[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for spne4:ACF55245.1

[Show Plain Result]


## Summary of Sequence Search
    1::230
    1::218     1e-34  33%  236 aa  TENA_BACSU RecName: Full=Thiaminase-2;         EC=3.5.99.2;AltName:
    1::222     5e-23  30%  229 aa  TENA_STAES RecName: Full=Putative thiaminase-2;       
    1::222     5e-23  30%  229 aa  TENA_STAEQ RecName: Full=Putative thiaminase-2;       
    1::221     1e-22  29%  229 aa  TENA_STAS1 RecName: Full=Putative thiaminase-2;       
    1::222     5e-19  28%  229 aa  TENA_STAAR RecName: Full=Putative thiaminase-2;       
    1::222     7e-19  29%  229 aa  TENA_STAAB RecName: Full=Putative thiaminase-2;       
    1::222     1e-18  28%  229 aa  TENA_STAAW RecName: Full=Putative thiaminase-2;       
    1::222     1e-18  28%  229 aa  TENA_STAAS RecName: Full=Putative thiaminase-2;       
    1::222     1e-18  28%  229 aa  TENA_STAAN RecName: Full=Putative thiaminase-2;       
    1::222     1e-18  28%  229 aa  TENA_STAAM RecName: Full=Putative thiaminase-2;       
    1::222     1e-18  28%  229 aa  TENA_STAAC RecName: Full=Putative thiaminase-2;       
    1::222     1e-18  28%  229 aa  TENA_STAA3 RecName: Full=Putative thiaminase-2;       
   13::210     2e-18  27%  215 aa  Y358_HAEIN RecName: Full=Uncharacterized protein HI0358;
    1::222     2e-18  28%  229 aa  TENA_STAA8 RecName: Full=Putative thiaminase-2;       
   23::222     6e-18  30%  228 aa  TENA_STACT RecName: Full=Putative thiaminase-2;       
    1::221     3e-14  24%  229 aa  TENA_STAHJ RecName: Full=Putative thiaminase-2;       
  336::549     4e-14  25%  551 aa  THI22_SCHPO RecName: Full=Putative phosphomethylpyrimidine kinase
  344::551     2e-11  23%  551 aa  THI21_YEAST RecName: Full=Phosphomethylpyrimidine kinase THI21;    
  570::755     5e-10  28%  763 aa  THIED_CORGL RecName: Full=Multifunctional protein thiED;Includes:
  547::684     4e-09  25%  739 aa  THIED_COREF RecName: Full=Multifunctional protein thiED;Includes:
  344::551     4e-09  22%  551 aa  THI20_YEAST RecName: Full=Phosphomethylpyrimidine kinase THI20;    
  288::431     9e-06  31%  846 aa  MUTS_LEGPL RecName: Full=DNA mismatch repair protein mutS;
   30::209     3e-05  27%  236 aa  PQQCL_CHLMU RecName: Full=PqqC-like protein;AltName: Full=Chlamydia
