[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for spne4:ACF55303.1

[Show Plain Result]


## Summary of Sequence Search
    1::816
    5::923     2e-46  31%  931 aa  DING_BACSU RecName: Full=Probable ATP-dependent helicase dinG
   54::501     5e-45  33%  902 aa  DING_STAES RecName: Full=Probable ATP-dependent helicase dinG
   54::501     5e-45  33%  902 aa  DING_STAEQ RecName: Full=Probable ATP-dependent helicase dinG
   54::872     5e-44  32%  900 aa  DING_STAS1 RecName: Full=Probable ATP-dependent helicase dinG
   40::501     2e-40  30%  897 aa  DING_STAAW RecName: Full=Probable ATP-dependent helicase dinG
   40::501     2e-40  30%  897 aa  DING_STAAS RecName: Full=Probable ATP-dependent helicase dinG
   40::501     2e-40  30%  897 aa  DING_STAAN RecName: Full=Probable ATP-dependent helicase dinG
   40::501     2e-40  30%  897 aa  DING_STAAM RecName: Full=Probable ATP-dependent helicase dinG
   40::501     2e-40  30%  897 aa  DING_STAAC RecName: Full=Probable ATP-dependent helicase dinG
   40::501     2e-40  30%  897 aa  DING_STAA8 RecName: Full=Probable ATP-dependent helicase dinG
   40::501     2e-40  30%  897 aa  DING_STAA3 RecName: Full=Probable ATP-dependent helicase dinG
   40::501     2e-40  30%  897 aa  DING_STAAR RecName: Full=Probable ATP-dependent helicase dinG
   40::501     5e-40  30%  897 aa  DING_STAAB RecName: Full=Probable ATP-dependent helicase dinG
   54::864     1e-35  31%  900 aa  DING_STAHJ RecName: Full=Probable ATP-dependent helicase dinG
  407::600     4e-27  35% 1427 aa  DPO3_CLOTE RecName: Full=DNA polymerase III polC-type;       
   21::626     1e-26  26%  636 aa  YOAA_ECOLI RecName: Full=Probable ATP-dependent helicase yoaA;     
  429::599     2e-23  34% 1449 aa  DPO3_CLOPE RecName: Full=DNA polymerase III polC-type;       
  460::579     1e-21  44% 1437 aa  DPO3_BACSU RecName: Full=DNA polymerase III polC-type;       
  459::594     1e-21  40% 1435 aa  DPO3_BACCR RecName: Full=DNA polymerase III polC-type;       
   13::204     2e-20  31%  640 aa  Y387_HAEIN RecName: Full=Probable ATP-dependent helicase HI0387;   
  458::575     3e-19  40% 1433 aa  DPO3_BACHD RecName: Full=DNA polymerase III polC-type;       
  463::587     2e-18  38% 1463 aa  DPO3_STRR6 RecName: Full=DNA polymerase III polC-type;       
  463::587     2e-18  38% 1463 aa  DPO3_STRPN RecName: Full=DNA polymerase III polC-type;       
  463::587     2e-18  38% 1463 aa  DPO3_STRP2 RecName: Full=DNA polymerase III polC-type;       
  422::586     3e-18  29% 1401 aa  DPO3_THETN RecName: Full=DNA polymerase III polC-type;       
  465::627     3e-18  36% 1465 aa  DPO3_STRPM RecName: Full=DNA polymerase III polC-type;       
  453::579     3e-18  38% 1428 aa  DPO3_OCEIH RecName: Full=DNA polymerase III polC-type;       
  465::627     6e-18  36% 1465 aa  DPO3_STRPG RecName: Full=DNA polymerase III polC-type;       
  465::627     6e-18  36% 1465 aa  DPO3_STRPC RecName: Full=DNA polymerase III polC-type;       
  465::627     6e-18  36% 1465 aa  DPO3_STRPB RecName: Full=DNA polymerase III polC-type;       
  465::627     7e-18  36% 1465 aa  DPO3_STRPD RecName: Full=DNA polymerase III polC-type;       
  465::627     1e-17  36% 1465 aa  DPO3_STRP8 RecName: Full=DNA polymerase III polC-type;       
  465::627     1e-17  36% 1465 aa  DPO3_STRPY RecName: Full=DNA polymerase III polC-type;       
  465::627     1e-17  36% 1465 aa  DPO3_STRPF RecName: Full=DNA polymerase III polC-type;       
  465::627     1e-17  36% 1465 aa  DPO3_STRP6 RecName: Full=DNA polymerase III polC-type;       
  465::627     1e-17  36% 1465 aa  DPO3_STRP3 RecName: Full=DNA polymerase III polC-type;       
  465::627     1e-17  36% 1465 aa  DPO3_STRP1 RecName: Full=DNA polymerase III polC-type;       
  462::586     2e-17  35% 1462 aa  DPO3_STRSV RecName: Full=DNA polymerase III polC-type;       
  463::589     2e-17  34% 1463 aa  DPO3_STRSY RecName: Full=DNA polymerase III polC-type;       
  463::589     2e-17  34% 1463 aa  DPO3_STRS2 RecName: Full=DNA polymerase III polC-type;       
  417::582     5e-17  30% 1437 aa  DPO3_PEDPA RecName: Full=DNA polymerase III polC-type;       
  463::587     6e-17  37% 1465 aa  DPO3_STRMU RecName: Full=DNA polymerase III polC-type;       
  547::673     8e-17  39%  704 aa  DPO3E_RHOCA RecName: Full=DNA polymerase III subunit epsilon-like
  634::779     1e-16  35% 1638 aa  DPO3_LACLA RecName: Full=DNA polymerase III polC-type;       
   19::182     1e-16  31%  202 aa  DPO3E_AQUAE RecName: Full=DNA polymerase III subunit epsilon;      
  464::626     2e-16  33% 1464 aa  DPO3_STRTD RecName: Full=DNA polymerase III polC-type;       
  464::626     2e-16  33% 1464 aa  DPO3_STRT2 RecName: Full=DNA polymerase III polC-type;       
  464::626     2e-16  33% 1464 aa  DPO3_STRT1 RecName: Full=DNA polymerase III polC-type;       
  426::592     2e-16  31% 1442 aa  DPO3_STAES RecName: Full=DNA polymerase III polC-type;       
  422::588     2e-16  31% 1438 aa  DPO3_STAEQ RecName: Full=DNA polymerase III polC-type;       
  420::586     2e-16  31% 1436 aa  DPO3_STAAW RecName: Full=DNA polymerase III polC-type;       
  420::586     2e-16  31% 1435 aa  DPO3_STAAU RecName: Full=DNA polymerase III polC-type;       
  422::588     2e-16  31% 1438 aa  DPO3_STAAS RecName: Full=DNA polymerase III polC-type;       
  422::588     2e-16  31% 1438 aa  DPO3_STAAR RecName: Full=DNA polymerase III polC-type;       
  422::588     2e-16  31% 1438 aa  DPO3_STAAN RecName: Full=DNA polymerase III polC-type;       
  422::588     2e-16  31% 1438 aa  DPO3_STAAM RecName: Full=DNA polymerase III polC-type;       
  422::588     2e-16  31% 1438 aa  DPO3_STAAE RecName: Full=DNA polymerase III polC-type;       
  422::588     2e-16  31% 1438 aa  DPO3_STAAC RecName: Full=DNA polymerase III polC-type;       
  422::588     2e-16  31% 1438 aa  DPO3_STAAB RecName: Full=DNA polymerase III polC-type;       
  420::586     2e-16  31% 1436 aa  DPO3_STAA8 RecName: Full=DNA polymerase III polC-type;       
  420::586     2e-16  31% 1436 aa  DPO3_STAA3 RecName: Full=DNA polymerase III polC-type;       
  422::588     2e-16  31% 1438 aa  DPO3_STAA1 RecName: Full=DNA polymerase III polC-type;       
  468::630     7e-16  32% 1468 aa  DPO3_STRA5 RecName: Full=DNA polymerase III polC-type;       
  468::630     7e-16  32% 1468 aa  DPO3_STRA3 RecName: Full=DNA polymerase III polC-type;       
  461::588     7e-16  34% 1438 aa  DPO3_STAHJ RecName: Full=DNA polymerase III polC-type;       
  422::588     9e-16  30% 1438 aa  DPO3_STAS1 RecName: Full=DNA polymerase III polC-type;       
  422::587     3e-15  30% 1445 aa  DPO3_LACBA RecName: Full=DNA polymerase III polC-type;       
   55::229     3e-14  29%  692 aa  DING_PHOPR RecName: Full=Probable ATP-dependent helicase dinG
   38::607     4e-14  25%  641 aa  YPVA_BACSU RecName: Full=Probable ATP-dependent helicase ypvA;     
  463::590     2e-13  33% 1446 aa  DPO3_LACSS RecName: Full=DNA polymerase III polC-type;       
  464::578     5e-13  36% 1444 aa  DPO3_LACS1 RecName: Full=DNA polymerase III polC-type;       
  466::583     1e-12  34% 1444 aa  DPO3_LISIN RecName: Full=DNA polymerase III polC-type;       
  466::583     2e-12  36% 1444 aa  DPO3_LISW6 RecName: Full=DNA polymerase III polC-type;       
  466::583     2e-12  34% 1444 aa  DPO3_LISMO RecName: Full=DNA polymerase III polC-type;       
  466::583     2e-12  34% 1444 aa  DPO3_LISMF RecName: Full=DNA polymerase III polC-type;       
  421::587     2e-12  27% 1444 aa  DPO3_LACC3 RecName: Full=DNA polymerase III polC-type;       
  392::540     4e-11  30% 1367 aa  DPO3_THEP1 RecName: Full=DNA polymerase III polC-type;       
  426::588     7e-11  27% 1443 aa  DPO3_LACRD RecName: Full=DNA polymerase III polC-type;       
  460::584     9e-11  31% 1437 aa  DPO3_LACPL RecName: Full=DNA polymerase III polC-type;       
   54::186     1e-10  29%  253 aa  DPO3E_PASMU RecName: Full=DNA polymerase III subunit epsilon;      
   51::183     3e-10  33%  256 aa  DPO3E_HAEIN RecName: Full=DNA polymerase III subunit epsilon;      
   25::637     3e-10  27%  664 aa  DING_MYCTU RecName: Full=Probable ATP-dependent helicase dinG
   25::637     3e-10  27%  664 aa  DING_MYCBO RecName: Full=Probable ATP-dependent helicase dinG
   49::172     4e-10  30%  215 aa  DPO3E_TREPA RecName: Full=DNA polymerase III subunit epsilon;      
   52::249     7e-10  28%  714 aa  DING_SALTY RecName: Full=Probable ATP-dependent helicase dinG;     
   52::249     7e-10  28%  714 aa  DING_SALPA RecName: Full=Probable ATP-dependent helicase dinG;     
   52::249     7e-10  28%  714 aa  DING_SALCH RecName: Full=Probable ATP-dependent helicase dinG;     
   52::92      2e-09  33%  716 aa  DING_ECO57 RecName: Full=Probable ATP-dependent helicase dinG;     
  392::540     2e-09  28% 1367 aa  DPO3_THEMA RecName: Full=DNA polymerase III polC-type;       
   51::177     2e-09  30%  245 aa  DPO3E_BUCBP RecName: Full=DNA polymerase III subunit epsilon;      
   52::92      2e-09  33%  716 aa  DING_SHIFL RecName: Full=Probable ATP-dependent helicase dinG;     
   52::92      2e-09  33%  716 aa  DING_ECOLI RecName: Full=Probable ATP-dependent helicase dinG;     
   52::92      2e-09  33%  716 aa  DING_ECOL6 RecName: Full=Probable ATP-dependent helicase dinG;     
  442::589     5e-09  25% 1435 aa  DPO3_MYCPU RecName: Full=DNA polymerase III polC-type;       
   47::177     1e-08  25%  233 aa  DPO3E_BUCAP RecName: Full=DNA polymerase III subunit epsilon;      
   41::172     4e-08  29%  229 aa  DPO3E_RICTY RecName: Full=DNA polymerase III subunit epsilon;      
   41::172     5e-08  29%  229 aa  DPO3E_RICPR RecName: Full=DNA polymerase III subunit epsilon;      
   41::172     9e-08  29%  229 aa  DPO3E_RICBR RecName: Full=DNA polymerase III subunit epsilon;      
  130::298     3e-07  27%  375 aa  REXO4_USTMA RecName: Full=RNA exonuclease 4;         EC=3.1.-.-;
   46::172     3e-07  29%  230 aa  DPO3E_RICCN RecName: Full=DNA polymerase III subunit epsilon;      
   50::175     3e-07  28%  237 aa  DPO3E_BUCAI RecName: Full=DNA polymerase III subunit epsilon;      
   46::172     3e-07  29%  229 aa  DPO3E_RICFE RecName: Full=DNA polymerase III subunit epsilon;      
   15::611     5e-07  33%  651 aa  Y942_METJA RecName: Full=Probable ATP-dependent helicase MJ0942;   
   43::214     5e-07  30%  645 aa  Y2191_MYCTU RecName: Full=Uncharacterized protein Rv2191/MT2247;
  353::566     1e-06  23%  602 aa  XPD_THEAC RecName: Full=ATP-dependent DNA helicase Ta0057;       
  201::296     4e-06  30%  651 aa  DBP6_CANGA RecName: Full=ATP-dependent RNA helicase DBP6;       
  451::656     5e-06  26% 1443 aa  DPO3_MYCPN RecName: Full=DNA polymerase III polC-type;       
   52::236     8e-06  30%  243 aa  DPO3E_SALTY RecName: Full=DNA polymerase III subunit epsilon;      
   52::236     8e-06  30%  243 aa  DPO3E_SALTI RecName: Full=DNA polymerase III subunit epsilon;      
   52::185     8e-06  27%  243 aa  DPO3E_ECOLI RecName: Full=DNA polymerase III subunit epsilon;      
  124::257     1e-05  31%  260 aa  REXO4_SCHPO RecName: Full=RNA exonuclease 4;         EC=3.1.-.-;
  132::288     2e-05  28%  319 aa  REXO4_GIBZE RecName: Full=RNA exonuclease 4;         EC=3.1.-.-;
  480::585     2e-05  28% 1451 aa  DPO3_MYCGE RecName: Full=DNA polymerase III polC-type;       
  243::303     3e-05  53%  739 aa  ROK1_ASPFU RecName: Full=ATP-dependent RNA helicase rok1;       
  169::299     6e-05  37%  738 aa  ROK1_ASPCL RecName: Full=ATP-dependent RNA helicase rok1;       
   94::243     6e-05  26%  263 aa  REXO4_CANGA RecName: Full=RNA exonuclease 4;         EC=3.1.-.-;
   39::161     6e-05  24%  181 aa  ISG20_PIG RecName: Full=Interferon-stimulated gene 20 kDa protein; 
  206::278     6e-05  37%  630 aa  DBP6_KLULA RecName: Full=ATP-dependent RNA helicase DBP6;       
   38::91      6e-05  48%  438 aa  CSHB_BACSU RecName: Full=DEAD-box ATP-dependent RNA helicase cshB; 
  158::289     7e-05  36%  725 aa  ROK1_ASPOR RecName: Full=ATP-dependent RNA helicase rok1;       
  248::308     7e-05  42%  908 aa  DDX31_DICDI RecName: Full=Probable ATP-dependent RNA helicase
   41::134     9e-05  40%  535 aa  MS116_SCHPO RecName: Full=ATP-dependent RNA helicase mss116,
   39::137     9e-05  22%  300 aa  ISG20_MOUSE RecName: Full=Interferon-stimulated gene 20 kDa
  209::275     9e-05  37%  629 aa  DBP6_YEAST RecName: Full=ATP-dependent RNA helicase DBP6;       
  209::275     9e-05  37%  629 aa  DBP6_YEAS7 RecName: Full=ATP-dependent RNA helicase DBP6;       
  242::302     1e-04  51%  738 aa  ROK1_NEOFI RecName: Full=ATP-dependent RNA helicase rok1;       
   83::207     1e-04  34%  229 aa  RNT_HAEIE RecName: Full=Ribonuclease T;       
   48::117     2e-04  40%  444 aa  SRMB_ECOLI RecName: Full=ATP-dependent RNA helicase srmB;       
  209::294     2e-04  37%  729 aa  ROK1_ASPNC RecName: Full=ATP-dependent RNA helicase rok1;       
  131::282     2e-04  25%  408 aa  REXO4_CRYNE RecName: Full=RNA exonuclease 4;         EC=3.1.-.-;
   39::104     2e-04  48%  409 aa  Y443_MYCPN RecName: Full=Probable ATP-dependent RNA helicase MG308
  162::227     2e-04  41%  771 aa  DBP7_ASPNC RecName: Full=ATP-dependent RNA helicase dbp7;       
  236::318     2e-04  43%  663 aa  DBP6_LODEL RecName: Full=ATP-dependent RNA helicase DBP6;       
  161::231     3e-04  41%  593 aa  YO12_CAEEL RecName: Full=Putative ATP-dependent RNA helicase
  396::541     3e-04  21%  551 aa  XPD_SULAC RecName: Full=ATP-dependent DNA helicase Saci_0192;      
  247::307     3e-04  51%  749 aa  ROK1_ASPTN RecName: Full=ATP-dependent RNA helicase rok1;       
   81::205     3e-04  36%  221 aa  RNT_BUCCC RecName: Full=Ribonuclease T;       
  158::213     3e-04  43%  769 aa  DBP7_ASPTN RecName: Full=ATP-dependent RNA helicase dbp7;       
  108::265     3e-04  23%  325 aa  AEN_HUMAN RecName: Full=Apoptosis-enhancing nuclease;       
  107::169     4e-04  44%  536 aa  RH26_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 26;   
  187::278     4e-04  37%  637 aa  DBP6_VANPO RecName: Full=ATP-dependent RNA helicase DBP6;       
  205::287     4e-04  35%  631 aa  DBP6_PICGU RecName: Full=ATP-dependent RNA helicase DBP6;       
  103::260     4e-04  24%  332 aa  AEN_RAT RecName: Full=Apoptosis-enhancing nuclease;       
  108::265     4e-04  23%  325 aa  AEN_PONAB RecName: Full=Apoptosis-enhancing nuclease;       
  194::265     6e-04  45%  792 aa  RH40_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 40;   
  242::406     6e-04  21%  422 aa  REXO4_HUMAN RecName: Full=RNA exonuclease 4;       
  191::294     6e-04  35%  619 aa  DDX59_HUMAN RecName: Full=Probable ATP-dependent RNA helicase
  152::207     6e-04  41%  755 aa  DBP7_ASPCL RecName: Full=ATP-dependent RNA helicase dbp7;       
  120::237     8e-04  35%  559 aa  Y022_SIFV RecName: Full=Putative helicase 22;         EC=3.6.1.-;
  241::301     8e-04  47%  742 aa  ROK1_EMENI RecName: Full=ATP-dependent RNA helicase rok1;       
  167::222     8e-04  45%  569 aa  ROK1_ASHGO RecName: Full=ATP-dependent RNA helicase ROK1;       
  471::572     8e-04  28% 1093 aa  RENT1_NEUCR RecName: Full=Regulator of nonsense transcripts 1
    1::816

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xKTIGNRYVVVDLEATSTGSKAKXXXXXXXXXXXXXXXXHYTTDVNPHEPLDAHIKELTGLTDQRLAQAP
DING_BACSU      ------RFVVIDVETTGNSPKKKIIQIAAVVIENGQITERFSKYINPNKSIPAFIEQLTGISNQMVENEQ
DING_STAES      ------------------------------------------------------IQALTSIEEEMLVQAP
DING_STAEQ      ------------------------------------------------------IQALTSIEEEMLVQAP
DING_STAS1      ------------------------------------------------------IQALTSIEEDMLNQAP
DING_STAAW      ----------------------------------------YHSMIRTNLEIPPFIQALTSIEENMLQQAP
DING_STAAS      ----------------------------------------YHSMIRTNLEIPPFIQALTSIEENMLQQAP
DING_STAAN      ----------------------------------------YHSMIRTNLEIPPFIQALTSIEENMLQQAP
DING_STAAM      ----------------------------------------YHSMIRTNLEIPPFIQALTSIEENMLQQAP
DING_STAAC      ----------------------------------------YHSMIRTNLEIPPFIQALTSIEENMLQQAP
DING_STAA8      ----------------------------------------YHSMIRTNLEIPPFIQALTSIEENMLQQAP
DING_STAA3      ----------------------------------------YHSMIRTNLEIPPFIQALTSIEENMLQQAP
DING_STAAR      ----------------------------------------YHSMIRTNLEIPPFIQALTSIEENMLQQAP
DING_STAAB      ----------------------------------------YHSMIRTNLEIPPFIQALTSIEENMLQQAP
DING_STAHJ      ------------------------------------------------------IQALTSIEDTMLEQAP
DPO3_CLOTE      -RTLEDSYVVFDIETTGFSNKNKIIEIGAVKIKEGKVVDKYSTFVNPERIIPEKIIELTGIHDYMVKDAP
YOAA_ECOLI      ----------------------------------------------------------------------
DPO3_CLOPE      -ESFDDEYVVFDIETTGFSSKNKIIEIGAVKLKDGEIVDSFSTFVDPKVNIPYKITELTSITQNMVNGQP
DPO3_BACSU      ---------------------------------------------NPHRPLSATIIELTGITDDMLQDAP
DPO3_BACCR      ---------------------------------------------NPHQPLSATIIELTGITDDMLTDAP
Y387_HAEIN      ----------------------------------------------------------------------
DPO3_BACHD      ---------------------------------------------DPHEPLTNTIIELTGITDDMLKGQP
DPO3_STRR6      --------------------------------------------INPGHPLSAFTTELTGITDDHVKNAK
DPO3_STRPN      --------------------------------------------INPGHPLSAFTTELTGITDDHVKNAK
DPO3_STRP2      --------------------------------------------INPGHPLSAFTTELTGITDDHVKNAK
DPO3_THETN      ----------------------------------------FETFVNPQIPISSFITKLTGIDESMVKDAP
DPO3_STRPM      --------------------------------------------IDPGHPLSAFTTELTGITDKHLQDAK
DPO3_OCEIH      ---------------------------------------------NPHHALSQTTIDLTGITDDMVNDAP
DPO3_STRPG      --------------------------------------------IDPGHPLSAFTTELTGITDKHLQGAK
DPO3_STRPC      --------------------------------------------IDPGHPLSAFTTELTGITDKHLQGAK
DPO3_STRPB      --------------------------------------------IDPGHPLSAFTTELTGITDKHLQGAK
DPO3_STRPD      --------------------------------------------IDPGHPLSAFTTELTGITDKHLQDAK
DPO3_STRP8      --------------------------------------------IDPGHPLSAFTTELTGITDKHLQGAK
DPO3_STRPY      --------------------------------------------IDPGHPLSAFTTELTGITDKHLQGAK
DPO3_STRPF      --------------------------------------------IDPGHPLSAFTTELTGITDKHLQGAK
DPO3_STRP6      --------------------------------------------IDPGHPLSAFTTELTGITDKHLQGAK
DPO3_STRP3      --------------------------------------------IDPGHPLSAFTTELTGITDKHLQGAK
DPO3_STRP1      --------------------------------------------IDPGHPLSAFTTELTGITDKHLQGAK
DPO3_STRSV      --------------------------------------------INPGHPLSAFTTDLTGITDEHVRNAK
DPO3_STRSY      --------------------------------------------IDPGHPLSQFTTDLTGITDEHVRGSK
DPO3_STRS2      --------------------------------------------IDPGHPLSQFTTDLTGITDEHVRGSK
DPO3_PEDPA      ----GGKYVIFDVETTGLSAYDKVIELSAVKMENGNVIDQFEEFIDPGFPLSETTINLTSITDEMVRGSM
DPO3_STRMU      --------------------------------------------IDPGHPLSQFTTDLTGITDQHVKGAK
DPO3E_RHOCA     ----------------------------------------FDTLVNPGRPIPAASTAVHGITEAMVATAP
DPO3_LACLA      --------------------------------------------INPGYRLSEFTTELTGITDDHVKNAK
DPO3E_AQUAE     -------FVVIDLEATGFDEKSEVIDLAAVRVEGGIITEKFSTLVYPGYFIPERIKKLTGITNAMLVGQP
DPO3_STRTD      --------------------------------------------IDPGYPLSAFTTELTGITDNHVKGAK
DPO3_STRT2      --------------------------------------------IDPGYPLSAFTTELTGITDNHVKGAK
DPO3_STRT1      --------------------------------------------IDPGYPLSAFTTELTGITDNHVKGAK
DPO3_STAES      -------YVVFDVETTGLSNQYKIIELAAVKVHNGEIIDKFERFSNPHERLSETIINLTHITDDMLTDAP
DPO3_STAEQ      -------YVVFDVETTGLSNQYKIIELAAVKVHNGEIIDKFERFSNPHERLSETIINLTHITDDMLTDAP
DPO3_STAAW      -------YVVFDVETTGLSNQYKIIELAAVKVHNGEIIDKFERFSNPHERLSETIINLTHITDDMLVDAP
DPO3_STAAU      -------YVVFDVETTGLSNQYKIIELAAVKVHNGEIIDKFERFSNPHERLSETIINLTHITDDMLVDAP
DPO3_STAAS      -------YVVFDVETTGLSNQYKIIELAAVKVHNGEIIDKFERFSNPHERLSETIINLTHITDDMLVDAP
DPO3_STAAR      -------YVVFDVETTGLSNQYKIIELAAVKVHNGEIIDKFERFSNPHERLSETIINLTHITDDMLVDAP
DPO3_STAAN      -------YVVFDVETTGLSNQYKIIELAAVKVHNGEIIDKFERFSNPHERLSETIINLTHITDDMLVDAP
DPO3_STAAM      -------YVVFDVETTGLSNQYKIIELAAVKVHNGEIIDKFERFSNPHERLSETIINLTHITDDMLVDAP
DPO3_STAAE      -------YVVFDVETTGLSNQYKIIELAAVKVHNGEIIDKFERFSNPHERLSETIINLTHITDDMLVDAP
DPO3_STAAC      -------YVVFDVETTGLSNQYKIIELAAVKVHNGEIIDKFERFSNPHERLSETIINLTHITDDMLVDAP
DPO3_STAAB      -------YVVFDVETTGLSNQYKIIELAAVKVHNGEIIDKFERFSNPHERLSETIINLTHITDDMLVDAP
DPO3_STAA8      -------YVVFDVETTGLSNQYKIIELAAVKVHNGEIIDKFERFSNPHERLSETIINLTHITDDMLVDAP
DPO3_STAA3      -------YVVFDVETTGLSNQYKIIELAAVKVHNGEIIDKFERFSNPHERLSETIINLTHITDDMLVDAP
DPO3_STAA1      -------YVVFDVETTGLSNQYKIIELAAVKVHNGEIIDKFERFSNPHERLSETIINLTHITDDMLVDAP
DPO3_STRA5      --------------------------------------------IDPGHPLSAFTTELTGITDNHVRGSK
DPO3_STRA3      --------------------------------------------IDPGHPLSAFTTELTGITDNHVRGSK
DPO3_STAHJ      ---------------------------------------------NPHEKLSETIINLTHITDDMLTDAP
DPO3_STAS1      -------YVVFDVETTGLSNQYKIIELAAVKVKDGEIIDKFERFSNPHERLSETIKNLTHISDDMLVDAP
DPO3_LACBA      ----GATYVVFDVETTGLSAYDKVIELSAVKMEHQNVVDQFEEFIDPGFPLSEQTTNLTSITDDMVAGSK
DING_PHOPR      ----------------------------------------------------------------------
YPVA_BACSU      ----------------------------------------------------------------------
DPO3_LACSS      --------------------------------------------IDPERPLSAFTTQLTSITNEMVHGAK
DPO3_LACS1      --------------------------------------------IDPGHPLSQTTINLTSITDDMVRGSK
