-
MTNN_PASMU      LPLAAKQSSAMVLEMIDNL-
MTNN_PSEHT      LETASINSSKMVVALLEKL-
MTNN_SALPA      LAVAAKQSTLMVETLVQKL-
MTNN_PROMH      LSVAAQQSSLMVTTMLDKL-
MTNN_ERWT9      LAVAAKQSSLLVEKLLAHL-
MTNN_VIBPA      LPLAAKSSSEMVFKMLE---
MTNN_HAEIE      LPLAAKQSSALVLEMIDRL-
MTNN_VIBSL      LPLAAQSSSEMVIKMVALL-
MTNN_GEOSW      LDTAAKHSADLVLSIVSSL-
MTNN_COLP3      LETAAVNSSQLVLNMLGQL-
MTNN_PHOLL      LAVAARQSTLMVNAMLATL-
MTNN_EXIS2      LEIASINSAKMVMEVVRTL-
MTNN_GEOKA      LETAAKHSAELVLSMLSVM-
MTNN_GEOTN      LETAAKHSAELVLSML----
MTNN_HAEIN      LPLAAKQSSALVLGMIDRL-
MTNN_HAEIG      LPLAAKQSSTLVLGMIDRL-
MTNN_HAEI8      LPLAAKQSSALVLGMIDRL-
MTNN_EDWI9      LKVAAEQSTLMVEAMLRAM-
MTNN_SHEPW      IIKAGLHSALMVIALIKQL-
MTNN_SHISS      LAVAAKQSSLMVESLVQKL-
MTNN_SHIFL      LAVAAKQSSLMVESLVQKL-
MTNN_SHIF8      LAVAAKQSSLMVESLVQKL-
MTNN_SHIDS      LAVAAKQSSLMVESLVQKL-
MTNN_SHIB3      LAVAAKQSSLMVESLVQKL-
MTNN_ECOUT      LAVAAKQSSLMVESLVQKL-
MTNN_ECOSM      LAVAAKQSSLMVESLVQKL-
MTNN_ECOSE      LAVAAKQSSLMVESLVQKL-
MTNN_ECOLU      LAVAAKQSSLMVESLVQKL-
MTNN_ECOLI      LAVAAKQSSLMVESLVQKL-
MTNN_ECOLC      LAVAAKQSSLMVESLVQKL-
MTNN_ECOL6      LAVAAKQSSLMVESLVQKL-
MTNN_ECOL5      LAVAAKQSSLMVESLVQKL-
MTNN_ECOK1      LAVAAKQSSLMVESLVQKL-
MTNN_ECODH      LAVAAKQSSLMVESLVQKL-
MTNN_ECOBW      LAVAAKQSSLMVESLVQKL-
MTNN_ECO8A      LAVAAKQSSLMVESLVQKL-
MTNN_ECO81      LAVAAKQSSLMVESLVQKL-
MTNN_ECO7I      LAVAAKQSSLMVESLVQKL-
MTNN_ECO5E      LAVAAKQSSLMVESLVQKL-
MTNN_ECO57      LAVAAKQSSLMVESLVQKL-
MTNN_ECO55      LAVAAKQSSLMVESLVQKL-
MTNN_ECO45      LAVAAKQSSLMVESLVQKL-
MTNN_ECO27      LAVAAKQSSLMVESLVQKL-
MTNN_ECO24      LAVAAKQSSLMVESLVQKL-
MTNN_SHIBS      LAVAAKQSSLMVESLVQKL-
MTNN_STAES      LDKA----------------
MTNN_STAEQ      LDKA----------------
MTNN_STACT      IGEAAKSSSEIVLEMLKSL-
MTNN_ECOHS      LAVAAKQSSLMVESLVQKL-
MTNN_BACCN      LDQAALHSTNFIVKVLKEL-
MTNN_PHOPR      LPLAAQSSSVMVAKMVEILN
MTNN_BACWK      LDQAALHSTNFIVKVLEEL-
MTNN_SERP5      LVVAAKQSTLMVNAMLQTL-
MTNN_BACCZ      LDQAALHSTNFIVKVLEEL-
MTNN_BACCR      LDQAALHSTNFIVKVLEEL-
MTNN_BACC7      LDQAALHSTNFIVKVLEEL-
MTNN_BACC4      LDQAALHSTNFIVKVLEEL-
MTNN_BACC3      LDQAALHSTNFIVKVLEEL-
MTNN_BACC1      LDQAALHSTNFIVKVLEEL-
MTNN_BACC0      LDQAALHSTNFIVKVLEEL-
MTNN_BACAN      LDQAALHSTNFIVKVLEEL-
MTNN_BACAH      LDQAALHSTNFIVKVLEEL-
MTNN_BACAC      LDQAALHSTNFIVKVLEEL-
MTNN_BACAA      LDQAALHSTNFIVKVLEEL-
MTNN_BACHK      LDQAALHSTNFIVKVLEEL-
MTNN_BACC2      LDQAALHSTNFIVKVLEEL-
MTNN_MANSM      LPIAAKQSSAMIIGMLEQL-
MTNN_TOLAT      LEVAAKNSSAMIVAMLKQL-
MTNN_BACLD      LEQAAKHSTDLVLRMIKRIN
MTNN_BACP2      LEQAAIHSTDLVLRMIK---
MTNN_HAMD5      LCIAAQRSSTVIENMLPIL-
MTNN_HAEPS      LPLAAEKSSEIVLAML----
MTNN_BACHD      LETASVNSANLVLAIVGRL-
MTNN_BACSU      LEQAAVHSTELVLKVIKRI-
MTNN_BACA2      LEQAAVHSTELVLNVIKRI-
MTNN_THICR      LDKAATHSARLILEMLTHL-
MTNN_STAS1      LEKAAIASSQIVDRLIKTI-
MTNN_DESPS      MEESAKNSVQVVFEMVEQL-
MTNN_DESAD      MEKAAANSVRMVLSMLKEL-
MTNN_MARMS      LKVAAENSSLMIQQMLK---
MTNN_BACSK      LEKSAVNSAKQVMLMLDHL-
MTNN_ACTP7      LPLAAKNSSEIVVAML----
MTNN_ACTP2      LPLAAKNSSEIVVAML----
MTNN_BUCAI      I-------------------
MTNN_ACTPJ      LPLAAKNSSEIVVAML----
MTNN_BUCAT      I-------------------
MTNN_BUCA5      I-------------------
MTNN_CHRSD      IEKAATHSAMMVEAMVKRL-
MTNN_BAUCH      LITVVSHLSLLVSDIIQAL-
MTNN_HAEDU      LPLAAEKSSEIVIAML----
MTNN_PSYIN      LPIAAKNAS-----------
MTNN_HELPY      L----EKSAQTSAKFLKSM-
MTNN_HELPJ      LEKSAHTSAKFLKSMVDEL-
MTNN_BUCAP      --------------------
MTNN_BUCBP      --------------------
MTNN_MYCTU      VGE-----------------
MTNN_MYCBO      VGE-----------------