  288::431     3e-04  29%  846 aa  MUTS_LEGPH RecName: Full=DNA mismatch repair protein mutS;
  288::431     3e-04  29%  846 aa  MUTS_LEGPC RecName: Full=DNA mismatch repair protein mutS;
  288::431     3e-04  29%  846 aa  MUTS_LEGPA RecName: Full=DNA mismatch repair protein mutS;
  672::794     5e-04  28%  802 aa  UHRF2_HUMAN RecName: Full=E3 ubiquitin-protein ligase UHRF2;       
   15::134     5e-04  22%  224 aa  PQQCL_CHLPN RecName: Full=PqqC-like protein;AltName: Full=Chlamydia
    1::230

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MEFTDIAMELSKKAWQASFHHPFILQLQEGNLEPAIFRYYLIQDAYYLKAFSEIYHLLADKTSNQEMKRL
TENA_BACSU      MKFSEECRSAAAEWWEGSFVHPFVQGIGDGTLPIDRFKYYVLQDSYYLTHFAKVQSFGAAYAKDLYTTGR
TENA_STAES      MTFSKELREASRPIIDDIYNDGFIQDLLAGKLSNQAVRQYLRADASYLKEFTNIYAMLIPKMSSMEDVKF
TENA_STAEQ      MTFSKELREASRPIIDDIYNDGFIQDLLAGKLSNQAVRQYLRADASYLKEFTNIYAMLIPKMSSMEDVKF
TENA_STAS1      MLFSEQLKKEAKPIINQIYHDPFIQGMLHGNLPTEATKFYLRADASYLNEFANIYALLIPKMGNLNDVRF
TENA_STAAR      -------MEFSQKLYQAAYEDDFIQKMLLGNIQADALRHYLQADAAYLKEFTNLYALLIPKMNSMNDVKF
TENA_STAAB      -------MEFSQKLYQAAYEDDFIQKMLLGNIQADALRHYLQADAAYLKEFTNLYALLIPKMNSMNDVKF
TENA_STAAW      -------MEFSQKLYQAAYEDDFIQKMLSGDIGADALRHYLKADAAYLKEFTNLYALLIPKMNSMNDVKF
TENA_STAAS      -------MEFSQKLYQAAYEDDFIQKMLSGDIGADALRHYLKADAAYLKEFTNLYALLIPKMNSMNDVKF
TENA_STAAN      -------MEFSQKLYQAAYEDDFIQKMLSGDIGADALRHYLKADAAYLKEFTNLYALLIPKMNSMNDVKF
TENA_STAAM      -------MEFSQKLYQAAYEDDFIQKMLSGDIGADALRHYLKADAAYLKEFTNLYALLIPKMNSMNDVKF
TENA_STAAC      -------MEFSQKLYQAAYEDDFIQKMLSGDIGADALRHYLKADAAYLKEFTNLYALLIPKMNSMNDVKF
TENA_STAA3      -------MEFSQKLYQAAYEDDFIQKMLSGDIGADALRHYLKADAAYLKEFTNLYALLIPKMNSMNDVKF
Y358_HAEIN      --------------WQQYIEHEFVQQLAKGTLPKACFQHYLKQDYLYLFHYSRAFALGVFKAKNFAEMET
TENA_STAA8      -------MEFSQKLYQAAYEDDFIQKMLSGDIGADALRHYLKADAAYLKEFTNLYALLIPKMNSMNDVKF
TENA_STACT      ----------------------FIQELLKGDIKKEALRQYLRADASYLREFANIYALLIPIMPDLESVRF
TENA_STAHJ      MTFSTEIKEAAQPIIEEIYNDGFIQDLLKGDLDAQAVRQYLRADASYLKEFTNLYALLIPKAPSMKDVKF
THI22_SCHPO     -------------AWKEYINHKFTNMLAKGTLPLPAFQDYLKQDYLYLVNFARAYSLKGYKENTFPNILE
THI21_YEAST     -----------KPHWDSYVNHDFVRKVADGSLEPKKFQFFIEQDYLYLVNYARISCIAGSKSEDLEKELV
THIED_CORGL     ----------------------FITMLGDGTLRRPEFDFYIDQDAQYLAQYSRALARLSSIAPDSHAQIE
THIED_COREF     ----------------------FIRGLGDGTLSREEFLFYIDQDAHYLRQYSRALATLSSRAPDAPAQVD