DPO3_LISIN      --------------------------------------------IDPGHPLSATTINLTGITDDMVKGSD
DPO3_LISW6      --------------------------------------------IDPGHPLSATTINLTGITDDMVKGSD
DPO3_LISMO      --------------------------------------------IDPGHPLSATTINLTGITDDMVKGSD
DPO3_LISMF      --------------------------------------------IDPGHPLSATTINLTGITDDMVKGSD
DPO3_LACC3      -------YVVFDVETTGLSAVYKVIELAAVKMKDGKVIDQFEEMIDPGFPLSELTINLTHITDDMVHGSK
DPO3_THEP1      ----------------------------------------YHTLIKPXXXXXXXXXXXTGITQEMLENKR
DPO3_LACRD      -------YVIFDVETTGLSAYDKVIELSAVKMQDGNVLERFDEFIDPGFPLSEQTTNLTSITTEMVQGSK
DPO3_LACPL      --------------------------------------------IDPGFHLSETTTNLTSITDDMVRGSK
DPO3E_PASMU     --------------------------------------------IKPNRPVDPDAIKVHGITDEMLADKP
DPO3E_HAEIN     --------------------------------------------IKPDRPXDPDAIKVHGITDEMLADKP
DING_MYCTU      ----------------------------------------------------------------------
DING_MYCBO      ----------------------------------------------------------------------
DPO3E_TREPA     ----------------------------------------FSTLIFPDRAIPPDVSKINHITDDMLVNKP
DING_SALTY      ----------------------------------------------------------------------
DING_SALPA      ----------------------------------------------------------------------
DING_SALCH      ----------------------------------------------------------------------
DING_ECO57      ----------------------------------------------------------------------
DPO3_THEMA      ----------------------------------------YHTLIKPSREISRKSSEITGITQEMLENKR
DPO3E_BUCBP     --------------------------------------------IQPNRLIDKQSFKIHGITDNFLLDKP
DING_SHIFL      ----------------------------------------------------------------------
DING_ECOLI      ----------------------------------------------------------------------
DING_ECOL6      ----------------------------------------------------------------------
DPO3_MYCPU      --------------------------------------------IKPKSKLDSFTTKLTGITQEHLEKGY
DPO3E_BUCAP     ----------------------------------------FHTYIKPNRLIESDASKIHGITDDFLSDKP
DPO3E_RICTY     ---------------------------------------HFHCYINPERDMPFEAYKIHGISGEFLKDKP
DPO3E_RICPR     ---------------------------------------HFHFYINPERDMPFEAYKIHGISGEFLKDKP
DPO3E_RICBR     ---------------------------------------HFHFYLNPERDMPFEAYRIHGISGEFLKDKP
REXO4_USTMA     -KEPGN-YLAIDCEMVGVGDKGSESILARVSIVNFHGATIYDQFVRPQEKVTDYRTWVSGVRPKDLKGAP
DPO3E_RICCN     --------------------------------------------INPERDMPFEAYRIHGISGEFLKDKP
DPO3E_BUCAI     --------------------------------------------IQPGRSIESGALKVHGITNKFLLDKP
DPO3E_RICFE     --------------------------------------------INPERDMPFDAYRIHGISGEFLKDKP
Y942_METJA      ----------------------------------------------------------------------
Y2191_MYCTU     -------FVVVDLETTTTGNDATPPDAITEIGAVKVCGGEFATLVNPQHSIPPQIVRLTGITTAMVGNAP
XPD_THEAC       ----------------------------------------------------------------------
DBP6_CANGA      ----------------------------------------------------------------------
DPO3_MYCPN      -------------------------------------------------PLPAAVTEITKITQAQLEDGM
DPO3E_SALTY     --------------------------------------------LKPDRLVDPEAFGVHGIADEFLLDKP
DPO3E_SALTI     --------------------------------------------LKPDRLVDPEAFGVHGIADEFLLDKP
DPO3E_ECOLI     --------------------------------------------LKPDRLVDPEAFGVHGIADEFLLDKP
REXO4_SCHPO     ----------------------------------------YDTYVRPKEKVTDWRTWVSGVKSFHMRDAP
REXO4_GIBZE     ------KYIAIDCEMVGVGPGGHESALARVSIVDFHGVQIYDSYVKPKEKVTNWRTAVSGISQKSMRFAR
DPO3_MYCGE      ----------------------------------------------------------------------
ROK1_ASPFU      ----------------------------------------------------------------------
ROK1_ASPCL      ----------------------------------------------------------------------
REXO4_CANGA     ------KYIAMDCEFVGVGPEGKDSALARVSLVNFHGNVVLDIFVKPRETVTDWRTWVSGITPDHMKNAV
ISG20_PIG       ----------------------------------------YDKFIQPEGEITDYRTRVSGVTPQHMVGAT
DBP6_KLULA      ----------------------------------------------------------------------
CSHB_BACSU      ----------------------------------------------------------------------
ROK1_ASPOR      ----------------------------------------------------------------------
DDX31_DICDI     ----------------------------------------------------------------------
MS116_SCHPO     ----------------------------------------------------------------------
ISG20_MOUSE     ----------------------------------------YDKYIRPEGEITDYRTQVSGVTPQHMVRAT
DBP6_YEAST      ----------------------------------------------------------------------
DBP6_YEAS7      ----------------------------------------------------------------------
ROK1_NEOFI      ----------------------------------------------------------------------
RNT_HAEIE       --------------------------------------------IDIHNPLRGAVSELDAITGL------
SRMB_ECOLI      ----------------------------------------------------------------------
ROK1_ASPNC      ----------------------------------------------------------------------
REXO4_CRYNE     ------QYLAIDCEMVGVGPNGMENTLARVSIVNYHGAVILDTFVQPREPVTDYRTWISGVKQSDLLGAP
Y443_MYCPN      ----------------------------------------------------------------------
DBP7_ASPNC      ----------------------------------------------------------------------
DBP6_LODEL      ----------------------------------------------------------------------
YO12_CAEEL      ----------------------------------------------------------------------
XPD_SULAC       ----------------------------------------------------------------------
ROK1_ASPTN      ----------------------------------------------------------------------
RNT_BUCCC       --------------------------------------------IDPFNPLRGAVSEKNALKNI------
DBP7_ASPTN      ----------------------------------------------------------------------
AEN_HUMAN       -----SKCVAIDCEMVGTGPRGRVSELARCSIVSYHGDVLYDKYIRPEMPIADYRTRWSGITRQHMRKAV
RH26_ORYSJ      ----------------------------------------------------------------------
DBP6_VANPO      ----------------------------------------------------------------------
DBP6_PICGU      ----------------------------------------------------------------------
AEN_RAT         -----SKYVAIDCEMVGTGPQGRVSELARCSVVSYSGDVLYDKYIRPEMPIVDYRTRWSGITRQHMHKAI
AEN_PONAB       -----SKCVAIDCEMVGTGPRGRVSELARCSIVSYHGDVLYDKYIRPEMPIVDYRTRWSGITRQHMCKAI
RH40_ORYSJ      ----------------------------------------------------------------------
REXO4_HUMAN     ------RALALDCEMVGVGPKGEESMAARVSIVNQYGKCVYDKYVKPTEPVTDYRTAVSGIRPENLKQGE
DDX59_HUMAN     ----------------------------------------------------------------------
DBP7_ASPCL      ----------------------------------------------------------------------
Y022_SIFV       ----------------------------------------------------------------------
ROK1_EMENI      ----------------------------------------------------------------------
ROK1_ASHGO      ----------------------------------------------------------------------
RENT1_NEUCR     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DFSQVARKIFDLVEDGIFVAHNVQFDANLLAENLFFEGYELRNPRVDTVELAQVFFPELEKYSLPILCRE
DING_BACSU      PFEAVAEEVFQLLDGAYFVAHNIHFDLGFVKYELHKAGFQLPDCEVDTVELSRIVFPGFEGYKLTELSEE
DING_STAES      YFNEVADDIYQLIKDCVFVAHNISFDLNFIKKAFEKCNIQFKPKRVDTLELFKIAFPTDKSYQLSALAES
DING_STAEQ      YFNEVADDIYQLIKDCVFVAHNISFDLNFIKKAFEKCNIQFKPKRVDTLELFKIAFPTDKSYQLSALAES
DING_STAS1      YFHEIAEDIYKQIDGCIFVAHNVAFDLNFIKKSFKQCHINYRPKKVDTLELFKVAFPTDKSYQLSELAEA
DING_STAAW      YFNQVAQEIYDKIKDCIFVAHNVDFDLNFIKKAFKDCNIQYRPKKVDTLEIFKIAFPTDKSYQLSELAEA
DING_STAAS      YFNQVAQEIYDKIKDCIFVAHNVDFDLNFIKKAFKDCNIQYRPKKVDTLEIFKIAFPTDKSYQLSELAEA
DING_STAAN      YFNQVAQEIYDKIKDCIFVAHNVDFDLNFIKKAFKDCNIQYRPKKVDTLEIFKIAFPTDKSYQLSELAEA
DING_STAAM      YFNQVAQEIYDKIKDCIFVAHNVDFDLNFIKKAFKDCNIQYRPKKVDTLEIFKIAFPTDKSYQLSELAEA
DING_STAAC      YFNQVAQEIYDKIKDCIFVAHNVDFDLNFIKKAFKDCNIQYRPKKVDTLEIFKIAFPTDKSYQLSELAEA
DING_STAA8      YFNQVAQEIYDKIKDCIFVAHNVDFDLNFIKKAFKDCNIQYRPKKVDTLEIFKIAFPTDKSYQLSELAEA
DING_STAA3      YFNQVAQEIYDKIKDCIFVAHNVDFDLNFIKKAFKDCNIQYRPKKVDTLEIFKIAFPTDKSYQLSELAEA
DING_STAAR      YFNQVAEEIYDKIKDCIFVAHNVDFDLNFIKKAFKDCNIQYRPKKVDTLEIFKIAFPTDKSYQLSELAEA
DING_STAAB      YFNQVAQGIYDNMKDCIFVAHNVDFDLNFIKKAFKDCNIQYRPKRVDTLEIFKIAFPTDKSYQLSELAEA
DING_STAHJ      YFHEIAQEIYKQLKDRVFVAHNVDFDLNFIKKAFQNCNIDFKPKKVDTLELFKIAYPTDKSYQLSELAEA
DPO3_CLOTE      KIEEVLPKFIDFIEDSILVAHNANFDVSFIKKNCKDFGIHFNNPILDTIPLCKFLYPELKRYKLNVVAKH
YOAA_ECOLI      ----------------------------------------------------------------------
DPO3_CLOPE      TIDEVLPKFMEFVGNSVLVAHNAAFDVGFIKKNLMDMGKTLKNPVMDTVPLARYLYPDLKKVKLNLVAKH
DPO3_BACSU      DVVDVIRDFREWIGDDILVAHNASFDMGFLAYKKLLEVEKAKNPVIDTLELGRFLYPEFKNHRLNTLCKK
DPO3_BACCR      EVDEVFKKFEEWMGDHTLVAHNASFDMGFINVGFKKAGLETNNPVIDTLELARFLFPEMKNHRLNTMCKK
Y387_HAEIN      ----------------------------------------------------------------------
DPO3_BACHD      EVEQVLNEFHAFIGDAVLVAHNASFDMGFLNTGFQKMGLEAKNPVIDTLELGRFLYPTLKNHRLNTLCKK
DPO3_STRR6      PLEQVLQEFQEFCKDTVLVAHNATFDVGFMNAN--YERHDLSQPVIDTLEFARNLYPEYKRHGLGPLTKR
DPO3_STRPN      PLEQVLQEFQEFCKDTVLVAHNATFDVGFMNAN--YERHDLSQPVIDTLEFARNLYPEYKRHGLGPLTKR
DPO3_STRP2      PLEQVLQEFQEFCKDTVLVAHNATFDVGFMNAN--YERHDLSQPVIDTLEFARNLYPEYKRHGLGPLTKR
DPO3_THETN      LIEEVLPKFLEFAKGAVLVAHNANFDVSFIKSKAKKLGLTVENTVLDTLELSRHLYQDLKNYKLDTLAEF
DPO3_STRPM      PLVTVLKAFQDFCKDSILVAHNASFDVGFMNAN--YERHDLTQPVIDTLEFARNLYPEYKRHGLGPLTKR
DPO3_OCEIH      EVADVLKDFHTWMGNDILVAHNASFDMGFLNQGFQRIDYEASNPVVDTLELARFLLPELRNHRLNTLCKH
DPO3_STRPG      PLVTVLKAFQDFCKDSILVAHNASFDVGFMNAN--YERHDLTQPVIDTLEFARNLYPEYKRHGLGPLTKR
DPO3_STRPC      PLVTVLKAFQDFCKDSILVAHNASFDVGFMNAN--YERHDLTQPVIDTLEFARNLYPEYKRHGLGPLTKR
DPO3_STRPB      PLVTVLKAFQDFCKDSILVAHNASFDVGFMNAN--YERHDLTQPVIDTLEFARNLYPEYKRHGLGPLTKR
DPO3_STRPD      PLVTVLKAFQDFCKDSILVAHNASFDVGFMNAN--YERHDLTQPVIDTLEFARNLYPEYKRHGLGPLTKR
DPO3_STRP8      PLVTVLKAFQDFCKDSILVAHNASFDVGFMNAN--YERHNLTQPVIDTLEFARNLYPEYKRHGLGPLTKR
DPO3_STRPY      PLVTVLKAFQDFCKDSILVAHNASFDVGFMNAN--YERHDLTQPVIDTLEFARNLYPEYKRHGLGPLTKR
DPO3_STRPF      PLVTVLKAFQDFCKDSILVAHNASFDVGFMNAN--YERHDLTQPVIDTLEFARNLYPEYKRHGLGPLTKR
DPO3_STRP6      PLVTVLKAFQDFCKDSILVAHNASFDVGFMNAN--YERHDLTQPVIDTLEFARNLYPEYKRHGLGPLTKR
DPO3_STRP3      PLVTVLKAFQDFCKDSILVAHNASFDVGFMNAN--YERHDLTQPVIDTLEFARNLYPEYKRHGLGPLTKR
DPO3_STRP1      PLVTVLKAFQDFCKDSILVAHNASFDVGFMNAN--YERHDLTQPVIDTLEFARNLYPEYKRHGLGPLTKR
DPO3_STRSV      PLEQVLKEFQEFCQDSVLVAHNATFDVGFMNVNYERHGLKIIQPVIDTLEFARNLYPEYKRHGLGPLTKR
DPO3_STRSY      PLEQVLREFQDFCQDSVMVAHNATFDVGFMNVNYERAGLPISQPVIDTLEFARNLYPDFKRHGLGPLTKR
DPO3_STRS2      PLEQVLREFQDFCQDSVMVAHNATFDVGFMNVNYERAGLPISQPVIDTLEFARNLYPDFKRHGLGPLTKR
DPO3_PEDPA      SEKEVFTKFREFYEDAIIVGHNVTFDIGFMNTGYLRHGMEIKNPIIDTLTLARFLYPTLKGYRLNTLAKK
DPO3_STRMU      PISQVLQEFQSFCQDTVLVAHNATFDVGFMNAN--YERHDLTQPVIDTLEFARNLYPEYKRHGLGPLTKR
DPO3E_RHOCA     AIAEVGRRFHKFAEGAVLVAHNAPFDLEFLRRKELLIGKNFDNPVLDTVLLSAVVFGAAEGHSLDALTHR
DPO3_LACLA      PLYEVLTKFQKFCEGTILVAHNATFDVGFMNMNYSRNGLPITQPVVDTLEFARNLYPEMKRFGLGQLTKK
DPO3E_AQUAE     TIEEVLPEFLEFVGDNIVVGHFVEQDIKFINKTKQYRGKKFRNPSLCTLKLARKVFPGLKKYSLKEIAEN
DPO3_STRTD      PLVQVLQEFQEFCKGAVLVAHNATFDVGFMNAN--YERHQLSQPVIDTLEFARNLYPEYKRHGLGPLTKR
DPO3_STRT2      PLVQVLQEFQEFCKGAVLVAHNATFDVGFMNAN--YERHQLSQPVIDTLEFARNLYPEYKRHGLGPLTKR
DPO3_STRT1      PLVQVLQEFQEFCKGAVLVAHNATFDVGFMNAN--YERHQLSQPVIDTLEFARNLYPEYKRHGLGPLTKR
DPO3_STAES      EIEEVLTEFKEWVGDAIFVAHNASFDMGFIDTGYERLGFPSTNGVIDTLELSRTINTEYGKHGLNFLAKK
DPO3_STAEQ      EIEEVLTEFKEWVGDAIFVAHNASFDMGFIDTGYERLGFPSTNGVIDTLELSRTINTEYGKHGLNFLAKK
DPO3_STAAW      EIEEVLTEFKEWVGDAIFVAHNASFDMGFIDTGYERLGFPSTNGVIDTLELSRTINTEYGKHGLNFLAKK
DPO3_STAAU      EIEEVLTEFKEWVGDAIFVAHNASFDMGFIDTGYERLGFPSTNGVIDTLELSRTINTEYGKHGLNFLAKK
DPO3_STAAS      EIEEVLTEFKEWVGDAIFVAHNASFDMGFIDTGYERLGFPSTNGVIDTLELSRTINTEYGKHGLNFLAKK
DPO3_STAAR      EIEEVLTEFKEWVGDAIFVAHNASFDMGFIDTGYERLGFPSTNGVIDTLELSRTINTEYGKHGLNFLAKK
DPO3_STAAN      EIEEVLTEFKEWVGDAIFVAHNASFDMGFIDTGYERLGFPSTNGVIDTLELSRTINTEYGKHGLNFLAKK
DPO3_STAAM      EIEEVLTEFKEWVGDAIFVAHNASFDMGFIDTGYERLGFPSTNGVIDTLELSRTINTEYGKHGLNFLAKK
DPO3_STAAE      EIEEVLTEFKEWVGDAIFVAHNASFDMGFIDTGYERLGFPSTNGVIDTLELSRTINTEYGKHGLNFLAKK
DPO3_STAAC      EIEEVLTEFKEWVGDAIFVAHNASFDMGFIDTGYERLGFPSTNGVIDTLELSRTINTEYGKHGLNFLAKK
DPO3_STAAB      EIEEVLTEFKEWVGDAIFVAHNASFDMGFIDTGYERLGFPSTNGVIDTLELSRTINTEYGKHGLNFLAKK
DPO3_STAA8      EIEEVLTEFKEWVGDAIFVAHNASFDMGFIDTGYERLGFPSTNGVIDTLELSRTINTEYGKHGLNFLAKK
DPO3_STAA3      EIEEVLTEFKEWVGDAIFVAHNASFDMGFIDTGYERLGFPSTNGVIDTLELSRTINTEYGKHGLNFLAKK
DPO3_STAA1      EIEEVLTEFKEWVGDAIFVAHNASFDMGFIDTGYERLGFPSTNGVIDTLELSRTINTEYGKHGLNFLAKK
DPO3_STRA5      PILQVLQEFQNFCQGTVLVAHNATFDVGFMNAN--YERHNLTQPVIDTLEFARNLYPEYKRHGLGPLTKR
DPO3_STRA3      PILQVLQEFQNFCQGTVLVAHNATFDVGFMNAN--YERHNLTQPVIDTLEFARNLYPEYKRHGLGPLTKR
DPO3_STAHJ      EIEEVLTEFKEWVGDAIFVAHNASFDMGFIDTGYERLGFPSTNGVIDTLELSRTINTEYGKHGLNFLAKK
DPO3_STAS1      EIEEVLTEFKSWVGDAIFVAHNASFDMGFIDTGYEHVGIASTNGVIDTLELSRTINTEYGKHGLNFLAKK
DPO3_LACBA      SEEEVFKLFREFCGDAIIVGHNVTFDVGFMNTGYQRHGMEISNPIIDTLTLARFLYPTLKSYRLNTLAKR
DING_PHOPR      ----------------------------------------------------------------------
YPVA_BACSU      ----------------------------------------------------------------------
DPO3_LACSS      KEAEVLAMFKEFTGDAVLAGHNVSFDMGFLNA-----GYEIDNPVIDTLELSRMLHPEYKNHKLDSLTKR
DPO3_LACS1      SEEEVFRLFKEFCKDCIIVGHNATFDVDFMNT-----GYERHNPWIDTLPLARYLYPEMKGFRLNTLAKK
DPO3_LISIN      PIDVVLKQFREWSGDDILVAHNASFDMGFINTAYEKVGLEAKNAVVDTLELARFLYPHFKNHRLNTLTKK
DPO3_LISW6      PIDVVLKRFKEWSGDDILVAHNASFDMGFI--NTAYEKVGLENAVVDTLELARFLYPHFKNHRLNTLTKK
DPO3_LISMO      PIDVVLKRFKEWSGDDILVAHNASFDMGFINTAYEKVGLEAENAVVDTLELARFLYPHFKNHRLNTLTKK
DPO3_LISMF      PIDVVLKRFKEWSGDDILVAHNASFDMGFINTAYEKVGLEAENAVVDTLELARFLYPHFKNHRLNTLTKK
DPO3_LACC3      SEVDVFKLFQQFCDGAIMVGHNVTFDVGFLDNGYERHGLDIDNPVIDTLELSRMLHPERKNHKLDTLAKQ
DPO3_THEP1      SIEEVLPEFLGFLENSIIVAHNANFDYRFL--RLWIKGLDWERPYIDTLALAKSLL-KMRSYSLDSVVEK
DPO3_LACRD      TEEEVFQMFKDFCKGCIIAGHNVSFDMGFM--NTGYERHQMAEPVIDTLPLARFLYPDMRGYRLNTLSKK
DPO3_LACPL      SEEEVFKLFREFYGDAIVVGHNVTFDIGFM--NTGYARHHMTNPIIDTLTLARWLYPNLRGYRLNTLAKK
DPO3E_PASMU     MFNEVAQQFIDYIQGAELLIHNAPFDVGFMDYEFKKLNLNINTDAIDTLQMARQMYPG-KRNSLDALCDR
DPO3E_HAEIN     EFKEVAQDFLDYINGAELLIHNAPFDVG-------FMDYEFRKLNLDTLQMARQMYPG-KRNNLDALCDR
DING_MYCTU      ----------------------------------------------------------------------
DING_MYCBO      ----------------------------------------------------------------------
DPO3E_TREPA     RFCEIVSDFSRFIKGTVLVAHNANFDVEFLAELSLCKKQPLSHKVVDTYAMAQAVFPGLHQYRLQNLALQ
DING_SALTY      ----------------------------------------------------------------------
DING_SALPA      ----------------------------------------------------------------------
DING_SALCH      ----------------------------------------------------------------------
DING_ECO57      ----------------------------------------------------------------------
DPO3_THEMA      SIEEVLPEFLGFLEDSIIVAHNANFDYRFL--RLWIKGLDWERPYIDTXXXXXXXXXXXXXXXXXVV-EK
DPO3E_BUCBP     KFHEISVKFLEYITNSDLIIHNAKFDVGFINYELNMINSDKRKISVDTLPLARQLFPG-KKNSLDALCNR
DING_SHIFL      ----------------------------------------------------------------------
DING_ECOLI      ----------------------------------------------------------------------
DING_ECOL6      ----------------------------------------------------------------------
DPO3_MYCPU      ELQEALEKISSIFKARIMVAHNAAFDHNFLKQKFIDNNIEFEEMSIDTLNLAKVLNPIYRSYRLGEVASK
DPO3E_BUCAP     SFKDIAKDFFNYIKNSELIIHNASFDVGFINQEFSMLTKKIQDISIDTLKIARKLFPG-KKNTLDALCMR
DPO3E_RICTY     LFHTIANDFLKFIADSTLIIHNAPFDIKFLNHELSIKFLELTN-TIDTLVMARSMFPG-ARYSLDALCKR
DPO3E_RICPR     LFKTIANDFLKFIADSTLIIHNAPFDIKFLNHELSIKFLELTN-TIDTLVMARNMFPG-ARYSLDALCKR
DPO3E_RICBR     LFHTIADDFLEFIADSKLVIHNAPFDVKFLNHELLLKRAEIKEHAIDTLVMARSMFPG-SKYSLDALCKR
REXO4_USTMA     SFSQVQGEVANLIKGKVLVGHAIQNDLKALL---------LSHPKVDTADLAKTKYPSLKKLAKLVLGID
DPO3E_RICCN     LFHTIADDFLEFISDSKLIIHNAPFDIKFLNHELSIKLLELAN-TIDTLVMARSIFPG-SKYNLDALCKR
DPO3E_BUCAI     IFKDIADSFLNYIKNSILVIHNASFDVGFINQEL-----EILNKKIDTLKIARELFPG-KKNTLDALCTR
DPO3E_RICFE     LFHTIADDFLEFISDSKLIIHNAPFDIKFLNHELSIKLLELSN-AIDTLVMARSMFPG-SKYNLDALCKR
Y942_METJA      ----------------------------------------------------------------------
Y2191_MYCTU     TIDAVLPMFFEFAGDSVLVAHNAGFDIGFLRAAARRCDITWPQPQVCTMRLARRVLSRDEAPSXXXXXXX
XPD_THEAC       ----------------------------------------------------------------------
DBP6_CANGA      ----------------------------------------------------------------------
DPO3_MYCPN      EQQAGLEKLRAWLDGCVMVAHNLSFDLPFLQTQ--FEKYNLTNPLIDTLALSWALNPGFASHTLSNICAK
DPO3E_SALTY     VFADVVDEFLDYIRGAELVIHNASFDIGFMDYEFGLLKRDIPKTNTDSLALARKMFPG-KRNSLDALCSE
DPO3E_SALTI     VFADVVDEFLDYIRGAELVIHNASFDIGFMDYEFGLLKRDIPKTNTDSLALARKMFPG-KRNSLDALCSE
DPO3E_ECOLI     TFAEVADEFMDYIRGAELVIHNAAFDIGFMDYEFSLLKRDIPKTNTDSLAVARKMFPG-KRNSLDALCAE
REXO4_SCHPO     SFEKVQAEVAKILDNRVLVGHAVHNDLKVLRDTSRFSGYR---------KLAKGRTPGLKKLAEVILGRD
REXO4_GIBZE     DFEEVQAEIDKLLRGRILVGHDLKHD---------LEALILSHPGKDIRDTAK--FSGFKKYSLRVLAQQ
DPO3_MYCGE      DQQQGLEKIRNYLDDCVMVAHNINFDLPFLQTQ--FEKYNIKNPLIDTLCLSWALNPLFSSHTLSNICSK
ROK1_ASPFU      ----------------------------------------------------------------------
ROK1_ASPCL      ----------------------------------------------------------------------
REXO4_CANGA     SFKQAQQQLSDILKDKILVGHAVKHD---------LEALMLSHPKSKVIDTAR-HLPFRQKYSLKKLAKE
ISG20_PIG       PFAVARLEILQLLKGKLVVGHDLKHDFQALKEDM--NRYTIYDTSTDMLLWREAKLDHCRRVSLRVLCRL
DBP6_KLULA      ----------------------------------------------------------------------
CSHB_BACSU      ----------------------------------------------------------------------
ROK1_ASPOR      ----------------------------------------------------------------------
DDX31_DICDI     ----------------------------------------------------------------------
MS116_SCHPO     ----------------------------------------------------------------------
ISG20_MOUSE     PFGEARLEILQLLKGKLVVGHDLKHDFNALKEDM--SKYTIYDTSTDRLLWHEAKLQYYSRVSLRLLCKR
DBP6_YEAST      ----------------------------------------------------------------------
DBP6_YEAS7      ----------------------------------------------------------------------
ROK1_NEOFI      ----------------------------------------------------------------------
RNT_HAEIE       -FQMIRRGQKDACQRSIIVAHNAAFDQSFVMAAAERTGVK-RNPMFDTASLAGLMFGQTV---LVKACLA
SRMB_ECOLI      ----------------------------------------------------------------------
ROK1_ASPNC      ----------------------------------------------------------------------
REXO4_CRYNE     QFDEVNKQVANLLHDKILIGHAIDNDLKVLM--LTHPGPLTRDTQKPLQEIAKNKRPGLKKLSELL----
Y443_MYCPN      ----------------------------------------------------------------------
DBP7_ASPNC      ----------------------------------------------------------------------
DBP6_LODEL      ----------------------------------------------------------------------
YO12_CAEEL      ----------------------------------------------------------------------
XPD_SULAC       ----------------------------------------------------------------------
ROK1_ASPTN      ----------------------------------------------------------------------
RNT_BUCCC       -FKLVRKKIINKCRKGILVAHNANFDHNFLMAASKRVG-NLNNPTFDTAALSGLIFGQT---VLAKACKL
DBP7_ASPTN      ----------------------------------------------------------------------
AEN_HUMAN       PFQVAQKEILKLLKGKVVVGHALHND---------FQALKYVHPRSQTRDTTYVFLSELKDLALQLLHKK
RH26_ORYSJ      ----------------------------------------------------------------------
DBP6_VANPO      ----------------------------------------------------------------------
DBP6_PICGU      ----------------------------------------------------------------------
AEN_RAT         PFQVAQKEILKLLKGKVVVGHALHNDFQALVPNLLSQPSSLTRARVSLKDLA-----------LNLLHKK
AEN_PONAB       PFQVAQKEILKLLKGKVVVGHALHND---------FQALKYVHPRSQTRDTTYVFLSELKDLALQLLHKK
RH40_ORYSJ      ----------------------------------------------------------------------
REXO4_HUMAN     ELEVVQKEVAEMLKGRILVGHALHNDLKVLF--LDHPKKKIRDTQKYKPFKSQV---KSGRPSLRLLSEK
DDX59_HUMAN     ----------------------------------------------------------------------
DBP7_ASPCL      ----------------------------------------------------------------------
Y022_SIFV       ----------------------------------------------------------------------
ROK1_EMENI      ----------------------------------------------------------------------
ROK1_ASHGO      ----------------------------------------------------------------------
RENT1_NEUCR     ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LGIPLKHAHTALSDAQATAELLLFLREKMTQLPKGLLERLLEMADALLYESYLVIEETYRNQSILSSPDL
DING_BACSU      LQLRHDQPHRADSDAEVTGLIFLEILEKLRQLPYPTLKQLRRLSQHFISDLTHLLDMFINENRHTEIPGY
DING_STAES      HHIPLNNAHRADEDATTTAKLMIKAFEKFEQLHLDTQKQLYYLSKNLKYDLYHILFEMVRNQTKPPNNQF
DING_STAEQ      HHIPLNNAHRADEDATTTAKLMIKAFEKFEQLHLDTQKQLYYLSKNLKYDLYHILFEMVRNQTKPPNNQF
DING_STAS1      HGIILNNAHRADEDAATTAQLMIIAFEKFESLPLDTLKQLYYLSKNLKYDLHDIIFEMVRNYDEQTLSDF
DING_STAAW      HGITLANAHRADEDAATTAKLMILAFEKFEKLPLDTXXXXXXXXXXXXXXXXXIFFEMVRDKSYEKFEQI
DING_STAAS      HGITLANAHRADEDAATTAKLMILAFEKFEKLPLDTXXXXXXXXXXXXXXXXXIFFEMVRDKSYEKFEQI
DING_STAAN      HGITLANAHRADEDAATTAKLMILAFEKFEKLPLDTXXXXXXXXXXXXXXXXXIFFEMVRDKSYEKFEQI
DING_STAAM      HGITLANAHRADEDAATTAKLMILAFEKFEKLPLDTXXXXXXXXXXXXXXXXXIFFEMVRDKSYEKFEQI
DING_STAAC      HGITLANAHRADEDAATTAKLMILAFEKFEKLPLDTXXXXXXXXXXXXXXXXXIFFEMVRDKSYEKFEQI
DING_STAA8      HGITLANAHRADEDAATTAKLMILAFEKFEKLPLDTXXXXXXXXXXXXXXXXXIFFEMVRDKSYEKFEQI
DING_STAA3      HGITLANAHRADEDAATTAKLMILAFEKFEKLPLDTXXXXXXXXXXXXXXXXXIFFEMVRDKSYEKFEQI
DING_STAAR      HGITLANAHRADEDAATTAKLMILAFEKFEKLPLDTXXXXXXXXXXXXXXXXXIFFEMVRDKSYEKFEQI