MTNN_TREPA      --------------------
DEOD_LACCB      --------------------
DEOD_LACC3      --------------------
MTNN_THEMA      YERYGFLSNLILLDVLK---
FIB_SPICI       --------------------
DEOD_STRSY      --------------------
DEOD_STRS2      --------------------
DEOD_DICNV      --------------------
DEOD1_VIBCH     --------------------
DEOD_BACLD      --------------------
DEOD_LACRJ      --------------------
DEOD_LACRD      --------------------
DEOD_ANOFW      --------------------
DEOD_MYCGE      --------------------
DEOD_BACST      --------------------
DEOD_PECCP      --------------------
DEOD_LISMO      --------------------
DEOD_LISMH      --------------------
DEOD_LISMF      --------------------
DEOD_LISMC      --------------------
DEOD_LISW6      --------------------
DEOD_LISIN      --------------------
DEOD_ERWCT      --------------------
BSPB_POPDE      --------------------
DEOD_MYCPN      --------------------
BSPA_POPDE      --------------------
DEOD_BACA2      --------------------
DEOD1_VIBF1     --------------------
DEOD_SHEDO      --------------------
DEOD_BACSU      --------------------
DEOD_XENNE      --------------------
DEOD_STRZP      --------------------
DEOD_STRZJ      --------------------
DEOD_STRPJ      --------------------
DEOD_STRP7      --------------------
DEOD_STRP4      --------------------
DEOD_STRP2      --------------------
DEOD_OCEIH      --------------------
DEOD_LACLS      --------------------
DEOD_LACLM      --------------------
DEOD_LACLA      --------------------
UDP_KLEAE       --------------------
DEOD_STRPF      --------------------
DEOD_HAES1      I-------------------
DEOD_KLEP3      --------------------
DEOD_GEOSW      --------------------
DEOD_STRPI      --------------------
DEOD_STRGC      --------------------
DEOD_ERWT9      --------------------
DEOD_DINSH      --------------------
DEOD_CLOP1      --------------------
DEOD1_VIBPA     --------------------
UDP_ECOLI       --------------------
DEOD_STRZT      --------------------
DEOD_STRPS      --------------------
DEOD_STRPG      --------------------
DEOD_HAES2      --------------------
DEOD_GEOTN      --------------------
DEOD_COLP3      --------------------
DEOD_CLOPS      --------------------
DEOD_BACCN      --------------------
DEOD_YERE8      --------------------
DEOD_STRPC      --------------------
DEOD_STRPB      --------------------
DEOD_MANSM      --------------------
DEOD_HELPJ      --------------------
DEOD_HELAH      --------------------
DEOD_BUCAT      LSSKERESS-----------
DEOD_BUCAI      LSSKERESS-----------
DEOD_BUCA5      LSSKERESS-----------
DEOD_BACCZ      --------------------
UDP_SALTY       --------------------
UDP_SALTI       --------------------
DEOD_SALTY      --------------------
DEOD_SALHS      --------------------
DEOD_ROSDO      --------------------
DEOD_PROMH      --------------------
DEOD_HAEDU      --------------------
DEOD_BUCAP      --------------------
DEOD_BACWK      --------------------
DEOD_BACHK      --------------------
DEOD_BACCQ      --------------------
DEOD_BACCE      --------------------
DEOD_BACC7      --------------------
DEOD_BACC4      --------------------
DEOD_BACC3      --------------------
DEOD_BACC2      --------------------
DEOD_BACC1      --------------------
DEOD_BACC0      --------------------
DEOD_BACAN      --------------------
DEOD_BACAH      --------------------
DEOD_BACAC      --------------------
DEOD_BACAA      --------------------
DEOD_STRU0      --------------------
DEOD_SHEFN      --------------------
DEOD_SALG2      --------------------
DEOD_HAHCH      --------------------