THI20_YEAST     -----------KPHWDSYINHEFVKKVADGTLERKKFQFFIEQDYAYLVDYARVHCIAGSKACLEDMEKE
MUTS_LEGPL      ---------------------------------------------------------ILDKTACAMGSRL
PQQCL_CHLMU     --------------------HPFYMKWSKGELTKEQLQAYAKDYYLHIKAFPKYLSAIHSRCDDLEARKL
MUTS_LEGPH      ---------------------------------------------------------ILDKTACAMGSRL
MUTS_LEGPC      ---------------------------------------------------------ILDKTACAMGSRL
MUTS_LEGPA      ---------------------------------------------------------ILDKTACAMGSRL
UHRF2_HUMAN     ---------------------------------PSASKVYKASDAEAIEAFQQQQHLIREDCQNQ---KL
PQQCL_CHLPN     ---------------QHMLKHEFYQRWSEGKLEKQQLQAYAKDYYLHIKAFPCYLSALHARCDDLQIRRQ


                         .         .         *         .         .         .         .:140
query           LKQNAQGLVEGELFIRQQFFKELEISDQEMEQHPIAPTCYHYISHIYRQFAEPNLAIAFASLLPCPWLYH
TENA_BACSU      MASHAQGTYEAEMALHRXXXXXXXXXXXXRKAFKPSPTAYSYTSHMYRSVLSGNFAEILAALLPCYWLYY
TENA_STAES      LVEQIEFMLEGEVEAHEVLADFINEPYEEIVKEKVPPSGDHYIKHMYNAFARENAAFTIAAMAPCPYVYA
TENA_STAEQ      LVEQIEFMLEGEVEAHEVLADFINEPYEEIVKEKVPPSGDHYIKHMYNAFARENAAFTIAAMAPCPYVYA
TENA_STAS1      LVEQIQFIVDGEVEAHEILADYVQESYNEIVQEKVPPSGDHYIKHMYNAYAKENAAYTIAAMAPCPYVYQ
TENA_STAAR      LVEQIEFMVEGEVLAHDILAQIVGESYEEIIKTKVPPSGDHYIKHMYFQHSRENAIYTIAAMAPCPYIYA
TENA_STAAB      LVEQIEFMVEGEVLAHDILAQIVGESYEEIINTKFPPSGDHYIKHMYFQHSRENAIYTIAAMAPCPYIYA
TENA_STAAW      LVEQIEFMVEGEVLAHDILAQIVGESYEEIIKTKVPPSGDHYIKHMYFQHSRENAIYTIAAMAPCPYIYA
TENA_STAAS      LVEQIEFMVEGEVLAHDILAQIVGESYEEIIKTKVPPSGDHYIKHMYFQHSRENAIYTIAAMAPCPYIYA
TENA_STAAN      LVEQIEFMVEGEVLAHDILAQIVGESYEEIIKTKVPPSGDHYIKHMYFQHSRENAIYTIAAMAPCPYIYA
TENA_STAAM      LVEQIEFMVEGEVLAHDILAQIVGESYEEIIKTKVPPSGDHYIKHMYFQHSRENAIYTIAAMAPCPYIYA
TENA_STAAC      LVEQIEFMVEGEVLAHDILAQIVGESYEEIIKTKVPPSGDHYIKHMYFQHSRENAIYTIAAMAPCPYIYA
TENA_STAA3      LVEQIEFMVEGEVLAHDILAQIVGESYEEIIKTKVPPSGDHYIKHMYFQHSRENAIYTIAAMAPCPYIYA
Y358_HAEIN      PRKTLEILCQ-EIQLHLNYCREWGISEQEIFTTQESAACIAYTRYLLDCGMTGSLAELYAAVTPCALGYA
TENA_STAA8      LVEQIEFMVEGEVLAHDILAQIVGESYEEIIKTKVPPSGDHYIKHMYFQHSRENAIYTIAAMAPCPYIYA
TENA_STACT      LVDQIQFIVNGEVEAHEYMADYIGENYNEIVQKKVPPSGDHYIKHMYNVYXXXXXXXXXXXXXPCPYVYA
TENA_STAHJ      LVEQIEFMLDGEVEAHEILADYINEPYEEIVKEKVPPSGDHYIKXXXXXXXXXXXXXTIAAMAPCPYVYE
THI22_SCHPO     AAQSVIHVIE-EKELHVSMCSSYGVSLQDLKSCEESPACTAYSRYILDTGAAQDVAALDFVQAPCLIGYY