DING_STAAB      HGITLANAHRADEDAATTAKLMILAFEKFEKLPLDTXXXXXXXXXXXXXXXXXIFFEMVRQKSYEKFEQI
DING_STAHJ      HDIPLDNAHRADEDATTTALLMIKAFQKFEQLPIDTLKQLYYLSKNLKYDLFNVLFEMVRQHE--NSPQY
DPO3_CLOTE      LGIPLLNHHRAVEDAKTTGDILLKAFE--------------DLKDKEIMNLNMLNEEYFKNQDIKKSP--
YOAA_ECOLI      ----------------------------------------------------------------------
DPO3_CLOPE      LGISLENHHRAVDDAKATAEILKFSFKKMKE---------------------------------------
DPO3_BACSU      FDIELTQHHRAIYDTEATAYLLL-----------------------------------------------
DPO3_BACCR      LDIELTQHHRAIYDTEATGYLLV-------KMLKDVIEKGFEYHDQL-----------------------
Y387_HAEIN      ----------------------------------------------------------------------
DPO3_BACHD      FDIELVSHHRAIYDAEATGHLL------------------------------------------------
DPO3_STRR6      FGVALEHHHMANYDAEATGRLLIFIKE-------------------------------------------
DPO3_STRPN      FGVALEHHHMANYDAEATGRLLIFIKE-------------------------------------------
DPO3_STRP2      FGVALEHHHMANYDAEATGRLLIFIKE-------------------------------------------
DPO3_THETN      FEVKLLHHHRAVEDAKATAEIFIKMLEKLSEINSVLMEREVDVKKLPVYHVTILVKD-------------
DPO3_STRPM      FQVSLDHHHMANYDAEATGRLLIFLRDAR---EKHGIKNLLQL------NTDLVAEDSYKKARIKHATIY
DPO3_OCEIH      LDIELTQHHRAIYDAEATGYLLWKLVQRLVE---------------------------------------
DPO3_STRPG      FQVSLDHHHMANYDAEATGRLLIFLRDAR---EKHGIKNLLQL------NTDLVAEDSYKKARIKHATIY
DPO3_STRPC      FQVSLDHHHMANYDAEATGRLLIFLRDAR---EKHGIKNLLQL------NTDLVAEDSYKKARIKHATIY
DPO3_STRPB      FQVSLDHHHMANYDAEATGRLLIFLRDAR---EKHGIKNLLQL------NTDLVAEDSYKKARIKHATIY
DPO3_STRPD      FQVSLDHHHMANYDAEATGRLLIFLKDAR---EKHGIKNLLQL------NTDLVAEDSYKKARIKHATIY
DPO3_STRP8      FQVSLDHHHMANYDAEATGRLLIFLRDAR---EKHGIKNLLQL------NTDLVAEDSYKKARIKHATIY
DPO3_STRPY      FQVSLDHHHMANYDAEATGRLLIFLKDAR---EKHGIKNLLQL------NTDLVAEDSYKKARIKHATIY
DPO3_STRPF      FQVSLDHHHMANYDAEATGRLLIFLKDAR---EKHGIKNLLQL------NTDLVAEDSYKKARIKHATIY
DPO3_STRP6      FQVSLDHHHMANYDAEATGRLLIFLKDAR---EKHGIKNLLQL------NTDLVAEDSYKKARIKHATIY
DPO3_STRP3      FQVSLDHHHMANYDAEATGRLLIFLKDAR---EKHGIKNLLQL------NTDLVAEDSYKKARIKHATIY
DPO3_STRP1      FQVSLDHHHMANYDAEATGRLLIFLKDAR---EKHGIKNLLQL------NTDLVAEDSYKKARIKHATIY
DPO3_STRSV      FQIALEHHHMANYDAEATGRLLIFIKD-------------------------------------------
DPO3_STRSY      FGVALEHHHMANYDAEATGRLLIFLKDAL-----------------------------------------
DPO3_STRS2      FGVALEHHHMANYDAEATGRLLIFLKDAL-----------------------------------------
DPO3_PEDPA      FGVALEHHHRAIYDSETTGHLYLFLKD-------------------------------------------
DPO3_STRMU      FQVSLEHHHMANYDAEATGRLLIFLKE-------------------------------------------
DPO3E_RHOCA     LGIPEEARHTALGDTVATAEAFLRL---------------------------------------------
DPO3_LACLA      FQIGLEHHHMANFDAEATGRLLFVFLEELRTRNTGWTS-LLELNDKLVSE--------------------
DPO3E_AQUAE     FGFETNGVHRALKDATLTAEIFIKILEEL-----------------------------------------
DPO3_STRTD      FGVALDHHHMANYDAEATGRLLIFIKDVFEKHGLTNLEQL---------NTELVSDDSYKKSRVKHATLY
DPO3_STRT2      FGVALDHHHMANYDAEATGRLLIFIKDVFEKHGLTNLEQL---------NTELVSDDSYKKSRVKHATLY
DPO3_STRT1      FGVALDHHHMANYDAEATGRLLIFIKDVFEKHGLTNLEQL---------NTELVSDDSYKKSRVKHATLY
DPO3_STAES      YGVELTQHHRAIYDTEATAYIFIKMVQQMKEL--------------------------------------
DPO3_STAEQ      YGVELTQHHRAIYDTEATAYIFIKMVQQMKEL--------------------------------------
DPO3_STAAW      YGVELTQHHRAIYDTEATAYIFIKMVQQMKEL--------------------------------------
DPO3_STAAU      YGVELTQHHRAIYDTEATAYIFIKMVQQMKEL--------------------------------------
DPO3_STAAS      YGVELTQHHRAIYDTEATAYIFIKMVQQMKEL--------------------------------------
DPO3_STAAR      YGVELTQHHRAIYDTEATAYIFIKMVQQMKEL--------------------------------------
DPO3_STAAN      YGVELTQHHRAIYDTEATAYIFIKMVQQMKEL--------------------------------------
DPO3_STAAM      YGVELTQHHRAIYDTEATAYIFIKMVQQMKEL--------------------------------------
DPO3_STAAE      YGVELTQHHRAIYDTEATAYIFIKMVQQMKEL--------------------------------------
DPO3_STAAC      YGVELTQHHRAIYDTEATAYIFIKMVQQMKEL--------------------------------------
DPO3_STAAB      YGVELTQHHRAIYDTEATAYIFIKMVQQMKEL--------------------------------------
DPO3_STAA8      YGVELTQHHRAIYDTEATAYIFIKMVQQMKEL--------------------------------------
DPO3_STAA3      YGVELTQHHRAIYDTEATAYIFIKMVQQMKEL--------------------------------------
DPO3_STAA1      YGVELTQHHRAIYDTEATAYIFIKMVQQMKEL--------------------------------------
DPO3_STRA5      FQVALEHHHMANYDAEATGRLLIFLKEAREN---------RDVTNLMELNTKLVAEDSYKKARIKHATIY
DPO3_STRA3      FQVALEHHHMANYDAEATGRLLIFLKEAREN---------RDVTNLMELNTKLVAEDSYKKARIKHATIY
DPO3_STAHJ      YGVELTQHHRAIYDTESTAYIFIKMVQQMKEL--------------------------------------
DPO3_STAS1      YGVELTQHHRAIYDTEATAYMFIKMLKQLEAL--------------------------------------
DPO3_LACBA      FHVSLEHHHRAVYDAESTGHLYLFLKD-------------------------------------------
DING_PHOPR      ----------------------------------------------------------------------
YPVA_BACSU      ----------------------------------------------------------------------
DPO3_LACSS      YKINLEHHHRANADAESTGYLLYKLEKEAAE---------------------------------------
DPO3_LACS1      LNIKLEHHHRAIYDAEAT----------------------------------------------------
DPO3_LISIN      FNIILEQHHRAVFDAEATAYL-------------------------------------------------
DPO3_LISW6      FNIILEQHHRAVFDAEATAYL-------------------------------------------------
DPO3_LISMO      FNIILEQHHRAVFDAEATAYL-------------------------------------------------
DPO3_LISMF      FNIILEQHHRAVFDAEATAYL-------------------------------------------------
DPO3_LACC3      YKVSLEHHHRANADAEATGYLLYALEKEAAKM--------------------------------------
DPO3_THEP1      LGLPFRH-HRALDDARVTAQVFLRFVEMMKKIGITKLSEIENLKDTIDY---------------------
DPO3_LACRD      FKVALEHHHRANYDSEATGHLLYFLKD-------------------------------------------
DPO3_LACPL      FNVNLEHHHRAIYDAETTGHLHLFLKD-------------------------------------------
DPO3E_PASMU     LGISKRTLHGALLDAEILADVYLTMTGGQTSL--------------------------------------
DPO3E_HAEIN     LGISKRTLHGALLDAEILADVYLMMTGGQTNL--------------------------------------
DING_MYCTU      ----------------------------------------------------------------------
DING_MYCBO      ----------------------------------------------------------------------
DPO3E_TREPA     FGLTVHAAHRAEDDARVCMEL-------------------------------------------------
DING_SALTY      ----------------------------------------------------------------------
DING_SALPA      ----------------------------------------------------------------------
DING_SALCH      ----------------------------------------------------------------------
DING_ECO57      ----------------------------------------------------------------------
DPO3_THEMA      LGLPFRH-HRALDDARVTAQVFLRFVEMMKKIGITKLSEMEKLKDTIDY---------------------
DPO3E_BUCBP     YKINVSHRHSALIDAKLLAKVYTFM---------------------------------------------
DING_SHIFL      ----------------------------------------------------------------------
DING_ECOLI      ----------------------------------------------------------------------
DING_ECOL6      ----------------------------------------------------------------------
DPO3_MYCPU      LSVVYSIAHRADYDSSVLTNIFILQMSHLKEKGINLFKELNSLSSEKFY---------------------
DPO3E_BUCAP     YKIKNSHLHGAILDAFLLGKLYLLM---------------------------------------------
DPO3E_RICTY     FKVDNRQLHGALKDAALLAEVYVAL---------------------------------------------
DPO3E_RICPR     FKVDNRQLHGALKDAALLAEVYVAL---------------------------------------------
DPO3E_RICBR     FKVDNRQLHGALKDAALLAEVYVEL---------------------------------------------
REXO4_USTMA     IQLE-GESHSSVEDARATMAVFRSQKPKWDEM--------------------------------------
DPO3E_RICCN     FKVDNRQLHGALKDAALLAEVYVEL---------------------------------------------
DPO3E_BUCAI     YKINKSHLHSAIVDSYLLGKLYLLM---------------------------------------------
DPO3E_RICFE     FKVDNRQLHGALKDAALLAEVYVEL---------------------------------------------
Y942_METJA      ----------------------------------------------------------------------
Y2191_MYCTU     XXXXXNPTHRALDDARATVDVLHALIERV-----------------------------------------
XPD_THEAC       ----------------------------------------------------------------------
DBP6_CANGA      ------------------------------------------------------------------TPKL
DPO3_MYCPN      LKFDFERLHRADYDTQALKKVFDYFKEQVELM--GITXXXXXXXXXXXXCHFELLKRTFTNTGI------
DPO3E_SALTY     IDNSKRTLHGALLDAQILAEVYLFAMEGETQRQQGTIQRIVRQASRLRV-VFASEEELAAHESRL---DL
DPO3E_SALTI     IDNSKRTLHGALLDAQILAEVYLFAMEGETQRQQGTIQRIVRQASRLRV-VFASEEELAAHESRL---DL
DPO3E_ECOLI     IDNSKRTLHGALLDAQILAEVYLAMTGGQTSM--------------------------------------
REXO4_SCHPO     I---QSGQHSSVQDAQATMELYKKVKKEMDEVAKGL----------------------------------
REXO4_GIBZE     LGVEIQGGHSSIEDARAT--MLLFRKHK------------------------------------------
DPO3_MYCGE      LKLEFERLHRAEYDTEALKKVFFYFKKQLKEM--------------------------------------
ROK1_ASPFU      ----------------------------------------------------------------------
ROK1_ASPCL      ----------------------------------------------------------------LTKKEQ
REXO4_CANGA     LNMDIQSGHSSVEDARAT----------------------------------------------------
ISG20_PIG       LHKSIQNSHSSVEDAKATMEL-------------------------------------------------
DBP6_KLULA      ----------------------------------------------------------------------
CSHB_BACSU      ----------------------------------------------------------------------
ROK1_ASPOR      ----------------------------------------------------------------LTKKEQ
DDX31_DICDI     ----------------------------------------------------------------------
MS116_SCHPO     ----------------------------------------------------------------------
ISG20_MOUSE     L---------------------------------------------------------------------
DBP6_YEAST      ----------------------------------------------------------------------
DBP6_YEAS7      ----------------------------------------------------------------------
ROK1_NEOFI      ----------------------------------------------------------------------
RNT_HAEIE       AKIPFKQAHSALYDTERTAELFCYMVNHLKDL--------------------------------------
SRMB_ECOLI      ----------------------------------------------------------------------
ROK1_ASPNC      ----------------------------------------------------------------------
REXO4_CRYNE     LGVQIQGAHSSVVDARVAMAL-------------------------------------------------
Y443_MYCPN      ----------------------------------------------------------------------
DBP7_ASPNC      ----------------------------------------------------------------------
DBP6_LODEL      ----------------------------------------------------------------------
YO12_CAEEL      ----------------------------------------------------------------------
XPD_SULAC       ----------------------------------------------------------------------
ROK1_ASPTN      ----------------------------------------------------------------------
RNT_BUCCC       AGIPFNQAHSALYDTIQTAYLFCELVNRWKRL--------------------------------------
DBP7_ASPTN      ----------------------------------------------------------------------
AEN_HUMAN       IQVG-QHGHSSVEDATTAMEL-------------------------------------------------
RH26_ORYSJ      ----------------------------------------------------------------------
DBP6_VANPO      ----------------------------------------------------------------------
DBP6_PICGU      ----------------------------------------------------------------------
AEN_RAT         IQVG-HHGHSSVEDAMTAMEL-------------------------------------------------
AEN_PONAB       IQVG-QHGHSSVEDATTAMEL-------------------------------------------------
RH40_ORYSJ      ----------------------------------------------------------------------
REXO4_HUMAN     LGLQVQQAHCSIQDAQAAMRLYVMVKKEWESMAR------------------------------------
DDX59_HUMAN     ----------------------------------------------------------------------
DBP7_ASPCL      ----------------------------------------------------------------------
Y022_SIFV       -------------------------------------------------------EGKYTEEEILKSYGF
ROK1_EMENI      ----------------------------------------------------------------------
ROK1_ASHGO      ----------------------------------------------------------------------
RENT1_NEUCR     ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           VQVQGLYFKKTAASLELRKLSQDFSKNISLLNLEVREEQESFAKEVGLLLKDEPVSLIQAPTGIGKTYGY
DING_BACSU      TRFSSFSVREPEASFEIESWEAGNEKALSELGYEKRDGQMMMMREVADAFANREHALIEAPPGIGKTIGY
DING_STAES      EQFEQIIYRK---QIDLKKPAKDLYKNVTSLNLTYRPQQLYLAEIILDQLMHSDKAMIEAPLGSGKSLAY
DING_STAEQ      EQFEQIIYRK---QIDLKKPAKDLYKNVTSLNLTYRPQQLYLAEIILDQLMHSDKAMIEAPLGSGKSLAY
DING_STAS1      DQFEQIIYKK---QIDFKAPTVQFGGNLKALYTLVTKEQQLYLSEIILQLMHSEKAMIEAPLGSGKSFAY
DING_STAAW      IYRKQVDFKKPTTNYN-GSLKSLYSKAVDQLGLTYRPQQLYLAETILDQLMHSEKAMIEASLGSGKSLAY
DING_STAAS      IYRKQVDFKKPTTNYN-GSLKSLYSKAVDQLGLTYRPQQLYLAETILDQLMHSEKAMIEASLGSGKSLAY
DING_STAAN      IYRKQVDFKKPTTNYN-GSLKSLYSKAVDQLGLTYRPQQLYLAETILDQLMHSEKAMIEASLGSGKSLAY
DING_STAAM      IYRKQVDFKKPTTNYN-GSLKSLYSKAVDQLGLTYRPQQLYLAETILDQLMHSEKAMIEASLGSGKSLAY
DING_STAAC      IYRKQVDFKKPTTNYN-GSLKSLYSKAVDQLGLTYRPQQLYLAETILDQLMHSEKAMIEASLGSGKSLAY
DING_STAA8      IYRKQVDFKKPTTNYN-GSLKSLYSKAVDQLGLTYRPQQLYLAETILDQLMHSEKAMIEASLGSGKSLAY
DING_STAA3      IYRKQVDFKKPTTNYN-GSLKSLYSKAVDQLGLTYRPQQLYLAETILDQLMHSEKAMIEASLGSGKSLAY
DING_STAAR      IYRKQVDFKKPTTNYN-GSLKSLYSKAVDQLGLTYRPQQLYLAETILDQLMHSEKAMIEASLGSGKSLAY
DING_STAAB      IYRKQVDFKKPTTNYN-GSLKSLYSKAVDQLGLTYRPQQLYLAETILDQLMHSEKAMIEASLGSGKSLAY
DING_STAHJ      GQFEQIIYKK---QIDLKSLKDLYSEVVKSLNLTYRPQQLYLSEIILEQLMHNDKAMIEAPLGSGKSLAY
DPO3_CLOTE      ----------------------------------------------------------------------
YOAA_ECOLI      -----------------------------------REPQRQMAVAVTQAIEKGQPLVVEAGTGTGKTYAY
DPO3_CLOPE      ----------------------------------------------------------------------
DPO3_BACSU      ----------------------------------------------------------------------
DPO3_BACCR      ----------------------------------------------------------------------
Y387_HAEIN      -------------------LNGELSQNIK--GFRPRAEQLEMAYAVGKAIQNKSSLVIEAGTGTGKTFAY
DPO3_BACHD      ----------------------------------------------------------------------
DPO3_STRR6      ----------------------------------------------------------------------
DPO3_STRPN      ----------------------------------------------------------------------
DPO3_STRP2      ----------------------------------------------------------------------
DPO3_THETN      ----------------------------------------------------------------------
DPO3_STRPM      VQNQ------------------------------------------------------------------
DPO3_OCEIH      ----------------------------------------------------------------------
DPO3_STRPG      VQNQ------------------------------------------------------------------
DPO3_STRPC      VQNQ------------------------------------------------------------------
DPO3_STRPB      VQNQ------------------------------------------------------------------
DPO3_STRPD      VQNQ------------------------------------------------------------------
DPO3_STRP8      VQNQ------------------------------------------------------------------
DPO3_STRPY      VQNQ------------------------------------------------------------------
DPO3_STRPF      VQNQ------------------------------------------------------------------
DPO3_STRP6      VQNQ------------------------------------------------------------------
DPO3_STRP3      VQNQ------------------------------------------------------------------
DPO3_STRP1      VQNQ------------------------------------------------------------------
DPO3_STRSV      ----------------------------------------------------------------------
DPO3_STRSY      ----------------------------------------------------------------------
DPO3_STRS2      ----------------------------------------------------------------------
DPO3_PEDPA      ----------------------------------------------------------------------
DPO3_STRMU      ----------------------------------------------------------------------
DPO3E_RHOCA     ----------------------------------------------------------------------
DPO3_LACLA      ----------------------------------------------------------------------
DPO3E_AQUAE     ----------------------------------------------------------------------
DPO3_STRTD      VQNQ------------------------------------------------------------------
DPO3_STRT2      VQNQ------------------------------------------------------------------
DPO3_STRT1      VQNQ------------------------------------------------------------------
DPO3_STAES      ----------------------------------------------------------------------
DPO3_STAEQ      ----------------------------------------------------------------------
DPO3_STAAW      ----------------------------------------------------------------------
DPO3_STAAU      ----------------------------------------------------------------------
DPO3_STAAS      ----------------------------------------------------------------------
DPO3_STAAR      ----------------------------------------------------------------------
DPO3_STAAN      ----------------------------------------------------------------------
DPO3_STAAM      ----------------------------------------------------------------------
DPO3_STAAE      ----------------------------------------------------------------------
DPO3_STAAC      ----------------------------------------------------------------------
DPO3_STAAB      ----------------------------------------------------------------------
DPO3_STAA8      ----------------------------------------------------------------------
DPO3_STAA3      ----------------------------------------------------------------------
DPO3_STAA1      ----------------------------------------------------------------------
DPO3_STRA5      VQNQ------------------------------------------------------------------
DPO3_STRA3      VQNQ------------------------------------------------------------------
DPO3_STAHJ      ----------------------------------------------------------------------
DPO3_STAS1      ----------------------------------------------------------------------
DPO3_LACBA      ----------------------------------------------------------------------
DING_PHOPR      ----------------------------------------------------------EAGTGIGKSLAY
YPVA_BACSU      ---------------------------------DLRDEQVFMAFQLERAFKEKKVMFAEAGVGTGKTLVY
DPO3_LACSS      ----------------------------------------------------------------------
DPO3_LACS1      ----------------------------------------------------------------------
DPO3_LISIN      ----------------------------------------------------------------------
DPO3_LISW6      ----------------------------------------------------------------------
DPO3_LISMO      ----------------------------------------------------------------------
DPO3_LISMF      ----------------------------------------------------------------------
DPO3_LACC3      ----------------------------------------------------------------------
DPO3_THEP1      ----------------------------------------------------------------------
DPO3_LACRD      ----------------------------------------------------------------------
DPO3_LACPL      ----------------------------------------------------------------------
DPO3E_PASMU     ----------------------------------------------------------------------
DPO3E_HAEIN     ----------------------------------------------------------------------
DING_MYCTU      -----------------------------------RRGQQEMAAAVAHAFETGEHLVVQAGTGTGKSLAY
DING_MYCBO      -----------------------------------RRGQQEMAAAVAHAFETGEHLVVQAGTGTGKSLAY
DPO3E_TREPA     ----------------------------------------------------------------------
DING_SALTY      ---------------------------------------------------------IEAPTGVGKTLSY
DING_SALPA      ---------------------------------------------------------IEAPTGVGKTLSY
DING_SALCH      ---------------------------------------------------------IEAPTGVGKTLSY
DING_ECO57      ---------------------------------------------------------IEAPTGVGKTLSY
DPO3_THEMA      ----------------------------------------------------------------------
DPO3E_BUCBP     ----------------------------------------------------------------------
DING_SHIFL      ---------------------------------------------------------IEAPTGVGKTLSY
DING_ECOLI      ---------------------------------------------------------IEAPTGVGKTLSY
DING_ECOL6      ---------------------------------------------------------IEAPTGVGKTLSY
DPO3_MYCPU      ----------------------------------------------------------------------
DPO3E_BUCAP     ----------------------------------------------------------------------
DPO3E_RICTY     ----------------------------------------------------------------------
DPO3E_RICPR     ----------------------------------------------------------------------
DPO3E_RICBR     ----------------------------------------------------------------------
REXO4_USTMA     ----------------------------------------------------------------------
DPO3E_RICCN     ----------------------------------------------------------------------
DPO3E_BUCAI     ----------------------------------------------------------------------
DPO3E_RICFE     ----------------------------------------------------------------------
Y942_METJA      ---------------------------------KVREPQKRMMLKIYECIKNKRNLIVEAPTGVGKTLGY
Y2191_MYCTU     ----------------------------------------------------------------------
XPD_THEAC       ----------------------------------------------------------------------
DBP6_CANGA      LNNIEKYFSKSTFPIQTAMLDQ----YLKLINFTLKTSKKNFTRRIGDIL-------VNASTGSGKTLAY
DPO3_MYCPN      -----IYIKSQSGFAKLYELSIALTDNNATRPLVLTSTLQKFAK--SFVITDNPV---------------
DPO3E_SALTY     VQKKG-----------------------------------------------------------------
DPO3E_SALTI     VQKKG-----------------------------------------------------------------
DPO3E_ECOLI     ----------------------------------------------------------------------
REXO4_SCHPO     ----------------------------------------------------------------------
REXO4_GIBZE     ----------------------------------------------------------------------
DPO3_MYCGE      ----------------------------------------------------------------------
ROK1_ASPFU      ----------------------------------------------------EPDLLVVAPTGSGKTLSF
ROK1_ASPCL      KKARRLYPEPLVSFKELRKISSRLAENIAEQGFTVPTEVQGFESKAGESV--EPDLLVVAPTGSGKTLSF
REXO4_CANGA     ----------------------------------------------------------------------
ISG20_PIG       ----------------------------------------------------------------------
DBP6_KLULA      -----------------------FDKVLPLLNSSFKANRKLFTRRVGDI-------LVNASTGSGKTLAY
CSHB_BACSU      ------------------------------------------------VLKKESV-IGQSQTGTGKTHAY
ROK1_ASPOR      KKARRLFPRPLVSFKELRKISRRLAENITEQGFTVPTEVQLGTRTIGQSKTEEPVELVVAPTGSGKTLSF
DDX31_DICDI     -------------------------------------------------------ALVKAQTGSGKTLSY
MS116_SCHPO     ---------------EVASLSSTFKNSLSRAGFEMTPVQQRVLNEV---FPNEENAVVQAKTGTGKTLAF
ISG20_MOUSE     ----------------------------------------------------------------------
DBP6_YEAST      ---------------------------LPVLNFTLNVSKRNFTRRIGDIL-------VNAATGSGKTLAY
DBP6_YEAS7      ---------------------------LPVLNFTLNVSKRNFTRRIGDIL-------VNAATGSGKTLAY
ROK1_NEOFI      ----------------------------------------------------EPDLLVVAPTGSGKTLSF
RNT_HAEIE       ----------------------------------------------------------------------
SRMB_ECOLI      -----------------------------------------------------------APTGTGKTAAY
ROK1_ASPNC      ---------------------------VQLGSLPLLLGDQSVPQKSGTEKSTEPDLLVVAPTGSGKTLSF
REXO4_CRYNE     ----------------------------------------------------------------------
Y443_MYCPN      -----------------------------------------------------------AETGSGKTFAY
DBP7_ASPNC      -----------------------------LTKLEVKAPTAIQKASITQLLKEESDAFIQAETGSGKTMAY
DBP6_LODEL      -------------------------------NLESLGFENAFAVQVGVLSKLLPEILVNASTGSGKTLAY
YO12_CAEEL      ---------------------------------------------------------IAAPTGSGKTICY
XPD_SULAC       ----------------------------------------------------------------------
ROK1_ASPTN      ----------------------------------------------------EPDLLVVAPTGSGKTLSF
RNT_BUCCC       ----------------------------------------------------------------------
DBP7_ASPTN      -----------------------------LTKLELKAPTAIQKASISQLLKEESDAFIQAETGSGKTLAY
AEN_HUMAN       ----------------------------------------------------------------------
RH26_ORYSJ      -----------------------------------------------IILQGEDV-LAKAKTGTGKTVAF
DBP6_VANPO      ----------------LKNIQQNFSTDLPTLNFSYNITKKNFTRRVGDVL-------VNASTGSGKTLAY
DBP6_PICGU      -------------NLQSNGFSSAFSVQVSVLKLLLPDESQAIRPDIGGDL------LVNAATGSGKTLGY
AEN_RAT         ----------------------------------------------------------------------
AEN_PONAB       ----------------------------------------------------------------------
RH40_ORYSJ      -----------------------------------------------------------AKTGSGKTLGY
REXO4_HUMAN     ----------------------------------------------------------------------
DDX59_HUMAN     ILVQGQEVTRPIIDFEHCSLPEVLNHNLKKSGYEVPTPIQMQMIPVGLLGRD---ILASADTGSGKTAAF
DBP7_ASPCL      -----------------------------LTKLELKAPTAIQKASISQLLKEDGDAFIQAETGSGKTLAY
Y022_SIFV       VTLRGLYWKKNIANFDLKPFTNLRFYDIQLKNFEMRNYQKSWVSDVNVIGN----GIIKAPTGSGKSVIA
ROK1_EMENI      ----------------------------------------------------EPDLLVVAPTGSGKTLSF
ROK1_ASHGO      -----------------------------------------------------------APTGSGKTLAF
RENT1_NEUCR     -----------------------------------------------------PLSLIQGPPGTGKTVAT


                         .         *         .         .         .         .         +:350
query           LLPALSQSKERQIVLSVPTKILQNQIMEEEGKRLKEVFHTDIHSLKGPQNYLKLDAFYHSLQENDENRLF
DING_BACSU      LIPAFAKKSKKPVIISTYSTLLQQQILTKDLPIVQDLFPFPVTALKGQSHYLCLYKFEQVLHEEDDNYDA
DING_STAES      LLAATMYNIERHVMISTNTKLLQSQLLEKDIPLLNDVLDFKINAIKSKNDYISLGLISQILKDDTNNYEV
DING_STAEQ      LLAATMYNIERHVMISTNTKLLQSQLLEKDIPLLNDVLDFKINAIKSKNDYISLGLISQILKDDTNNYEV
DING_STAS1      LLASLMYNIEKHVMISTNTKLLQNQLLEKDIPAIKKALDFKINAIKSKRDYIALGLISQILEEESSNYEV
DING_STAAW      LLAALMYNIEKHVMISTNTKLLQSQLLEKDIPAMNEALNFKINALKSKSDYISLGLISQILKDDTSNYEV
DING_STAAS      LLAALMYNIEKHVMISTNTKLLQSQLLEKDIPAMNEALNFKINALKSKSDYISLGLISQILKDDTSNYEV
DING_STAAN      LLAALMYNIEKHVMISTNTKLLQSQLLEKDIPAMNEALNFKINALKSKSDYISLGLISQILKDDTSNYEV
DING_STAAM      LLAALMYNIEKHVMISTNTKLLQSQLLEKDIPAMNEALNFKINALKSKSDYISLGLISQILKDDTSNYEV
DING_STAAC      LLAALMYNIEKHVMISTNTKLLQSQLLEKDIPAMNEALNFKINALKSKSDYISLGLISQILKDDTSNYEV
DING_STAA8      LLAALMYNIEKHVMISTNTKLLQSQLLEKDIPAMNEALNFKINALKSKSDYISLGLISQILKDDTSNYEV
DING_STAA3      LLAALMYNIEKHVMISTNTKLLQSQLLEKDIPAMNEALNFKINALKSKSDYISLGLISQILKDDTSNYEV
DING_STAAR      LLAALMYNIEKHVMISTNTKLLQSQLLEKDIPAMNEALNFKINALKSKSDYISLGLISQILKDDTSNYEV
DING_STAAB      LLAALMYNIEKHVMISTNTKLLQSQLLEKDIPAMNEALNFKINALKSKSDYISLGLISQILKDDTSNYEV
DING_STAHJ      LLAALMYNIERHVMISXXXXXXXXXXXXXDIPSINQALNFKINAIKSKSEYISLGLISQILKDETTNYEV
DPO3_CLOTE      ----------------------------------------------------------------------
YOAA_ECOLI      LAPALRAKKK--VIISTGSKALQDQLYSRDSKALK--YTGNVALLKGRSNYLCLERLQQALAGGDLPVQI
DPO3_CLOPE      ----------------------------------------------------------------------
DPO3_BACSU      ----------------------------------------------------------------------
DPO3_BACCR      ----------------------------------------------------------------------
Y387_HAEIN      LAPALVFGK--KTIISTGSKNLQDQLFNRDLPAIKKAFTGKIALLKGRANYLCLERLDQVIAQGDKSVLA
DPO3_BACHD      ----------------------------------------------------------------------
DPO3_STRR6      ----------------------------------------------------------------------
DPO3_STRPN      ----------------------------------------------------------------------
DPO3_STRP2      ----------------------------------------------------------------------
DPO3_THETN      ----------------------------------------------------------------------
DPO3_STRPM      ----------------------------------------------------------------------
DPO3_OCEIH      ----------------------------------------------------------------------
DPO3_STRPG      ----------------------------------------------------------------------
DPO3_STRPC      ----------------------------------------------------------------------
DPO3_STRPB      ----------------------------------------------------------------------
DPO3_STRPD      ----------------------------------------------------------------------
DPO3_STRP8      ----------------------------------------------------------------------
DPO3_STRPY      ----------------------------------------------------------------------
DPO3_STRPF      ----------------------------------------------------------------------
DPO3_STRP6      ----------------------------------------------------------------------
DPO3_STRP3      ----------------------------------------------------------------------
DPO3_STRP1      ----------------------------------------------------------------------
DPO3_STRSV      ----------------------------------------------------------------------
DPO3_STRSY      ----------------------------------------------------------------------
DPO3_STRS2      ----------------------------------------------------------------------
DPO3_PEDPA      ----------------------------------------------------------------------
DPO3_STRMU      ----------------------------------------------------------------------
DPO3E_RHOCA     ----------------------------------------------------------------------
DPO3_LACLA      ----------------------------------------------------------------------
DPO3E_AQUAE     ----------------------------------------------------------------------
DPO3_STRTD      ----------------------------------------------------------------------
DPO3_STRT2      ----------------------------------------------------------------------
DPO3_STRT1      ----------------------------------------------------------------------
DPO3_STAES      ----------------------------------------------------------------------
DPO3_STAEQ      ----------------------------------------------------------------------
DPO3_STAAW      ----------------------------------------------------------------------
DPO3_STAAU      ----------------------------------------------------------------------
DPO3_STAAS      ----------------------------------------------------------------------
DPO3_STAAR      ----------------------------------------------------------------------
DPO3_STAAN      ----------------------------------------------------------------------
DPO3_STAAM      ----------------------------------------------------------------------
DPO3_STAAE      ----------------------------------------------------------------------
DPO3_STAAC      ----------------------------------------------------------------------
DPO3_STAAB      ----------------------------------------------------------------------
DPO3_STAA8      ----------------------------------------------------------------------
DPO3_STAA3      ----------------------------------------------------------------------
DPO3_STAA1      ----------------------------------------------------------------------
DPO3_STRA5      ----------------------------------------------------------------------
DPO3_STRA3      ----------------------------------------------------------------------
DPO3_STAHJ      ----------------------------------------------------------------------
DPO3_STAS1      ----------------------------------------------------------------------
DPO3_LACBA      ----------------------------------------------------------------------
DING_PHOPR      LLGGIALFNNKKLLISTATVALQEQLINKDLPLFNRIYPKEFSFIKGRQRYCKLEAC--CATNNDQ----
YPVA_BACSU      LLFAISYARYKPAIIACADETLIEQLVKKEGDISKLAEHLDLRLSKSHEQYLCLKKLEKTMQRSDDDKWL
DPO3_LACSS      ----------------------------------------------------------------------
DPO3_LACS1      ----------------------------------------------------------------------
DPO3_LISIN      ----------------------------------------------------------------------
DPO3_LISW6      ----------------------------------------------------------------------
DPO3_LISMO      ----------------------------------------------------------------------
DPO3_LISMF      ----------------------------------------------------------------------
DPO3_LACC3      ----------------------------------------------------------------------
DPO3_THEP1      ----------------------------------------------------------------------
DPO3_LACRD      ----------------------------------------------------------------------
DPO3_LACPL      ----------------------------------------------------------------------
DPO3E_PASMU     ----------------------------------------------------------------------
DPO3E_HAEIN     ----------------------------------------------------------------------
DING_MYCTU      LVPAIIRADDAPVVVSTATIALQRQLVDRDLPQLVDSLTNALPRLKGRRNYLCLNKIHNSVTASDQEELF
DING_MYCBO      LVPAIIRADDAPVVVSTATIALQRQLVDRDLPQLVDSLTNALPRLKGRRNYLCLNKIHNSVTASDQEELF
DPO3E_TREPA     ----------------------------------------------------------------------
DING_SALTY      LIPGIAIAREEQLVVSTANVALQDQIFSKDLPLLRKII-PDLRFTAAPRNLAALASSEPTQQD-------
DING_SALPA      LIPGIAIAREEQLVVSTANVALQDQIFSKDLPLLRKII-PDLRFTAAPRNLAALASSEPTQQD-------
DING_SALCH      LIPGIAIAREEQLVVSTANVALQDQIFSKDLPLLRKII-PDLRFTAAPRNLAALASSEPTQQD-------
DING_ECO57      LIPGIAIAREEQLVVSTANVALQDQI--------------------------------------------
DPO3_THEMA      ----------------------------------------------------------------------
DPO3E_BUCBP     ----------------------------------------------------------------------
DING_SHIFL      LIPGIAIAREEQLVVSTANVALQDQI--------------------------------------------
DING_ECOLI      LIPGIAIAREEQLVVSTANVALQDQI--------------------------------------------
DING_ECOL6      LIPGIAIAREEQLVVSTANVALQDQI--------------------------------------------
DPO3_MYCPU      ----------------------------------------------------------------------
DPO3E_BUCAP     ----------------------------------------------------------------------
DPO3E_RICTY     ----------------------------------------------------------------------
DPO3E_RICPR     ----------------------------------------------------------------------
DPO3E_RICBR     ----------------------------------------------------------------------
REXO4_USTMA     ----------------------------------------------------------------------
DPO3E_RICCN     ----------------------------------------------------------------------
DPO3E_BUCAI     ----------------------------------------------------------------------
DPO3E_RICFE     ----------------------------------------------------------------------
Y942_METJA      LIPALYFAERRKRVLILTETIDQQVRIYEDLSSLRH--NLKVAFLMGKSNFI------------------
Y2191_MYCTU     ----------------------------------------------------------------------
XPD_THEAC       ----------------------------------------------------------------------
DBP6_CANGA      SIPIIQTLSSRRVLIILPTKLLINQVFQ------------------------------------------
DPO3_MYCPN      ----------------------------------------------------------------------
DPO3E_SALTY     ----------------------------------------------------------------------
DPO3E_SALTI     ----------------------------------------------------------------------
DPO3E_ECOLI     ----------------------------------------------------------------------
REXO4_SCHPO     ----------------------------------------------------------------------
REXO4_GIBZE     ----------------------------------------------------------------------
DPO3_MYCGE      ----------------------------------------------------------------------
ROK1_ASPFU      LIPVINQEKERGIVIVAPTKELASQIV-NEGRKL------------------------------------
ROK1_ASPCL      LIPVISQEQERGIIIVAPTKELASQIV-NEGRKL------------------------------------
REXO4_CANGA     ----------------------------------------------------------------------
ISG20_PIG       ----------------------------------------------------------------------
DBP6_KLULA      SVPLVQILRSRTVIILVPTKILIHQVYD------------------------------------------
CSHB_BACSU      LLPLLNKIDPAQVVITAPTRELANQIYQE-----------------------------------------
ROK1_ASPOR      LIPVINQQEERGIVVVAPTKELASQIV-NEGRKL------------------------------------
DDX31_DICDI     LIPVVQKLTEQRVVIITPTRELSSQIYEELQKLLKPFY--------------------------------
MS116_SCHPO     LLPRLNSSKIHSVILS-PTRELALQIFEEARK--------------------------------------
ISG20_MOUSE     ----------------------------------------------------------------------
DBP6_YEAST      SIPIVQTLFKRQIIIIVPTKLLINQV--------------------------------------------
DBP6_YEAS7      SIPIVQTLFKRQIIIIVPTKLLINQV--------------------------------------------
ROK1_NEOFI      LIPVINQEEERGIVVVAPTKELASQIV-NEGRKL------------------------------------
RNT_HAEIE       ----------------------------------------------------------------------
SRMB_ECOLI      LLPALKKSGPPRILILTPTRELAMQV-SDHARELAKHTHLDIATITGGVAYM------------------
ROK1_ASPNC      MIPVINEKPEERGILSVPTKELASQIV-NEGRKL------------------------------------
REXO4_CRYNE     ----------------------------------------------------------------------
Y443_MYCPN      LLPALNQLNKPQAVVFVPTKELKWQILSFTGLKVSENFNSNAH---------------------------
DBP7_ASPNC      LLPLV----QRIMTISL------NQKKREEGEQVQ-----------------------------------
DBP6_LODEL      SIPIIESLKDRVVIVLVPTKPLINQV--------------------------------------------
YO12_CAEEL      VLPVLAPSKILQAVILVPVQTLVAQIVDEFKRWNDESGVAKVVSLSGANDFEK-----------------
XPD_SULAC       ----------------------------------------------------------------------
ROK1_ASPTN      LIPVINQPDERGIVVVAPTKELASQIV-NEGRKL------------------------------------
RNT_BUCCC       ----------------------------------------------------------------------
DBP7_ASPTN      LLPLV----QRIMALSHPT---------------------------------------------------
AEN_HUMAN       ----------------------------------------------------------------------
RH26_ORYSJ      LLPALPRSPSINLLVICPTRELANQVAAEARKLLK-----------------------------------
DBP6_VANPO      SIPILQILSKRTVLVIVPTKLLINQVYE------------------------------------------
DBP6_PICGU      AIPIIESLRNRRAIVLVPTKPLISQV--------------------------------------------
AEN_RAT         ----------------------------------------------------------------------
AEN_PONAB       ----------------------------------------------------------------------
RH40_ORYSJ      LLPGFMHIKRLQVLVLAPTRELATQILEEAVKRSSRISSTCLYAPKGPQ---------------------
REXO4_HUMAN     ----------------------------------------------------------------------
DDX59_HUMAN     LLPALFESKTPSALILTPTRELAIQI-ERQAKEL------------------------------------
DBP7_ASPCL      LLPLV----QRIMTLSKPT---------------------------------------------------
Y022_SIFV       ILSALEILKNKKIVYAVNSTTLLKQ---------------------------------------------
ROK1_EMENI      MIPVINKPEERGIVVVAPTKELASQIV-NEGRKL------------------------------------
ROK1_ASHGO      LIPLLQQVISDKAVIISPTKELANQIFDECSKLAQRIF--------------------------------
RENT1_NEUCR     IIYHLAKMSNSQVLVCAPSNVAVDQLCERIHRTGLKVVRLTAKSREDVESSVSFLALHEQVRMNTTNK--


                         .         .         .         .         *         .         .:420
query           RRFKMQVLVWLTETETGDLDEIGQLYRYQHFLADLRHDGNLSSHSLFVTEDFWKRSQERAETCKLLVTNH
DING_BACSU      VLTKAQLLVWLTETNTGDVAELGKLLWDRLAYDDDSYKRSRSEHVI----GFYERAKQIAMRSDLVITNH
DING_STAES      SILKMQLLIWITETNTGDIQELNKMYVDQKIYVPVRHDIH-----------YYNYIKRNAQNIQIGITNH
DING_STAEQ      SILKMQLLIWITETNTGDIQELNKMYVDQKIYVPVRHDIH-----------YYNYIKRNAQNIQIGITNH
DING_STAS1      CILKMQLLIWITETDTGDIQELGQKMYFEQKLETYVPVRNDIHYFNFI--------KRNAQNIQIGITNH
DING_STAAW      NILKMQLLIWITETPSGDIQEL-NLKGGQKMYFDQKIETYVPARHDVHYYNFIKRN---AQNIQIGITNH
DING_STAAS      NILKMQLLIWITETPSGDIQEL-NLKGGQKMYFDQKIETYVPARHDVHYYNFIKRN---AQNIQIGITNH
DING_STAAN      NILKMQLLIWITETPSGDIQEL-NLKGGQKMYFDQKIETYVPARHDVHYYNFIKRN---AQNIQIGITNH
DING_STAAM      NILKMQLLIWITETPSGDIQEL-NLKGGQKMYFDQKIETYVPARHDVHYYNFIKRN---AQNIQIGITNH
DING_STAAC      NILKMQLLIWITETPSGDIQEL-NLKGGQKMYFDQKIETYVPARHDVHYYNFIKRN---AQNIQIGITNH
DING_STAA8      NILKMQLLIWITETPSGDIQEL-NLKGGQKMYFDQKIETYVPARHDVHYYNFIKRN---AQNIQIGITNH
DING_STAA3      NILKMQLLIWITETPSGDIQEL-NLKGGQKMYFDQKIETYVPARHDVHYYNFIKRN---AQNIQIGITNH
DING_STAAR      NILKMQLLIWITETPSGDIQEL-NLKGGQKMYFDQKIETYVPARHDVHYYNFIKRN---AQNIQIGITNH
DING_STAAB      NILKMQLLIWITETPSGDIQEL-NLKGGQKMYFDQKIETYVPARHDVHYYNFIKRN---AQNIQIGITNH
DING_STAHJ      NILKMQLLTWIIETETGDIQDLGQKMYFDQKIVPVRHDMH-----------YYNYIKRNAHHIQIGITNH
DPO3_CLOTE      ----------------------------------------------------------------------
YOAA_ECOLI      LSDVILLRSWSNQTVDGDISTCVSVAEDSQALVTSTNDNCLGSDCPMYKDCFVVKARKKAMDADVVVVNH
DPO3_CLOPE      ----------------------------------------------------------------------
DPO3_BACSU      ----------------------------------------------------------------------
DPO3_BACCR      ----------------------------------------------------------------------
Y387_HAEIN      ELSK--VRKWNNSTKTGDFTECIELAEDSPIIPQLTSESCLGTDCPNYSECYVASARKKALNADLVVVNH
DPO3_BACHD      ----------------------------------------------------------------------
DPO3_STRR6      ----------------------------------------------------------------------
DPO3_STRPN      ----------------------------------------------------------------------
DPO3_STRP2      ----------------------------------------------------------------------
DPO3_THETN      ----------------------------------------------------------------------
DPO3_STRPM      ----------------------------------------------------------------------
DPO3_OCEIH      ----------------------------------------------------------------------
DPO3_STRPG      ----------------------------------------------------------------------
DPO3_STRPC      ----------------------------------------------------------------------
DPO3_STRPB      ----------------------------------------------------------------------
DPO3_STRPD      ----------------------------------------------------------------------
DPO3_STRP8      ----------------------------------------------------------------------
DPO3_STRPY      ----------------------------------------------------------------------
DPO3_STRPF      ----------------------------------------------------------------------
DPO3_STRP6      ----------------------------------------------------------------------
DPO3_STRP3      ----------------------------------------------------------------------
DPO3_STRP1      ----------------------------------------------------------------------
DPO3_STRSV      ----------------------------------------------------------------------
DPO3_STRSY      ----------------------------------------------------------------------
DPO3_STRS2      ----------------------------------------------------------------------
DPO3_PEDPA      ----------------------------------------------------------------------
DPO3_STRMU      ----------------------------------------------------------------------
DPO3E_RHOCA     ----------------------------------------------------------------------