THI21_YEAST     IVECVRGLCQHERRLREEFGIKDPDYLQKIQRGPALRAYCRYFNDVSRRGNWQELVIA---LNPCLMGYH
THIED_CORGL     WAQSAAECLVVEAELHRSYMAGKEVSA------PSHITMAYTDFLIARTYTE-DYVCGVAAVLPCYWLYA
THIED_COREF     WATSAAECITVEAELHRTYLNK---GLAETGVSAPSPVTMAYTDFLIARSHADDYVVGAAAVLPCYWLYA
THI20_YEAST     LV--IVGGVRTEMGQHEKRLKEVGVKDQKIKRGPALRAYSRYFNDVSRR---GNWQELVASLTPCLMGYG
MUTS_LEGPL      LKRWLGKPLKQHAIIRQQAIKEIIFLQQDVSLHQLIKQCARIVSRIALKSARPDLVSLLQTLILLPAIHD
PQQCL_CHLMU     LLDNLMDEENGHIDLWKQFVFALGVSSEELEAHEPSEAAKAKVATFMRWCTGDSLAAGVAALIPCV-AKE
MUTS_LEGPH      LKRWLGKPLKQHAIIRQQAIKEIIFLQQDVSLHQLIKQCARIVSRIALKSARPDXXXXXXXXXXXPAIHD
MUTS_LEGPC      LKRWLGKPLKQHAIIRQQAIKEIIFLQQDVSLHQLIKQCARIVSRIALKSARPDXXXXXXXXXXXPAIHD
MUTS_LEGPA      LKRWLGKPLKQHAIIRQQAIKEIIFLQQDVSLHQLIKQCARIVSRIALKSARPDXXXXXXXXXXXPAIHD
UHRF2_HUMAN     WDEVLSHLVEGPNFLKKLEQSFMCVCCQELVYQPVTTECFHNVCKLQRSFK--------AQVFSCPACRH
PQQCL_CHLPN     ILENLMDEEAGNIDLWRQFALSLGVSEEELANHEFSQAAQDMVATFRRLCDMPQLAVGLGAL--------


                         +         .         .         .         .         *         .:210
query           DIGKSLNLKPSPNPLYQQWIETYITDELEQQIREEGALVNQLYRESDETDKQKMLDAFHISVHMEAKFWE
TENA_BACSU      EVGEKLLHCDPGHPIYQKWIGTYGGDWFRQQVEEQINRFDELAENSTEEVRAKMKENFVISSYYEYQFWG
TENA_STAES      VIGKRAMEDPKLNSVTSKWFQFYST-EMDELVDVFDQLMDRLTKHCSETEKKEIKENFLQSTIHERHFFN
TENA_STAEQ      VIGKRAMEDPKLNSVTSKWFQFYST-EMDELVDVFDQLMDRLTKHCSETEKKEIKENFLQSTIHERHFFN
TENA_STAS1      FIAQEADKELNKDSILAKWFEFYST-EMDELVIVFDNLMDKLTKHCSEKEKNEIKQCFLQSTVHERNFFN
TENA_STAAR      ELAKQSDHKLNREKDTAKWFDFYST-EMDDIINVFESLMNKLAESMSDKELEQVKQVFLESCIHERRFFN
TENA_STAAB      ELAKQSDHKLNREKDTAKWFDFYST-EMDDIINVFEALMNKLAESMSDKELEQVKQVFLESCIHERRFFN
TENA_STAAW      ELAKQSDHKLNREKDTAKWFDFYST-EMDDIINVFEALMNKLAESMSDKELEQVKQVFLESCIHERRFFN
TENA_STAAS      ELAKQSDHKLNREKDTAKWFDFYST-EMDDIINVFEALMNKLAESMSDKELEQVKQVFLESCIHERRFFN
TENA_STAAN      ELAKQSDHKLNREKDTAKWFDFYST-EMDDIINVFEALMNKLAESMSDKELEQVKQVFLESCIHERRFFN
TENA_STAAM      ELAKQSDHKLNREKDTAKWFDFYST-EMDDIINVFEALMNKLAESMSDKELEQVKQVFLESCIHERRFFN
TENA_STAAC      ELAKQSDHKLNREKDTAKWFDFYST-EMDDIINVFEALMNKLAESMSDKELEQVKQVFLESCIHERRFFN
TENA_STAA3      ELAKQSDHKLNREKDTAKWFDFYST-EMDDIINVFEALMNKLAESMSDKELEQVKQVFLESCIHERRFFN
Y358_HAEIN      QVARYIHYPRLPNNPYQTWIDTYASEEFQQAAQETVDFLTALCKPLNPSQLAEIQQIFTTATRMEIAFWQ