DPO3_LACLA      ----------------------------------------------------------------------
DPO3E_AQUAE     ----------------------------------------------------------------------
DPO3_STRTD      ----------------------------------------------------------------------
DPO3_STRT2      ----------------------------------------------------------------------
DPO3_STRT1      ----------------------------------------------------------------------
DPO3_STAES      ----------------------------------------------------------------------
DPO3_STAEQ      ----------------------------------------------------------------------
DPO3_STAAW      ----------------------------------------------------------------------
DPO3_STAAU      ----------------------------------------------------------------------
DPO3_STAAS      ----------------------------------------------------------------------
DPO3_STAAR      ----------------------------------------------------------------------
DPO3_STAAN      ----------------------------------------------------------------------
DPO3_STAAM      ----------------------------------------------------------------------
DPO3_STAAE      ----------------------------------------------------------------------
DPO3_STAAC      ----------------------------------------------------------------------
DPO3_STAAB      ----------------------------------------------------------------------
DPO3_STAA8      ----------------------------------------------------------------------
DPO3_STAA3      ----------------------------------------------------------------------
DPO3_STAA1      ----------------------------------------------------------------------
DPO3_STRA5      ----------------------------------------------------------------------
DPO3_STRA3      ----------------------------------------------------------------------
DPO3_STAHJ      ----------------------------------------------------------------------
DPO3_STAS1      ----------------------------------------------------------------------
DPO3_LACBA      ----------------------------------------------------------------------
DING_PHOPR      -----QVTLWEEKPKKSDLDLLRRMLKATR---DGKWDGDRDSWPTTIPDRVWAKAREHLDKADVIIANH
YPVA_BACSU      DLYE-SLPSFVHESQAGDRKQYANLSNYDSFTCDMRHRCGLTSHDFYM-EHVWTEESRKREGQLPLLPDH
DPO3_LACSS      ----------------------------------------------------------------------
DPO3_LACS1      ----------------------------------------------------------------------
DPO3_LISIN      ----------------------------------------------------------------------
DPO3_LISW6      ----------------------------------------------------------------------
DPO3_LISMO      ----------------------------------------------------------------------
DPO3_LISMF      ----------------------------------------------------------------------
DPO3_LACC3      ----------------------------------------------------------------------
DPO3_THEP1      ----------------------------------------------------------------------
DPO3_LACRD      ----------------------------------------------------------------------
DPO3_LACPL      ----------------------------------------------------------------------
DPO3E_PASMU     ----------------------------------------------------------------------
DPO3E_HAEIN     ----------------------------------------------------------------------
DING_MYCTU      GRDVQRLTAWASTTVSGDRDDLGVGDRSWSQVSVSARECLGVARCPFGSECFSERARGAAGLADVVVTNH
DING_MYCBO      GRDVQRLTAWASTTVSGDRDDLGVGDRSWSQVSVSARECLGVARCPFGSECFSERARGAAGLADVVVTNH
DPO3E_TREPA     ----------------------------------------------------------------------
DING_SALTY      ------LLAFLDDELTNNQEEQKRCARLKGDLDGYKWDGLRDHTDIAIDDDLWRRLSTDKASCEVVVANH
DING_SALPA      ------LLAFLDDELTNNQEEQKRCARLKGDLDGYKWDGLRDHTDIAIDDDLWRRLSTDKASCEVVVANH
DING_SALCH      ------LLAFLDDELTNNQEEQKRCARLKGDLDGYKWDGLRDHTDIAIDDDLWRRLSTDKASCEVVVANH
DING_ECO57      ----------------------------------------------------------------------
DPO3_THEMA      ----------------------------------------------------------------------
DPO3E_BUCBP     ----------------------------------------------------------------------
DING_SHIFL      ----------------------------------------------------------------------
DING_ECOLI      ----------------------------------------------------------------------
DING_ECOL6      ----------------------------------------------------------------------
DPO3_MYCPU      ----------------------------------------------------------------------
DPO3E_BUCAP     ----------------------------------------------------------------------
DPO3E_RICTY     ----------------------------------------------------------------------
DPO3E_RICPR     ----------------------------------------------------------------------
DPO3E_RICBR     ----------------------------------------------------------------------
REXO4_USTMA     ----------------------------------------------------------------------
DPO3E_RICCN     ----------------------------------------------------------------------
DPO3E_BUCAI     ----------------------------------------------------------------------
DPO3E_RICFE     ----------------------------------------------------------------------
Y942_METJA      ----------------------------------------------------------------------
Y2191_MYCTU     ----------------------------------------------------------------------
XPD_THEAC       ----------------------------------------------------------------------
DBP6_CANGA      ----------------------------------------------------------------------
DPO3_MYCPN      ----------------------------------------------------------------------
DPO3E_SALTY     ----------------------------------------------------------------------
DPO3E_SALTI     ----------------------------------------------------------------------
DPO3E_ECOLI     ----------------------------------------------------------------------
REXO4_SCHPO     ----------------------------------------------------------------------
REXO4_GIBZE     ----------------------------------------------------------------------
DPO3_MYCGE      ----------------------------------------------------------------------
ROK1_ASPFU      ----------------------------------------------------------------------
ROK1_ASPCL      ----------------------------------------------------------------------
REXO4_CANGA     ----------------------------------------------------------------------
ISG20_PIG       ----------------------------------------------------------------------
DBP6_KLULA      ----------------------------------------------------------------------
CSHB_BACSU      ----------------------------------------------------------------------
ROK1_ASPOR      ----------------------------------------------------------------------
DDX31_DICDI     ----------------------------------------------------------------------
MS116_SCHPO     ----------------------------------------------------------------------
ISG20_MOUSE     ----------------------------------------------------------------------
DBP6_YEAST      ----------------------------------------------------------------------
DBP6_YEAS7      ----------------------------------------------------------------------
ROK1_NEOFI      ----------------------------------------------------------------------
RNT_HAEIE       ----------------------------------------------------------------------
SRMB_ECOLI      ----------------------------------------------------------------------
ROK1_ASPNC      ----------------------------------------------------------------------
REXO4_CRYNE     ----------------------------------------------------------------------
Y443_MYCPN      ----------------------------------------------------------------------
DBP7_ASPNC      ----------------------------------------------------------------------
DBP6_LODEL      ----------------------------------------------------------------------
YO12_CAEEL      ----------------------------------------------------------------------
XPD_SULAC       ----------------------------------------------------------------------
ROK1_ASPTN      ----------------------------------------------------------------------
RNT_BUCCC       ----------------------------------------------------------------------
DBP7_ASPTN      ----------------------------------------------------------------------
AEN_HUMAN       ----------------------------------------------------------------------
RH26_ORYSJ      ----------------------------------------------------------------------
DBP6_VANPO      ----------------------------------------------------------------------
DBP6_PICGU      ----------------------------------------------------------------------
AEN_RAT         ----------------------------------------------------------------------
AEN_PONAB       ----------------------------------------------------------------------
RH40_ORYSJ      ----------------------------------------------------------------------
REXO4_HUMAN     ----------------------------------------------------------------------
DDX59_HUMAN     ----------------------------------------------------------------------
DBP7_ASPCL      ----------------------------------------------------------------------
Y022_SIFV       ----------------------------------------------------------------------
ROK1_EMENI      ----------------------------------------------------------------------
ROK1_ASHGO      ----------------------------------------------------------------------
RENT1_NEUCR     ---ELDGLVKL-KTETGEL---------------------------------------------------


                         .         .         +         .         .         .         .:490
query           AYLVTRLEDNPEFVSDRLLIIDEVQKILLALENLLQETYDIQSIIDLIDKALVGEENRVQQRILESIRFE
DING_BACSU      SLLLTRLPESGTFIID------------------------------------------------------
DING_STAES      AHLIHSDSENTIYQLFDDCIIDEAHRLPYALNQVTNDLSDVKYQLGLIEKLLKAVDKLEQQRILEKL---
DING_STAEQ      AHLIHSDSENTIYQLFDDCIIDEAHRLPYALNQVTNDLSDVKYQLGLIEKLLKAVDKLEQQRILEKL---
DING_STAS1      AHLIHAAHDNSIYQLFDDCIIDEAHRLPYALNQVTNELADIKYQLGLIEKLLKSIDLLEQQRILEKL---
DING_STAAW      AHLIHSDVENSIYQLFDDCIVDEAHRLPYALNQVTNELADIKYQLGLIEKLLKAIDQLEKQRILEKL---
DING_STAAS      AHLIHSDVENSIYQLFDDCIVDEAHRLPYALNQVTNELADIKYQLGLIEKLLKAIDQLEKQRILEKL---
DING_STAAN      AHLIHSDVENSIYQLFDDCIVDEAHRLPYALNQVTNELADIKYQLGLIEKLLKAIDQLEKQRILEKL---
DING_STAAM      AHLIHSDVENSIYQLFDDCIVDEAHRLPYALNQVTNELADIKYQLGLIEKLLKAIDQLEKQRILEKL---
DING_STAAC      AHLIHSDVENSIYQLFDDCIVDEAHRLPYALNQVTNELADIKYQLGLIEKLLKAIDQLEKQRILEKL---
DING_STAA8      AHLIHSDVENSIYQLFDDCIVDEAHRLPYALNQVTNELADIKYQLGLIEKLLKAIDQLEKQRILEKL---
DING_STAA3      AHLIHSDVENSIYQLFDDCIVDEAHRLPYALNQVTNELADIKYQLGLIEKLLKAIDQLEKQRILEKL---
DING_STAAR      AHLIHSDVENSIYQLFDDCIVDEAHRLPYALNQVTNELADIKYQLGLIEKLLKAIDQLEKQRILEKL---
DING_STAAB      AHLIHSDVENSIYQLFDDCIVDEAHRLPYALNQVTNELADIKYQLGLIEKLLKAIDQLEKQRILEKL---
DING_STAHJ      AHLIHSDQENSIYQLFDDCIIDEAHRLPYALNQVTNDLSDLKYQLGLIEKLLKAIDKLEQQRILERL---
DPO3_CLOTE      ----------------------------------------------------------------------
YOAA_ECOLI      ADMVVKESGFGELIPEAVMIFDEAHQLPDIASQYFGQSLSSRQLLDLAKDITIAYRTELKDRLAQSAQDF
DPO3_CLOPE      ----------------------------------------------------------------------
DPO3_BACSU      ----------------------------------------------------------------------
DPO3_BACCR      ----------------------------------------------------------------------
Y387_HAEIN      ----------------------------------------------------------------------
DPO3_BACHD      ----------------------------------------------------------------------
DPO3_STRR6      ----------------------------------------------------------------------
DPO3_STRPN      ----------------------------------------------------------------------
DPO3_STRP2      ----------------------------------------------------------------------
DPO3_THETN      ----------------------------------------------------------------------
DPO3_STRPM      ----------------------------------------------------------------------
DPO3_OCEIH      ----------------------------------------------------------------------
DPO3_STRPG      ----------------------------------------------------------------------
DPO3_STRPC      ----------------------------------------------------------------------
DPO3_STRPB      ----------------------------------------------------------------------
DPO3_STRPD      ----------------------------------------------------------------------
DPO3_STRP8      ----------------------------------------------------------------------
DPO3_STRPY      ----------------------------------------------------------------------
DPO3_STRPF      ----------------------------------------------------------------------
DPO3_STRP6      ----------------------------------------------------------------------
DPO3_STRP3      ----------------------------------------------------------------------
DPO3_STRP1      ----------------------------------------------------------------------
DPO3_STRSV      ----------------------------------------------------------------------
DPO3_STRSY      ----------------------------------------------------------------------
DPO3_STRS2      ----------------------------------------------------------------------
DPO3_PEDPA      ----------------------------------------------------------------------
DPO3_STRMU      ----------------------------------------------------------------------
DPO3E_RHOCA     ----------------------------------------------------------------------
DPO3_LACLA      ----------------------------------------------------------------------
DPO3E_AQUAE     ----------------------------------------------------------------------
DPO3_STRTD      ----------------------------------------------------------------------
DPO3_STRT2      ----------------------------------------------------------------------
DPO3_STRT1      ----------------------------------------------------------------------
DPO3_STAES      ----------------------------------------------------------------------
DPO3_STAEQ      ----------------------------------------------------------------------
DPO3_STAAW      ----------------------------------------------------------------------
DPO3_STAAU      ----------------------------------------------------------------------
DPO3_STAAS      ----------------------------------------------------------------------
DPO3_STAAR      ----------------------------------------------------------------------
DPO3_STAAN      ----------------------------------------------------------------------
DPO3_STAAM      ----------------------------------------------------------------------
DPO3_STAAE      ----------------------------------------------------------------------
DPO3_STAAC      ----------------------------------------------------------------------
DPO3_STAAB      ----------------------------------------------------------------------
DPO3_STAA8      ----------------------------------------------------------------------
DPO3_STAA3      ----------------------------------------------------------------------
DPO3_STAA1      ----------------------------------------------------------------------
DPO3_STRA5      ----------------------------------------------------------------------
DPO3_STRA3      ----------------------------------------------------------------------
DPO3_STAHJ      ----------------------------------------------------------------------
DPO3_STAS1      ----------------------------------------------------------------------
DPO3_LACBA      ----------------------------------------------------------------------
DING_PHOPR      ALLMADIE-----------------------------------IHDLISERL--KDNEIQQRLGEQALAE
YPVA_BACSU      SAVVFDEGHLLEFAAQKALTYRVKQSTLLFLERLLQN--DIEEFAELIEDALLANDEFFYVLSEESKEVA
DPO3_LACSS      ----------------------------------------------------------------------
DPO3_LACS1      ----------------------------------------------------------------------
DPO3_LISIN      ----------------------------------------------------------------------
DPO3_LISW6      ----------------------------------------------------------------------
DPO3_LISMO      ----------------------------------------------------------------------
DPO3_LISMF      ----------------------------------------------------------------------
DPO3_LACC3      ----------------------------------------------------------------------
DPO3_THEP1      ----------------------------------------------------------------------
DPO3_LACRD      ----------------------------------------------------------------------
DPO3_LACPL      ----------------------------------------------------------------------
DPO3E_PASMU     ----------------------------------------------------------------------
DPO3E_HAEIN     ----------------------------------------------------------------------
DING_MYCTU      ALLIDAVAESAVLPEHRLLVVDEAHEL-------------------------------------------
DING_MYCBO      ALLIDAVAESAVLPEHRLLVVDEAHEL-------------------------------------------
DPO3E_TREPA     ----------------------------------------------------------------------
DING_SALTY      ALVMAAMESEAVLPEPKLLVLDE-----------------------------------------------
DING_SALPA      ALVMAAMESEAVLPEPKLLVLDE-----------------------------------------------
DING_SALCH      ALVMAAMESEAVLPEPKLLVLDE-----------------------------------------------
DING_ECO57      ----------------------------------------------------------------------
DPO3_THEMA      ----------------------------------------------------------------------
DPO3E_BUCBP     ----------------------------------------------------------------------
DING_SHIFL      ----------------------------------------------------------------------
DING_ECOLI      ----------------------------------------------------------------------
DING_ECOL6      ----------------------------------------------------------------------
DPO3_MYCPU      ----------------------------------------------------------------------
DPO3E_BUCAP     ----------------------------------------------------------------------
DPO3E_RICTY     ----------------------------------------------------------------------
DPO3E_RICPR     ----------------------------------------------------------------------
DPO3E_RICBR     ----------------------------------------------------------------------
REXO4_USTMA     ----------------------------------------------------------------------
DPO3E_RICCN     ----------------------------------------------------------------------
DPO3E_BUCAI     ----------------------------------------------------------------------
DPO3E_RICFE     ----------------------------------------------------------------------
Y942_METJA      ----------------------------------------------------------------------
Y2191_MYCTU     ----------------------------------------------------------------------
XPD_THEAC       ----------------------------------------------------------------------
DBP6_CANGA      ----------------------------------------------------------------------
DPO3_MYCPN      ----------------------------------------------------------------------
DPO3E_SALTY     ----------------------------------------------------------------------
DPO3E_SALTI     ----------------------------------------------------------------------
DPO3E_ECOLI     ----------------------------------------------------------------------
REXO4_SCHPO     ----------------------------------------------------------------------
REXO4_GIBZE     ----------------------------------------------------------------------
DPO3_MYCGE      ----------------------------------------------------------------------
ROK1_ASPFU      ----------------------------------------------------------------------
ROK1_ASPCL      ----------------------------------------------------------------------
REXO4_CANGA     ----------------------------------------------------------------------
ISG20_PIG       ----------------------------------------------------------------------
DBP6_KLULA      ----------------------------------------------------------------------
CSHB_BACSU      ----------------------------------------------------------------------
ROK1_ASPOR      ----------------------------------------------------------------------
DDX31_DICDI     ----------------------------------------------------------------------
MS116_SCHPO     ----------------------------------------------------------------------
ISG20_MOUSE     ----------------------------------------------------------------------
DBP6_YEAST      ----------------------------------------------------------------------
DBP6_YEAS7      ----------------------------------------------------------------------
ROK1_NEOFI      ----------------------------------------------------------------------
RNT_HAEIE       ----------------------------------------------------------------------
SRMB_ECOLI      ----------------------------------------------------------------------
ROK1_ASPNC      ----------------------------------------------------------------------
REXO4_CRYNE     ----------------------------------------------------------------------
Y443_MYCPN      ----------------------------------------------------------------------
DBP7_ASPNC      ----------------------------------------------------------------------
DBP6_LODEL      ----------------------------------------------------------------------
YO12_CAEEL      ----------------------------------------------------------------------
XPD_SULAC       ----------------------------------------------------------------------
ROK1_ASPTN      ----------------------------------------------------------------------
RNT_BUCCC       ----------------------------------------------------------------------
DBP7_ASPTN      ----------------------------------------------------------------------
AEN_HUMAN       ----------------------------------------------------------------------
RH26_ORYSJ      ----------------------------------------------------------------------
DBP6_VANPO      ----------------------------------------------------------------------
DBP6_PICGU      ----------------------------------------------------------------------
AEN_RAT         ----------------------------------------------------------------------
AEN_PONAB       ----------------------------------------------------------------------
RH40_ORYSJ      ----------------------------------------------------------------------
REXO4_HUMAN     ----------------------------------------------------------------------
DDX59_HUMAN     ----------------------------------------------------------------------
DBP7_ASPCL      ----------------------------------------------------------------------
Y022_SIFV       ----------------------------------------------------------------------
ROK1_EMENI      ----------------------------------------------------------------------
ROK1_ASHGO      ----------------------------------------------------------------------
RENT1_NEUCR     ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           CLYLIEQFQSGKSRKNILDSLDNLHQYFSELEVEGFDELVRYFTAEGDYWLEVTEXXXXXXXXXXXXXGR
DING_BACSU      --------------------------------------------------------------------GE
DING_STAES      ----------------------------------------------------------------------
DING_STAEQ      ----------------------------------------------------------------------
DING_STAS1      ----------------------------------------------------------------------
DING_STAAW      ----------------------------------------------------------------------
DING_STAAS      ----------------------------------------------------------------------
DING_STAAN      ----------------------------------------------------------------------
DING_STAAM      ----------------------------------------------------------------------
DING_STAAC      ----------------------------------------------------------------------
DING_STAA8      ----------------------------------------------------------------------
DING_STAA3      ----------------------------------------------------------------------
DING_STAAR      ----------------------------------------------------------------------
DING_STAAB      ----------------------------------------------------------------------
DING_STAHJ      ----------------------------------------------------------------------
DPO3_CLOTE      ----------------------------------------------------------------------
YOAA_ECOLI      RLQLGEPGYRGNLRELLADTLELCYDVASALLDAAFERATLYRTRLKSYWYECTSRHFTLALTPLSVADK
DPO3_CLOPE      ----------------------------------------------------------------------
DPO3_BACSU      ----------------------------------------------------------------------
DPO3_BACCR      ----------------------------------------------------------------------
Y387_HAEIN      ----------------------------------------------------------------------
DPO3_BACHD      ----------------------------------------------------------------------
DPO3_STRR6      ----------------------------------------------------------------------
DPO3_STRPN      ----------------------------------------------------------------------
DPO3_STRP2      ----------------------------------------------------------------------
DPO3_THETN      ----------------------------------------------------------------------
DPO3_STRPM      ----------------------------------------------------------------------
DPO3_OCEIH      ----------------------------------------------------------------------
DPO3_STRPG      ----------------------------------------------------------------------
DPO3_STRPC      ----------------------------------------------------------------------
DPO3_STRPB      ----------------------------------------------------------------------
DPO3_STRPD      ----------------------------------------------------------------------
DPO3_STRP8      ----------------------------------------------------------------------
DPO3_STRPY      ----------------------------------------------------------------------
DPO3_STRPF      ----------------------------------------------------------------------
DPO3_STRP6      ----------------------------------------------------------------------
DPO3_STRP3      ----------------------------------------------------------------------
DPO3_STRP1      ----------------------------------------------------------------------
DPO3_STRSV      ----------------------------------------------------------------------
DPO3_STRSY      ----------------------------------------------------------------------
DPO3_STRS2      ----------------------------------------------------------------------
DPO3_PEDPA      ----------------------------------------------------------------------
DPO3_STRMU      ----------------------------------------------------------------------
DPO3E_RHOCA     ----------------------------------------------------------------------
DPO3_LACLA      ----------------------------------------------------------------------
DPO3E_AQUAE     ----------------------------------------------------------------------
DPO3_STRTD      ----------------------------------------------------------------------
DPO3_STRT2      ----------------------------------------------------------------------
DPO3_STRT1      ----------------------------------------------------------------------
DPO3_STAES      ----------------------------------------------------------------------
DPO3_STAEQ      ----------------------------------------------------------------------
DPO3_STAAW      ----------------------------------------------------------------------
DPO3_STAAU      ----------------------------------------------------------------------
DPO3_STAAS      ----------------------------------------------------------------------
DPO3_STAAR      ----------------------------------------------------------------------
DPO3_STAAN      ----------------------------------------------------------------------
DPO3_STAAM      ----------------------------------------------------------------------
DPO3_STAAE      ----------------------------------------------------------------------
DPO3_STAAC      ----------------------------------------------------------------------
DPO3_STAAB      ----------------------------------------------------------------------
DPO3_STAA8      ----------------------------------------------------------------------
DPO3_STAA3      ----------------------------------------------------------------------
DPO3_STAA1      ----------------------------------------------------------------------
DPO3_STRA5      ----------------------------------------------------------------------
DPO3_STRA3      ----------------------------------------------------------------------
DPO3_STAHJ      ----------------------------------------------------------------------
DPO3_STAS1      ----------------------------------------------------------------------
DPO3_LACBA      ----------------------------------------------------------------------
DING_PHOPR      SGVYLQR----------LENLEKVWALMAQPKKDKGAPLARWIEKEGDYIIQVSPLEV----------GY
YPVA_BACSU      GSHRLEIKNDHRVKKRLLDKIGEALVFESEMYVEEYVEQMAYYQKDAISWLEKKEAESTFVVMPRTVAGE
DPO3_LACSS      ----------------------------------------------------------------------
DPO3_LACS1      ----------------------------------------------------------------------
DPO3_LISIN      ----------------------------------------------------------------------
DPO3_LISW6      ----------------------------------------------------------------------
DPO3_LISMO      ----------------------------------------------------------------------
DPO3_LISMF      ----------------------------------------------------------------------
DPO3_LACC3      ----------------------------------------------------------------------
DPO3_THEP1      ----------------------------------------------------------------------
DPO3_LACRD      ----------------------------------------------------------------------
DPO3_LACPL      ----------------------------------------------------------------------
DPO3E_PASMU     ----------------------------------------------------------------------
DPO3E_HAEIN     ----------------------------------------------------------------------
DING_MYCTU      ----------------------------------------------------------------------
DING_MYCBO      ----------------------------------------------------------------------
DPO3E_TREPA     ----------------------------------------------------------------------
DING_SALTY      ----------------------------------------------------------------------
DING_SALPA      ----------------------------------------------------------------------
DING_SALCH      ----------------------------------------------------------------------
DING_ECO57      ----------------------------------------------------------------------
DPO3_THEMA      ----------------------------------------------------------------------
DPO3E_BUCBP     ----------------------------------------------------------------------
DING_SHIFL      ----------------------------------------------------------------------
DING_ECOLI      ----------------------------------------------------------------------
DING_ECOL6      ----------------------------------------------------------------------
DPO3_MYCPU      ----------------------------------------------------------------------
DPO3E_BUCAP     ----------------------------------------------------------------------
DPO3E_RICTY     ----------------------------------------------------------------------
DPO3E_RICPR     ----------------------------------------------------------------------
DPO3E_RICBR     ----------------------------------------------------------------------
REXO4_USTMA     ----------------------------------------------------------------------
DPO3E_RICCN     ----------------------------------------------------------------------
DPO3E_BUCAI     ----------------------------------------------------------------------
DPO3E_RICFE     ----------------------------------------------------------------------
Y942_METJA      ----------------------------------------------------------------------
Y2191_MYCTU     ----------------------------------------------------------------------
XPD_THEAC       ----------------------------------------------------------------------
DBP6_CANGA      ----------------------------------------------------------------------
DPO3_MYCPN      ----------------------------------------------------------------------
DPO3E_SALTY     ----------------------------------------------------------------------
DPO3E_SALTI     ----------------------------------------------------------------------
DPO3E_ECOLI     ----------------------------------------------------------------------
REXO4_SCHPO     ----------------------------------------------------------------------
REXO4_GIBZE     ----------------------------------------------------------------------
DPO3_MYCGE      ----------------------------------------------------------------------
ROK1_ASPFU      ----------------------------------------------------------------------
ROK1_ASPCL      ----------------------------------------------------------------------
REXO4_CANGA     ----------------------------------------------------------------------
ISG20_PIG       ----------------------------------------------------------------------
DBP6_KLULA      ----------------------------------------------------------------------
CSHB_BACSU      ----------------------------------------------------------------------
ROK1_ASPOR      ----------------------------------------------------------------------
DDX31_DICDI     ----------------------------------------------------------------------
MS116_SCHPO     ----------------------------------------------------------------------
ISG20_MOUSE     ----------------------------------------------------------------------
DBP6_YEAST      ----------------------------------------------------------------------
DBP6_YEAS7      ----------------------------------------------------------------------
ROK1_NEOFI      ----------------------------------------------------------------------
RNT_HAEIE       ----------------------------------------------------------------------
SRMB_ECOLI      ----------------------------------------------------------------------
ROK1_ASPNC      ----------------------------------------------------------------------
REXO4_CRYNE     ----------------------------------------------------------------------
Y443_MYCPN      ----------------------------------------------------------------------
DBP7_ASPNC      ----------------------------------------------------------------------
DBP6_LODEL      ----------------------------------------------------------------------
YO12_CAEEL      ----------------------------------------------------------------------
XPD_SULAC       ----------------------------------------------------------------------
ROK1_ASPTN      ----------------------------------------------------------------------
RNT_BUCCC       ----------------------------------------------------------------------
DBP7_ASPTN      ----------------------------------------------------------------------
AEN_HUMAN       ----------------------------------------------------------------------
RH26_ORYSJ      ----------------------------------------------------------------------
DBP6_VANPO      ----------------------------------------------------------------------
DBP6_PICGU      ----------------------------------------------------------------------
AEN_RAT         ----------------------------------------------------------------------
AEN_PONAB       ----------------------------------------------------------------------
RH40_ORYSJ      ----------------------------------------------------------------------
REXO4_HUMAN     ----------------------------------------------------------------------
DDX59_HUMAN     ----------------------------------------------------------------------
DBP7_ASPCL      ----------------------------------------------------------------------
Y022_SIFV       ----------------------------------------------------------------------
ROK1_EMENI      ----------------------------------------------------------------------
ROK1_ASHGO      ----------------------------------------------------------------------
RENT1_NEUCR     ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           TLLSSLLPESCQVLGVSATLEISQRVSLADLLGYPEAKFVKIESRGKQEQEVVMVKDFPLVTETSLEVYA
DING_BACSU      LLADQFFARKNSVVLTSATLTVEERLGLSDF--FPRTMRIESPFSYDERMQVMIPKEMKSIQDTGQPEFI
DING_STAES      ----------------------------------------------------------------------
DING_STAEQ      ----------------------------------------------------------------------
DING_STAS1      --------------------------------------------------------------------YV
DING_STAAW      ----------------------------------------------------------------------
DING_STAAS      ----------------------------------------------------------------------
DING_STAAN      ----------------------------------------------------------------------
DING_STAAM      ----------------------------------------------------------------------
DING_STAAC      ----------------------------------------------------------------------
DING_STAA8      ----------------------------------------------------------------------
DING_STAA3      ----------------------------------------------------------------------
DING_STAAR      ----------------------------------------------------------------------
DING_STAAB      ----------------------------------------------------------------------
DING_STAHJ      ----------------------------------------------------------------------
DPO3_CLOTE      ----------------------------------------------------------------------
YOAA_ECOLI      FKLMAQKPGSW--IFTSATLSVNDDLHFTSRLGIEQAESLLLPSPFDYSRQALLLRNLP---QTNQPGSA
DPO3_CLOPE      ----------------------------------------------------------------------
DPO3_BACSU      ----------------------------------------------------------------------
DPO3_BACCR      ----------------------------------------------------------------------
Y387_HAEIN      ----------------------------------------------------------------------
DPO3_BACHD      ----------------------------------------------------------------------
DPO3_STRR6      ----------------------------------------------------------------------
DPO3_STRPN      ----------------------------------------------------------------------
DPO3_STRP2      ----------------------------------------------------------------------
DPO3_THETN      ----------------------------------------------------------------------
DPO3_STRPM      ----------------------------------------------------------------------
DPO3_OCEIH      ----------------------------------------------------------------------
DPO3_STRPG      ----------------------------------------------------------------------
DPO3_STRPC      ----------------------------------------------------------------------
DPO3_STRPB      ----------------------------------------------------------------------
DPO3_STRPD      ----------------------------------------------------------------------
DPO3_STRP8      ----------------------------------------------------------------------
DPO3_STRPY      ----------------------------------------------------------------------
DPO3_STRPF      ----------------------------------------------------------------------
DPO3_STRP6      ----------------------------------------------------------------------
DPO3_STRP3      ----------------------------------------------------------------------
DPO3_STRP1      ----------------------------------------------------------------------
DPO3_STRSV      ----------------------------------------------------------------------
DPO3_STRSY      ----------------------------------------------------------------------
DPO3_STRS2      ----------------------------------------------------------------------
DPO3_PEDPA      ----------------------------------------------------------------------
DPO3_STRMU      ----------------------------------------------------------------------
DPO3E_RHOCA     ----------------------------------------------------------------------
DPO3_LACLA      ----------------------------------------------------------------------
DPO3E_AQUAE     ----------------------------------------------------------------------
DPO3_STRTD      ----------------------------------------------------------------------
DPO3_STRT2      ----------------------------------------------------------------------
DPO3_STRT1      ----------------------------------------------------------------------
DPO3_STAES      ----------------------------------------------------------------------
DPO3_STAEQ      ----------------------------------------------------------------------
DPO3_STAAW      ----------------------------------------------------------------------
DPO3_STAAU      ----------------------------------------------------------------------
DPO3_STAAS      ----------------------------------------------------------------------
DPO3_STAAR      ----------------------------------------------------------------------
DPO3_STAAN      ----------------------------------------------------------------------
DPO3_STAAM      ----------------------------------------------------------------------
DPO3_STAAE      ----------------------------------------------------------------------
DPO3_STAAC      ----------------------------------------------------------------------
DPO3_STAAB      ----------------------------------------------------------------------
DPO3_STAA8      ----------------------------------------------------------------------
DPO3_STAA3      ----------------------------------------------------------------------
DPO3_STAA1      ----------------------------------------------------------------------
DPO3_STRA5      ----------------------------------------------------------------------
DPO3_STRA3      ----------------------------------------------------------------------
DPO3_STAHJ      ----------------------------------------------------------------------
DPO3_STAS1      ----------------------------------------------------------------------
DPO3_LACBA      ----------------------------------------------------------------------
DING_PHOPR      RLDQLLWSRAAGAILVSATLRLNQFTYFCRQVGIYETRFLALASPFDYQNNARLV-----IPALSLEPQA
YPVA_BACSU      KVFSKKIP----YIFSSATLSEGGSFDIADSLGIHDYLSLTVDSPYDYDEQM----SINLYAKTDMDA-E
DPO3_LACSS      ----------------------------------------------------------------------
DPO3_LACS1      ----------------------------------------------------------------------
DPO3_LISIN      ----------------------------------------------------------------------
DPO3_LISW6      ----------------------------------------------------------------------
DPO3_LISMO      ----------------------------------------------------------------------
DPO3_LISMF      ----------------------------------------------------------------------
DPO3_LACC3      ----------------------------------------------------------------------