TENA_STAA8      ELAKQSDHKLNREKDTAKWFDFYST-EMDDIINVFEAIMNKLAESMSDKELEQVKQVFLESCIHERRFFN
TENA_STACT      MIAKRAMKDPNLNSILAKWFEFYNT-EMDPLIEVLDDLMNQLTANMSETEKNEVRENYLQSTVHELNFFN
TENA_STAHJ      VVAKMADQNLNRDSVTSKWFDFYST-EMRPLIEVFDNLLDELTANCTEQEKKDIKESFLQSTIHERNFFN
THI22_SCHPO     VIAARLMKEPFRNPQYQKWVDNYFCEDYLSAVRRGCRQIEEIVLKLSPERIQELIEIFIRATKFETLFWE
THI21_YEAST     ALTKIKDVTAAEGSVYREWCETYSSSWCHEAMLEGEKLLNHILETYPPEKLDTLVTIYAEVCELEANFWT
THIED_CORGL     EIGLMLAEQNHDEHPYKDWLNTYSGEEF---IAGTRAAIARLEKALENAGAEQRVDALSASVH-EREFFD
THIED_COREF     EIGLILAKQNHPEHPYTDWLDTY-----------------------------------------------
THI20_YEAST     EALTKMKGKVTEGSVYHEWCETYASSWYREAMDEGEKLLNHILETYPPEQLDTLVTIYAEVCELETNFWT
MUTS_LEGPL      ELQENKTLEISPLPLLQQLLETAIIDNPPMLIRDGGVIAPGFDEELDE----------------------
PQQCL_CHLMU     KIRGLIEYFGFSNPEDY----AYFTEHEEADVREEKALIEMLSRD----DSDKVLEA-------------
MUTS_LEGPH      ELQENKSLEISPLPLLQQLLETAIIDNPPMLIRDGGVIAPGFDEELDE----------------------
MUTS_LEGPC      ELQENKSLEISPLPLLQQLLETAIIDNPPMLIRDGGVIAPGFDEELDE----------------------
MUTS_LEGPA      ELQENKSLEISPLPLLQQLLETAIIDNPPMLIRDGGVIAPGFDEELDE----------------------
UHRF2_HUMAN     DLGQ--NYIMIPNEILQTLLDLF-----------------------------------------------
PQQCL_CHLPN     ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           MAYQHQTWKSDLQSLExxxx
TENA_BACSU      MAYRKEGW------------
TENA_STAES      MAYINEKWE-----------
TENA_STAEQ      MAYINEKWE-----------
TENA_STAS1      MSFNEESW------------
TENA_STAAR      MAMTLEQWE-----------
TENA_STAAB      MAMTLEQWE-----------
TENA_STAAW      MAMTLEQWE-----------
TENA_STAAS      MAMTLEQWE-----------
TENA_STAAN      MAMTLEQWE-----------
TENA_STAAM      MAMTLEQWE-----------
TENA_STAAC      MAMTLEQWE-----------
TENA_STAA3      MAMTLEQWE-----------
Y358_HAEIN      M-------------------
TENA_STAA8      MAMTLEQWE-----------
TENA_STACT      MAYTSEKWQ-----------
TENA_STAHJ      MAYINEQW------------
THI22_SCHPO     TPYYEYVTKQNLEDKE----
THI21_YEAST     AALEYE--------------
THIED_CORGL     QATRH---------------
THIED_COREF     --------------------
THI20_YEAST     AALEYE--------------
MUTS_LEGPL      --------------------
PQQCL_CHLMU     --------------------
MUTS_LEGPH      --------------------
MUTS_LEGPC      --------------------
MUTS_LEGPA      --------------------
UHRF2_HUMAN     --------------------
PQQCL_CHLPN     --------------------