DPO3_THEP1      ----------------------------------------------------------------------
DPO3_LACRD      ----------------------------------------------------------------------
DPO3_LACPL      ----------------------------------------------------------------------
DPO3E_PASMU     ----------------------------------------------------------------------
DPO3E_HAEIN     ----------------------------------------------------------------------
DING_MYCTU      ----------------------------------------------------------------------
DING_MYCBO      ----------------------------------------------------------------------
DPO3E_TREPA     ----------------------------------------------------------------------
DING_SALTY      ----------------------------------------------------------------------
DING_SALPA      ----------------------------------------------------------------------
DING_SALCH      ----------------------------------------------------------------------
DING_ECO57      ----------------------------------------------------------------------
DPO3_THEMA      ----------------------------------------------------------------------
DPO3E_BUCBP     ----------------------------------------------------------------------
DING_SHIFL      ----------------------------------------------------------------------
DING_ECOLI      ----------------------------------------------------------------------
DING_ECOL6      ----------------------------------------------------------------------
DPO3_MYCPU      ----------------------------------------------------------------------
DPO3E_BUCAP     ----------------------------------------------------------------------
DPO3E_RICTY     ----------------------------------------------------------------------
DPO3E_RICPR     ----------------------------------------------------------------------
DPO3E_RICBR     ----------------------------------------------------------------------
REXO4_USTMA     ----------------------------------------------------------------------
DPO3E_RICCN     ----------------------------------------------------------------------
DPO3E_BUCAI     ----------------------------------------------------------------------
DPO3E_RICFE     ----------------------------------------------------------------------
Y942_METJA      --------------------------------GLDKAEFLILESPPKNRKKIIALKDG---VDMKYERKD
Y2191_MYCTU     ----------------------------------------------------------------------
XPD_THEAC       -----------EVLKESKTIHMSGTLDYSDITGF-EIPFKKIGEIFPPENRYIAYYDYDTLDEKELDRMA
DBP6_CANGA      ----------------------------------------------------------------------
DPO3_MYCPN      ----------------------------------------------------------------------
DPO3E_SALTY     ----------------------------------------------------------------------
DPO3E_SALTI     ----------------------------------------------------------------------
DPO3E_ECOLI     ----------------------------------------------------------------------
REXO4_SCHPO     ----------------------------------------------------------------------
REXO4_GIBZE     ----------------------------------------------------------------------
DPO3_MYCGE      ----------------------------------------------------------------------
ROK1_ASPFU      ----------------------------------------------------------------------
ROK1_ASPCL      ----------------------------------------------------------------------
REXO4_CANGA     ----------------------------------------------------------------------
ISG20_PIG       ----------------------------------------------------------------------
DBP6_KLULA      ----------------------------------------------------------------------
CSHB_BACSU      ----------------------------------------------------------------------
ROK1_ASPOR      ----------------------------------------------------------------------
DDX31_DICDI     ----------------------------------------------------------------------
MS116_SCHPO     ----------------------------------------------------------------------
ISG20_MOUSE     ----------------------------------------------------------------------
DBP6_YEAST      ----------------------------------------------------------------------
DBP6_YEAS7      ----------------------------------------------------------------------
ROK1_NEOFI      ----------------------------------------------------------------------
RNT_HAEIE       ----------------------------------------------------------------------
SRMB_ECOLI      ----------------------------------------------------------------------
ROK1_ASPNC      ----------------------------------------------------------------------
REXO4_CRYNE     ----------------------------------------------------------------------
Y443_MYCPN      ----------------------------------------------------------------------
DBP7_ASPNC      ----------------------------------------------------------------------
DBP6_LODEL      ----------------------------------------------------------------------
YO12_CAEEL      ----------------------------------------------------------------------
XPD_SULAC       ----------------------------------------------------------------------
ROK1_ASPTN      ----------------------------------------------------------------------
RNT_BUCCC       ----------------------------------------------------------------------
DBP7_ASPTN      ----------------------------------------------------------------------
AEN_HUMAN       ----------------------------------------------------------------------
RH26_ORYSJ      ----------------------------------------------------------------------
DBP6_VANPO      ----------------------------------------------------------------------
DBP6_PICGU      ----------------------------------------------------------------------
AEN_RAT         ----------------------------------------------------------------------
AEN_PONAB       ----------------------------------------------------------------------
RH40_ORYSJ      ----------------------------------------------------------------------
REXO4_HUMAN     ----------------------------------------------------------------------
DDX59_HUMAN     ----------------------------------------------------------------------
DBP7_ASPCL      ----------------------------------------------------------------------
Y022_SIFV       ----------------------------------------------------------------------
ROK1_EMENI      ----------------------------------------------------------------------
ROK1_ASHGO      ----------------------------------------------------------------------
RENT1_NEUCR     ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           REVAALLVEIQAFQQPILVLFTAKDMLLAVSDLLTVSHLAQYKNGDVHQLKKRFEKGEQQILLGAASFWE
DING_BACSU      QDTARYIELMAKEKQPILVLFTSHDMLKKVHQELKIQLLAQITGGSPGKLMKTFKTSNQAILLGTNHFWE
DING_STAES      ----------------------------------------------------------------------
DING_STAEQ      ----------------------------------------------------------------------
DING_STAS1      SSIVNYVIEVSVVESKCLILFTSYKMMHMVQEL--INELPEFEDYVVYKIVQQFNSFNKAILLGTGTFFE
DING_STAAW      ----------------------------------------------------------------------
DING_STAAS      ----------------------------------------------------------------------
DING_STAAN      ----------------------------------------------------------------------
DING_STAAM      ----------------------------------------------------------------------
DING_STAAC      ----------------------------------------------------------------------
DING_STAA8      ----------------------------------------------------------------------
DING_STAA3      ----------------------------------------------------------------------
DING_STAAR      ----------------------------------------------------------------------
DING_STAAB      ----------------------------------------------------------------------
DING_STAHJ      --VASIVDYIQEYDSKCLVLFTSYRMMHMVQELL--NELPTFEDYVVYKIVQQFNNFDKTILLGTSTFFE
DPO3_CLOTE      ----------------------------------------------------------------------
YOAA_ECOLI      RQLAAMLRPIEANNGRCFMLCTSHAMMRDLAETMTLPVLLQGETSK-GQLLQQFVSAGNALLVATSSFWE
DPO3_CLOPE      ----------------------------------------------------------------------
DPO3_BACSU      ----------------------------------------------------------------------
DPO3_BACCR      ----------------------------------------------------------------------
Y387_HAEIN      -----LLPVIEANKGRCFVLCTSYSMMRGLAEYFRESHLSILLQGETSKLLEQFIKETHSVLVATSSFWE
DPO3_BACHD      ----------------------------------------------------------------------
DPO3_STRR6      ----------------------------------------------------------------------
DPO3_STRPN      ----------------------------------------------------------------------
DPO3_STRP2      ----------------------------------------------------------------------
DPO3_THETN      ----------------------------------------------------------------------
DPO3_STRPM      ----------------------------------------------------------------------
DPO3_OCEIH      ----------------------------------------------------------------------
DPO3_STRPG      ----------------------------------------------------------------------
DPO3_STRPC      ----------------------------------------------------------------------
DPO3_STRPB      ----------------------------------------------------------------------
DPO3_STRPD      ----------------------------------------------------------------------
DPO3_STRP8      ----------------------------------------------------------------------
DPO3_STRPY      ----------------------------------------------------------------------
DPO3_STRPF      ----------------------------------------------------------------------
DPO3_STRP6      ----------------------------------------------------------------------
DPO3_STRP3      ----------------------------------------------------------------------
DPO3_STRP1      ----------------------------------------------------------------------
DPO3_STRSV      ----------------------------------------------------------------------
DPO3_STRSY      ----------------------------------------------------------------------
DPO3_STRS2      ----------------------------------------------------------------------
DPO3_PEDPA      ----------------------------------------------------------------------
DPO3_STRMU      ----------------------------------------------------------------------
DPO3E_RHOCA     ----------------------------------------------------------------------
DPO3_LACLA      ----------------------------------------------------------------------
DPO3E_AQUAE     ----------------------------------------------------------------------
DPO3_STRTD      ----------------------------------------------------------------------
DPO3_STRT2      ----------------------------------------------------------------------
DPO3_STRT1      ----------------------------------------------------------------------
DPO3_STAES      ----------------------------------------------------------------------
DPO3_STAEQ      ----------------------------------------------------------------------
DPO3_STAAW      ----------------------------------------------------------------------
DPO3_STAAU      ----------------------------------------------------------------------
DPO3_STAAS      ----------------------------------------------------------------------
DPO3_STAAR      ----------------------------------------------------------------------
DPO3_STAAN      ----------------------------------------------------------------------
DPO3_STAAM      ----------------------------------------------------------------------
DPO3_STAAE      ----------------------------------------------------------------------
DPO3_STAAC      ----------------------------------------------------------------------
DPO3_STAAB      ----------------------------------------------------------------------
DPO3_STAA8      ----------------------------------------------------------------------
DPO3_STAA3      ----------------------------------------------------------------------
DPO3_STAA1      ----------------------------------------------------------------------
DPO3_STRA5      ----------------------------------------------------------------------
DPO3_STRA3      ----------------------------------------------------------------------
DPO3_STAHJ      ----------------------------------------------------------------------
DPO3_STAS1      ----------------------------------------------------------------------
DPO3_LACBA      ----------------------------------------------------------------------
DING_PHOPR      DKFTDLLIEYLEGETASLVLFSSYWQMNKVADELRPELLVQGEESRHITLKKHKDNGKPSILFGTGSFSE
YPVA_BACSU      QKTAETIETIKRYKGRTLVLFPSFEELNEFKELSAAWELPYFFEGDISSLVEKFQEEEETVLC-SVHLWE
DPO3_LACSS      ----------------------------------------------------------------------
DPO3_LACS1      ----------------------------------------------------------------------
DPO3_LISIN      ----------------------------------------------------------------------
DPO3_LISW6      ----------------------------------------------------------------------
DPO3_LISMO      ----------------------------------------------------------------------
DPO3_LISMF      ----------------------------------------------------------------------
DPO3_LACC3      ----------------------------------------------------------------------
DPO3_THEP1      ----------------------------------------------------------------------
DPO3_LACRD      ----------------------------------------------------------------------
DPO3_LACPL      ----------------------------------------------------------------------
DPO3E_PASMU     ----------------------------------------------------------------------
DPO3E_HAEIN     ----------------------------------------------------------------------
DING_MYCTU      -------------------------------------------------LVEKFTADAATSLFGTLSLWQ
DING_MYCBO      -------------------------------------------------LVEKFTADAATSLFGTLSLWQ
DPO3E_TREPA     ----------------------------------------------------------------------
DING_SALTY      --------------------------------LLVQGDQPRYRLVELH--RKRVESGERSVLVGLQSFAE
DING_SALPA      --------------------------------LLVQGDQPRYRLVELH--RKRVESGERSVLVGLQSFAE
DING_SALCH      --------------------------------LLVQGDQPRYRLVELH--RKRVESGERSVLVGLQSFAE
DING_ECO57      ----------------MLVLFASGRAMQRFLDYVTDLRLMLLVQGDVELHRKRVANGERSVLVGLQSFAE
DPO3_THEMA      ----------------------------------------------------------------------
DPO3E_BUCBP     ----------------------------------------------------------------------
DING_SHIFL      ----------------MLVLFASGRAMQRFLDYVTDLRLMLLVQGDVELHRKRVANGERSVLVGLQSFAE
DING_ECOLI      ----------------MLVLFASGRAMQRFLDYVTDLRLMLLVQGDVELHRKRVANGERSVLVGLQSFAE
DING_ECOL6      ----------------MLVLFASGRAMQRFLDYVTDLRLMLLVQGDVELHRKRVANGERSVLVGLQSFAE
DPO3_MYCPU      ----------------------------------------------------------------------
DPO3E_BUCAP     ----------------------------------------------------------------------
DPO3E_RICTY     ----------------------------------------------------------------------
DPO3E_RICPR     ----------------------------------------------------------------------
DPO3E_RICBR     ----------------------------------------------------------------------
REXO4_USTMA     ----------------------------------------------------------------------
DPO3E_RICCN     ----------------------------------------------------------------------
DPO3E_BUCAI     ----------------------------------------------------------------------
DPO3E_RICFE     ----------------------------------------------------------------------
Y942_METJA      REKANLLKILEAINGNSLVLFKSEDLDSFYKYLKREITKTNIKNKNIHELKERFEK-IGGILLATGRFAE
Y2191_MYCTU     ----------------------------------------------------------------------
XPD_THEAC       TVIEDIILKVK---KNTIVYFPSYSLMDRVENRVSFEHMKEYRGIDLYSMLKKFRRDHGTIFVSGGRLSE
DBP6_CANGA      ----------------------------------------------------------------------
DPO3_MYCPN      ----------------------------------------------------------------------
DPO3E_SALTY     ----------------------------------------------------------------------
DPO3E_SALTI     ----------------------------------------------------------------------
DPO3E_ECOLI     ----------------------------------------------------------------------
REXO4_SCHPO     ----------------------------------------------------------------------
REXO4_GIBZE     ----------------------------------------------------------------------
DPO3_MYCGE      ----------------------------------------------------------------------
ROK1_ASPFU      ----------------------------------------------------------------------
ROK1_ASPCL      ----------------------------------------------------------------------
REXO4_CANGA     ----------------------------------------------------------------------
ISG20_PIG       ----------------------------------------------------------------------
DBP6_KLULA      ----------------------------------------------------------------------
CSHB_BACSU      ----------------------------------------------------------------------
ROK1_ASPOR      ----------------------------------------------------------------------
DDX31_DICDI     ----------------------------------------------------------------------
MS116_SCHPO     ----------------------------------------------------------------------
ISG20_MOUSE     ----------------------------------------------------------------------
DBP6_YEAST      ----------------------------------------------------------------------
DBP6_YEAS7      ----------------------------------------------------------------------
ROK1_NEOFI      ----------------------------------------------------------------------
RNT_HAEIE       ----------------------------------------------------------------------
SRMB_ECOLI      ----------------------------------------------------------------------
ROK1_ASPNC      ----------------------------------------------------------------------
REXO4_CRYNE     ----------------------------------------------------------------------
Y443_MYCPN      ----------------------------------------------------------------------
DBP7_ASPNC      ----------------------------------------------------------------------
DBP6_LODEL      ----------------------------------------------------------------------
YO12_CAEEL      ----------------------------------------------------------------------
XPD_SULAC       ----------------VLVVFPSYEIMDRVMSRISLPKYVESEDSSVEDLYSAISANNKVLIVGKGKLAE
ROK1_ASPTN      ----------------------------------------------------------------------
RNT_BUCCC       ----------------------------------------------------------------------
DBP7_ASPTN      ----------------------------------------------------------------------
AEN_HUMAN       ----------------------------------------------------------------------
RH26_ORYSJ      ----------------------------------------------------------------------
DBP6_VANPO      ----------------------------------------------------------------------
DBP6_PICGU      ----------------------------------------------------------------------
AEN_RAT         ----------------------------------------------------------------------
AEN_PONAB       ----------------------------------------------------------------------
RH40_ORYSJ      ----------------------------------------------------------------------
REXO4_HUMAN     ----------------------------------------------------------------------
DDX59_HUMAN     ----------------------------------------------------------------------
DBP7_ASPCL      ----------------------------------------------------------------------
Y022_SIFV       ----------------------------------------------------------------------
ROK1_EMENI      ----------------------------------------------------------------------
ROK1_ASHGO      ----------------------------------------------------------------------
RENT1_NEUCR     ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           GVDFSSHPFVIQVVPRLPFQNPQEPLTKKINQELNQEGKNAFYDYQLPMAIIRLKQALGRSMRREYQRSL
DING_BACSU      GVDFPGDELTTVMIVRLPFRSPDHPLHAAKCELARKKGKNPFQTVSLPEAVLTFRQGIGRLLRSAGDKGT
DING_STAES      ----------------------------------------------------------------------
DING_STAEQ      ----------------------------------------------------------------------
DING_STAS1      GFDFQSNGIKCVMIAKLPFMNQNN--TKYWLME--SEFTSTFKEYVLPDAVTRFRQGLGRLIRSENDKGI
DING_STAAW      ----------------------------------------------------------------------
DING_STAAS      ----------------------------------------------------------------------
DING_STAAN      ----------------------------------------------------------------------
DING_STAAM      ----------------------------------------------------------------------
DING_STAAC      ----------------------------------------------------------------------
DING_STAA8      ----------------------------------------------------------------------
DING_STAA3      ----------------------------------------------------------------------
DING_STAAR      ----------------------------------------------------------------------
DING_STAAB      ----------------------------------------------------------------------
DING_STAHJ      GFDYQAKGIKCVMIAKLPFMNKYN--TK--HWLMDSEFDSTFKDYVLPDAVTRFRQGLGRLIRNEDDQGL
DPO3_CLOTE      ----------------------------------------------------------------------
YOAA_ECOLI      GVDVRGDTLSLVIIDKLPFTSPDDPLLKARMEDCRLRGGDPFDEVQLPDAVITLKQGVGRLIRDADDRGV
DPO3_CLOPE      ----------------------------------------------------------------------
DPO3_BACSU      ----------------------------------------------------------------------
DPO3_BACCR      ----------------------------------------------------------------------
Y387_HAEIN      GVDVRGDALSLVIIDKLPFTAPDEPLLKARIEDCRLQGGDPFNDIQIPEAVITLKQGVGRLIRDVTDRGV
DPO3_BACHD      ----------------------------------------------------------------------
DPO3_STRR6      ----------------------------------------------------------------------
DPO3_STRPN      ----------------------------------------------------------------------
DPO3_STRP2      ----------------------------------------------------------------------
DPO3_THETN      ----------------------------------------------------------------------
DPO3_STRPM      ----------------------------------------------------------------------
DPO3_OCEIH      ----------------------------------------------------------------------
DPO3_STRPG      ----------------------------------------------------------------------
DPO3_STRPC      ----------------------------------------------------------------------
DPO3_STRPB      ----------------------------------------------------------------------
DPO3_STRPD      ----------------------------------------------------------------------
DPO3_STRP8      ----------------------------------------------------------------------
DPO3_STRPY      ----------------------------------------------------------------------
DPO3_STRPF      ----------------------------------------------------------------------
DPO3_STRP6      ----------------------------------------------------------------------
DPO3_STRP3      ----------------------------------------------------------------------
DPO3_STRP1      ----------------------------------------------------------------------
DPO3_STRSV      ----------------------------------------------------------------------
DPO3_STRSY      ----------------------------------------------------------------------
DPO3_STRS2      ----------------------------------------------------------------------
DPO3_PEDPA      ----------------------------------------------------------------------
DPO3_STRMU      ----------------------------------------------------------------------
DPO3E_RHOCA     ----------------------------------------------------------------------
DPO3_LACLA      ----------------------------------------------------------------------
DPO3E_AQUAE     ----------------------------------------------------------------------
DPO3_STRTD      ----------------------------------------------------------------------
DPO3_STRT2      ----------------------------------------------------------------------
DPO3_STRT1      ----------------------------------------------------------------------
DPO3_STAES      ----------------------------------------------------------------------
DPO3_STAEQ      ----------------------------------------------------------------------
DPO3_STAAW      ----------------------------------------------------------------------
DPO3_STAAU      ----------------------------------------------------------------------
DPO3_STAAS      ----------------------------------------------------------------------
DPO3_STAAR      ----------------------------------------------------------------------
DPO3_STAAN      ----------------------------------------------------------------------
DPO3_STAAM      ----------------------------------------------------------------------
DPO3_STAAE      ----------------------------------------------------------------------
DPO3_STAAC      ----------------------------------------------------------------------
DPO3_STAAB      ----------------------------------------------------------------------
DPO3_STAA8      ----------------------------------------------------------------------
DPO3_STAA3      ----------------------------------------------------------------------
DPO3_STAA1      ----------------------------------------------------------------------
DPO3_STRA5      ----------------------------------------------------------------------
DPO3_STRA3      ----------------------------------------------------------------------
DPO3_STAHJ      ----------------------------------------------------------------------
DPO3_STAS1      ----------------------------------------------------------------------
DPO3_LACBA      ----------------------------------------------------------------------
DING_PHOPR      GLDLPGDLLKNLIITKIPFGVPTSPVEEAHAEYIESCGGNPFMQISVPEASKKLIQSVGRLIRKEDDMGR
YPVA_BACSU      GLDIPGDALKNVTIWSLPFP-PHDPV---FTAKRNGAKKDPFEEVDLPYMLLRVRQGIGRLIR-------
DPO3_LACSS      ----------------------------------------------------------------------
DPO3_LACS1      ----------------------------------------------------------------------
DPO3_LISIN      ----------------------------------------------------------------------
DPO3_LISW6      ----------------------------------------------------------------------
DPO3_LISMO      ----------------------------------------------------------------------
DPO3_LISMF      ----------------------------------------------------------------------
DPO3_LACC3      ----------------------------------------------------------------------
DPO3_THEP1      ----------------------------------------------------------------------
DPO3_LACRD      ----------------------------------------------------------------------
DPO3_LACPL      ----------------------------------------------------------------------
DPO3E_PASMU     ----------------------------------------------------------------------
DPO3E_HAEIN     ----------------------------------------------------------------------
DING_MYCTU      GVDVPGPSLSLVXXXXXXXXXXXXXXXSARQRAVAARGGNGFMTVAASHAALLLAQGSGRLLRRVTDRGV
DING_MYCBO      GVDVPGPSLSLVXXXXXXXXXXXXXXXSARQRAVAARGGNGFMTVAASHAALLLAQGSGRLLRRVTDRGV
DPO3E_TREPA     ----------------------------------------------------------------------
DING_SALTY      GLDLKGELLTQVHIHKIAFPPIDSPVVITEGEWLKSLNRYPFEVQSLPSASFNLIQQVGRLIRSHACRGE
DING_SALPA      GLDLKGELLTQVHIHKIAFPPIDSPVVITEGEWLKSLNRYPFEVQSLPSASFNLIQQVGRLIRSHACRGE
DING_SALCH      GLDLKGELLTQVHIHKIAFPPIDSPVVITEGEWLKSLNRYPFEVQSLPSASFNLIQQVGRLIRSHACRGE
DING_ECO57      GLDLKGDMLSQVHIHKIAFPPIDSPVVITEGEWLKSLNRYPFEVQSLPSASFNLIQQVGRLIRSHGCWGE
DPO3_THEMA      ----------------------------------------------------------------------
DPO3E_BUCBP     ----------------------------------------------------------------------
DING_SHIFL      GLDLKGDLLSQVHIHKIAFPPIDSPVVITEGEWLKSLNRYPFEVQSLPSASFNLIQQVGRLIRSHGCWGE
DING_ECOLI      GLDLKGDLLSQVHIHKIAFPPIDSPVVITEGEWLKSLNRYPFEVQSLPSASFNLIQQVGRLIRSHGCWGE
DING_ECOL6      GLDLKGDLLSQVHIHKIAFPPIDSPVVITEGEWLKSLNRYPFEVQSLPSASFNLIQQVGRLIRSHGCWGE
DPO3_MYCPU      ----------------------------------------------------------------------
DPO3E_BUCAP     ----------------------------------------------------------------------
DPO3E_RICTY     ----------------------------------------------------------------------
DPO3E_RICPR     ----------------------------------------------------------------------
DPO3E_RICBR     ----------------------------------------------------------------------
REXO4_USTMA     ----------------------------------------------------------------------
DPO3E_RICCN     ----------------------------------------------------------------------
DPO3E_BUCAI     ----------------------------------------------------------------------
DPO3E_RICFE     ----------------------------------------------------------------------
Y942_METJA      GVDIPGEALVGVVIDSLPFPVP-TPLILREQKILEERFKRAFLMTSFDRMARTLVQMIGRLIRTENDYGV
Y2191_MYCTU     ----------------------------------------------------------------------
XPD_THEAC       GINFPGNELEMIILAGLPFPRPDAINRSLFDYYERKYGKGWEYSVVYPTAI-KIRQEIGRLIRSAEDTGA
DBP6_CANGA      ----------------------------------------------------------------------
DPO3_MYCPN      ----------------------------------------------------------------------
DPO3E_SALTY     ----------------------------------------------------------------------
DPO3E_SALTI     ----------------------------------------------------------------------
DPO3E_ECOLI     ----------------------------------------------------------------------
REXO4_SCHPO     ----------------------------------------------------------------------
REXO4_GIBZE     ----------------------------------------------------------------------
DPO3_MYCGE      ----------------------------------------------------------------------
ROK1_ASPFU      ----------------------------------------------------------------------
ROK1_ASPCL      ----------------------------------------------------------------------
REXO4_CANGA     ----------------------------------------------------------------------
ISG20_PIG       ----------------------------------------------------------------------
DBP6_KLULA      ----------------------------------------------------------------------
CSHB_BACSU      ----------------------------------------------------------------------
ROK1_ASPOR      ----------------------------------------------------------------------
DDX31_DICDI     ----------------------------------------------------------------------
MS116_SCHPO     ----------------------------------------------------------------------
ISG20_MOUSE     ----------------------------------------------------------------------
DBP6_YEAST      ----------------------------------------------------------------------
DBP6_YEAS7      ----------------------------------------------------------------------
ROK1_NEOFI      ----------------------------------------------------------------------
RNT_HAEIE       ----------------------------------------------------------------------
SRMB_ECOLI      ----------------------------------------------------------------------
ROK1_ASPNC      ----------------------------------------------------------------------
REXO4_CRYNE     ----------------------------------------------------------------------
Y443_MYCPN      ----------------------------------------------------------------------
DBP7_ASPNC      ----------------------------------------------------------------------
DBP6_LODEL      ----------------------------------------------------------------------
YO12_CAEEL      ----------------------------------------------------------------------
XPD_SULAC       GIELRNNDVVIVGIPYPPPDDYLKILAQRVSLKMNRE--NEEFLFKIP-ALVTIKQAIGRAIRDVNDKCN
ROK1_ASPTN      ----------------------------------------------------------------------
RNT_BUCCC       ----------------------------------------------------------------------
DBP7_ASPTN      ----------------------------------------------------------------------
AEN_HUMAN       ----------------------------------------------------------------------
RH26_ORYSJ      ----------------------------------------------------------------------
DBP6_VANPO      ----------------------------------------------------------------------
DBP6_PICGU      ----------------------------------------------------------------------
AEN_RAT         ----------------------------------------------------------------------
AEN_PONAB       ----------------------------------------------------------------------
RH40_ORYSJ      ----------------------------------------------------------------------
REXO4_HUMAN     ----------------------------------------------------------------------
DDX59_HUMAN     ----------------------------------------------------------------------
DBP7_ASPCL      ----------------------------------------------------------------------
Y022_SIFV       ----------------------------------------------------------------------
ROK1_EMENI      ----------------------------------------------------------------------
ROK1_ASHGO      ----------------------------------------------------------------------
RENT1_NEUCR     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           TLILDRRIVGKRYGKQIVASLAEEATVKTISRSEVDEAIxxxxxxx
DING_BACSU      IIILDRRIKTAGYGRLFLDAL-PTTSVSEMTDSELE----------
DING_STAES      ----------------------------------------------
DING_STAEQ      ----------------------------------------------
DING_STAS1      IVSFDDRLIRSNYKQFFEQSL-------------------------
DING_STAAW      ----------------------------------------------
DING_STAAS      ----------------------------------------------
DING_STAAN      ----------------------------------------------
DING_STAAM      ----------------------------------------------
DING_STAAC      ----------------------------------------------
DING_STAA8      ----------------------------------------------
DING_STAA3      ----------------------------------------------
DING_STAAR      ----------------------------------------------
DING_STAAB      ----------------------------------------------
DING_STAHJ      IVSFDDRLVSSNY---------------------------------
DPO3_CLOTE      ----------------------------------------------
YOAA_ECOLI      LVICDNRLVMRPYGATFLASLPPAPRTRDIARA-------------
DPO3_CLOPE      ----------------------------------------------
DPO3_BACSU      ----------------------------------------------
DPO3_BACCR      ----------------------------------------------
Y387_HAEIN      VIICDNRLVMRNYGETFLKSLPNSSRTRDLNK--------------
DPO3_BACHD      ----------------------------------------------
DPO3_STRR6      ----------------------------------------------
DPO3_STRPN      ----------------------------------------------
DPO3_STRP2      ----------------------------------------------
DPO3_THETN      ----------------------------------------------
DPO3_STRPM      ----------------------------------------------
DPO3_OCEIH      ----------------------------------------------
DPO3_STRPG      ----------------------------------------------
DPO3_STRPC      ----------------------------------------------
DPO3_STRPB      ----------------------------------------------
DPO3_STRPD      ----------------------------------------------
DPO3_STRP8      ----------------------------------------------
DPO3_STRPY      ----------------------------------------------
DPO3_STRPF      ----------------------------------------------
DPO3_STRP6      ----------------------------------------------
DPO3_STRP3      ----------------------------------------------
DPO3_STRP1      ----------------------------------------------
DPO3_STRSV      ----------------------------------------------
DPO3_STRSY      ----------------------------------------------
DPO3_STRS2      ----------------------------------------------
DPO3_PEDPA      ----------------------------------------------
DPO3_STRMU      ----------------------------------------------
DPO3E_RHOCA     ----------------------------------------------
DPO3_LACLA      ----------------------------------------------
DPO3E_AQUAE     ----------------------------------------------
DPO3_STRTD      ----------------------------------------------
DPO3_STRT2      ----------------------------------------------
DPO3_STRT1      ----------------------------------------------
DPO3_STAES      ----------------------------------------------
DPO3_STAEQ      ----------------------------------------------
DPO3_STAAW      ----------------------------------------------
DPO3_STAAU      ----------------------------------------------
DPO3_STAAS      ----------------------------------------------
DPO3_STAAR      ----------------------------------------------
DPO3_STAAN      ----------------------------------------------
DPO3_STAAM      ----------------------------------------------
DPO3_STAAE      ----------------------------------------------
DPO3_STAAC      ----------------------------------------------
DPO3_STAAB      ----------------------------------------------
DPO3_STAA8      ----------------------------------------------
DPO3_STAA3      ----------------------------------------------
DPO3_STAA1      ----------------------------------------------
DPO3_STRA5      ----------------------------------------------
DPO3_STRA3      ----------------------------------------------
DPO3_STAHJ      ----------------------------------------------
DPO3_STAS1      ----------------------------------------------
DPO3_LACBA      ----------------------------------------------
DING_PHOPR      VVLLDRRIINRRYGKALLDSL-------------------------
YPVA_BACSU      ----------------------------------------------
DPO3_LACSS      ----------------------------------------------
DPO3_LACS1      ----------------------------------------------
DPO3_LISIN      ----------------------------------------------
DPO3_LISW6      ----------------------------------------------
DPO3_LISMO      ----------------------------------------------
DPO3_LISMF      ----------------------------------------------
DPO3_LACC3      ----------------------------------------------
DPO3_THEP1      ----------------------------------------------
DPO3_LACRD      ----------------------------------------------
DPO3_LACPL      ----------------------------------------------
DPO3E_PASMU     ----------------------------------------------
DPO3E_HAEIN     ----------------------------------------------
DING_MYCTU      VAVLDSRMATARYGEFLRASL-------------------------
DING_MYCBO      VAVLDSRMATARYGEFLRASL-------------------------
DPO3E_TREPA     ----------------------------------------------
DING_SALTY      VVIYDKRLLTKNYGQRLLNAL-------------------------
DING_SALPA      VVIYDKRLLTKNYGQRLLNAL-------------------------
DING_SALCH      VVIYDKRLLTKNYGQRLLNAL-------------------------
DING_ECO57      VVIYDKRLLTKNYGKRLLDAL----PVFPIEQPEVPEGI-------
DPO3_THEMA      ----------------------------------------------
DPO3E_BUCBP     ----------------------------------------------
DING_SHIFL      VVIYDKRLLTKNYGKRLLDAL----PVFPIEQPEVPEGI-------
DING_ECOLI      VVIYDKRLLTKNYGKRLLDAL----PVFPIEQPEVPEGI-------
DING_ECOL6      VVIYDKRLLTKNYGKRLLDAL----PVFPIEQPEVPEGI-------
DPO3_MYCPU      ----------------------------------------------
DPO3E_BUCAP     ----------------------------------------------
DPO3E_RICTY     ----------------------------------------------
DPO3E_RICPR     ----------------------------------------------
DPO3E_RICBR     ----------------------------------------------
REXO4_USTMA     ----------------------------------------------
DPO3E_RICCN     ----------------------------------------------
DPO3E_BUCAI     ----------------------------------------------
DPO3E_RICFE     ----------------------------------------------
Y942_METJA      VVIQDKR---------------------------------------
Y2191_MYCTU     ----------------------------------------------
XPD_THEAC       CVILDKR---------------------------------------
DBP6_CANGA      ----------------------------------------------
DPO3_MYCPN      ----------------------------------------------
DPO3E_SALTY     ----------------------------------------------
DPO3E_SALTI     ----------------------------------------------
DPO3E_ECOLI     ----------------------------------------------
REXO4_SCHPO     ----------------------------------------------
REXO4_GIBZE     ----------------------------------------------
DPO3_MYCGE      ----------------------------------------------
ROK1_ASPFU      ----------------------------------------------
ROK1_ASPCL      ----------------------------------------------
REXO4_CANGA     ----------------------------------------------
ISG20_PIG       ----------------------------------------------
DBP6_KLULA      ----------------------------------------------
CSHB_BACSU      ----------------------------------------------
ROK1_ASPOR      ----------------------------------------------
DDX31_DICDI     ----------------------------------------------
MS116_SCHPO     ----------------------------------------------
ISG20_MOUSE     ----------------------------------------------
DBP6_YEAST      ----------------------------------------------
DBP6_YEAS7      ----------------------------------------------
ROK1_NEOFI      ----------------------------------------------
RNT_HAEIE       ----------------------------------------------
SRMB_ECOLI      ----------------------------------------------
ROK1_ASPNC      ----------------------------------------------
REXO4_CRYNE     ----------------------------------------------
Y443_MYCPN      ----------------------------------------------
DBP7_ASPNC      ----------------------------------------------
DBP6_LODEL      ----------------------------------------------
YO12_CAEEL      ----------------------------------------------
XPD_SULAC       VWLLDKRFESLYWKKNL-----------------------------
ROK1_ASPTN      ----------------------------------------------
RNT_BUCCC       ----------------------------------------------
DBP7_ASPTN      ----------------------------------------------
AEN_HUMAN       ----------------------------------------------
RH26_ORYSJ      ----------------------------------------------
DBP6_VANPO      ----------------------------------------------
DBP6_PICGU      ----------------------------------------------
AEN_RAT         ----------------------------------------------
AEN_PONAB       ----------------------------------------------
RH40_ORYSJ      ----------------------------------------------
REXO4_HUMAN     ----------------------------------------------
DDX59_HUMAN     ----------------------------------------------
DBP7_ASPCL      ----------------------------------------------
Y022_SIFV       ----------------------------------------------
ROK1_EMENI      ----------------------------------------------
ROK1_ASHGO      ----------------------------------------------
RENT1_NEUCR     ----------------------------------------------