[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for spne4:ACF55344.1

[Show Plain Result]


## Summary of Sequence Search
    1::238
    1::238     e-136 100%  238 aa  ATP6_STRP4 RecName: Full=ATP synthase subunit a;AltName:
    1::238     e-136 100%  238 aa  ATP6_STRZT RecName: Full=ATP synthase subunit a;AltName:
    1::238     e-136 100%  238 aa  ATP6_STRZP RecName: Full=ATP synthase subunit a;AltName:
    1::238     e-136 100%  238 aa  ATP6_STRZJ RecName: Full=ATP synthase subunit a;AltName:
    1::238     e-136 100%  238 aa  ATP6_STRR6 RecName: Full=ATP synthase subunit a;AltName:
    1::238     e-136 100%  238 aa  ATP6_STRPS RecName: Full=ATP synthase subunit a;AltName:
    1::238     e-136 100%  238 aa  ATP6_STRPN RecName: Full=ATP synthase subunit a;AltName:
    1::238     e-136 100%  238 aa  ATP6_STRPJ RecName: Full=ATP synthase subunit a;AltName:
    1::238     e-136 100%  238 aa  ATP6_STRPI RecName: Full=ATP synthase subunit a;AltName:
    1::238     e-136 100%  238 aa  ATP6_STRP2 RecName: Full=ATP synthase subunit a;AltName:
    1::238     e-135  99%  238 aa  ATP6_STRP7 RecName: Full=ATP synthase subunit a;AltName:
    1::238     2e-86  63%  238 aa  ATP6_STRSV RecName: Full=ATP synthase subunit a;AltName:
    1::237     1e-85  62%  237 aa  ATP6_STRGC RecName: Full=ATP synthase subunit a;AltName:
    1::238     1e-81  58%  238 aa  ATP6_STRS7 RecName: Full=ATP synthase subunit a;AltName:
    1::238     1e-81  58%  238 aa  ATP6_STREM RecName: Full=ATP synthase subunit a;AltName:
    1::238     1e-81  58%  238 aa  ATP6_STRE4 RecName: Full=ATP synthase subunit a;AltName:
    1::238     3e-80  56%  238 aa  ATP6_STRPZ RecName: Full=ATP synthase subunit a;AltName:
    1::238     3e-80  56%  238 aa  ATP6_STRPM RecName: Full=ATP synthase subunit a;AltName:
    1::238     3e-80  56%  238 aa  ATP6_STRPG RecName: Full=ATP synthase subunit a;AltName:
    1::238     3e-80  56%  238 aa  ATP6_STRPF RecName: Full=ATP synthase subunit a;AltName:
    1::238     3e-80  56%  238 aa  ATP6_STRPD RecName: Full=ATP synthase subunit a;AltName:
    1::238     3e-80  56%  238 aa  ATP6_STRPC RecName: Full=ATP synthase subunit a;AltName:
    1::238     3e-80  56%  238 aa  ATP6_STRPB RecName: Full=ATP synthase subunit a;AltName:
    1::238     3e-80  56%  238 aa  ATP6_STRP8 RecName: Full=ATP synthase subunit a;AltName:
    1::238     3e-80  56%  238 aa  ATP6_STRP6 RecName: Full=ATP synthase subunit a;AltName:
    1::238     3e-80  56%  238 aa  ATP6_STRP3 RecName: Full=ATP synthase subunit a;AltName:
    1::238     6e-80  55%  238 aa  ATP6_STRP1 RecName: Full=ATP synthase subunit a;AltName:
    1::237     7e-65  52%  238 aa  ATP6_STRA5 RecName: Full=ATP synthase subunit a;AltName:
    1::237     7e-65  52%  238 aa  ATP6_STRA1 RecName: Full=ATP synthase subunit a;AltName:
    1::237     9e-65  52%  238 aa  ATP6_STRA3 RecName: Full=ATP synthase subunit a;AltName:
    1::235     4e-58  45%  239 aa  ATP6_STRMU RecName: Full=ATP synthase subunit a;AltName:
    7::239     4e-52  41%  239 aa  ATP6_ENTFA RecName: Full=ATP synthase subunit a;AltName:
   10::239     2e-45  41%  239 aa  ATP6_ENTHR RecName: Full=ATP synthase subunit a;AltName:
    8::237     1e-43  39%  240 aa  ATP6_OCEIH RecName: Full=ATP synthase subunit a;AltName:
    1::237     2e-42  39%  238 aa  ATP6_LISMF RecName: Full=ATP synthase subunit a;AltName:
    1::237     2e-42  39%  238 aa  ATP6_LISMC RecName: Full=ATP synthase subunit a;AltName:
    1::237     2e-42  39%  238 aa  ATP6_LISIN RecName: Full=ATP synthase subunit a;AltName:
    1::237     4e-42  38%  238 aa  ATP6_LISMO RecName: Full=ATP synthase subunit a;AltName:
    6::237     6e-42  38%  238 aa  ATP6_LISW6 RecName: Full=ATP synthase subunit a;AltName:
   17::238     6e-40  35%  242 aa  ATP6_STAAW RecName: Full=ATP synthase subunit a;AltName:
   17::238     6e-40  35%  242 aa  ATP6_STAAT RecName: Full=ATP synthase subunit a;AltName:
   17::238     6e-40  35%  242 aa  ATP6_STAAS RecName: Full=ATP synthase subunit a;AltName:
   17::238     6e-40  35%  242 aa  ATP6_STAAR RecName: Full=ATP synthase subunit a;AltName:
   17::238     6e-40  35%  242 aa  ATP6_STAAN RecName: Full=ATP synthase subunit a;AltName:
   17::238     6e-40  35%  242 aa  ATP6_STAAM RecName: Full=ATP synthase subunit a;AltName:
   17::238     6e-40  35%  242 aa  ATP6_STAAE RecName: Full=ATP synthase subunit a;AltName:
   17::238     6e-40  35%  242 aa  ATP6_STAAC RecName: Full=ATP synthase subunit a;AltName:
   17::238     6e-40  35%  242 aa  ATP6_STAAB RecName: Full=ATP synthase subunit a;AltName:
   17::238     6e-40  35%  242 aa  ATP6_STAA9 RecName: Full=ATP synthase subunit a;AltName:
   17::238     6e-40  35%  242 aa  ATP6_STAA8 RecName: Full=ATP synthase subunit a;AltName:
   17::238     6e-40  35%  242 aa  ATP6_STAA3 RecName: Full=ATP synthase subunit a;AltName:
   17::238     6e-40  35%  242 aa  ATP6_STAA2 RecName: Full=ATP synthase subunit a;AltName:
   17::238     6e-40  35%  242 aa  ATP6_STAA1 RecName: Full=ATP synthase subunit a;AltName:
    6::233     8e-40  35%  236 aa  ATP6_GEOSW RecName: Full=ATP synthase subunit a;AltName:
    4::238     2e-39  39%  238 aa  ATP6_PEDPA RecName: Full=ATP synthase subunit a;AltName:
    1::235     1e-38  33%  238 aa  ATP6_BACPF RecName: Full=ATP synthase subunit a;AltName:
    8::241     6e-37  38%  244 aa  ATP6_BACA2 RecName: Full=ATP synthase subunit a;AltName:
   15::241     2e-36  39%  244 aa  ATP6_BACSU RecName: Full=ATP synthase subunit a;AltName:
    5::233     3e-35  32%  236 aa  ATP6_BACME RecName: Full=ATP synthase subunit a;AltName:
   17::237     6e-35  34%  240 aa  ATP6_MACCJ RecName: Full=ATP synthase subunit a;AltName:
   40::235     2e-34  36%  238 aa  ATP6_BACSK RecName: Full=ATP synthase subunit a;AltName:
   17::238     3e-34  32%  242 aa  ATP6_STAES RecName: Full=ATP synthase subunit a;AltName:
   17::238     3e-34  32%  242 aa  ATP6_STAEQ RecName: Full=ATP synthase subunit a;AltName:
    6::233     4e-34  31%  236 aa  ATP6_LYSSC RecName: Full=ATP synthase subunit a;AltName:
    6::234     5e-34  32%  237 aa  ATP6_GEOKA RecName: Full=ATP synthase subunit a;AltName:
    6::233     5e-34  31%  236 aa  ATP6_BACST RecName: Full=ATP synthase subunit a;AltName:
    6::235     6e-34  33%  238 aa  ATP6_BACP3 RecName: Full=ATP synthase subunit a;AltName:
    6::233     8e-34  32%  236 aa  ATP6_ANOFW RecName: Full=ATP synthase subunit a;AltName:
   19::237     2e-33  35%  241 aa  ATP6_STACT RecName: Full=ATP synthase subunit a;AltName:
   15::236     2e-33  37%  236 aa  ATP6_LACF3 RecName: Full=ATP synthase subunit a;AltName:
   17::238     1e-32  35%  242 aa  ATP6_STAS1 RecName: Full=ATP synthase subunit a;AltName:
   15::234     8e-31  35%  235 aa  ATP6_LACRJ RecName: Full=ATP synthase subunit a;AltName:
   15::234     8e-31  35%  235 aa  ATP6_LACRD RecName: Full=ATP synthase subunit a;AltName:
    5::237     1e-30  30%  241 aa  ATP6_STAHJ RecName: Full=ATP synthase subunit a;AltName:
    6::234     7e-30  33%  237 aa  ATP6_BACCA RecName: Full=ATP synthase subunit a;AltName:
   15::243     1e-29  31%  244 aa  ATP6_BACP2 RecName: Full=ATP synthase subunit a;AltName:
   51::251     3e-25  33%  262 aa  ATP6_DESRM RecName: Full=ATP synthase subunit a;AltName:
    9::223     1e-23  31%  224 aa  ATP6_SULDN RecName: Full=ATP synthase subunit a;AltName:
   53::248     4e-22  34%  251 aa  ATP6_MYCLE RecName: Full=ATP synthase subunit a;AltName:
   50::233     4e-22  32%  271 aa  ATP6_ACIC1 RecName: Full=ATP synthase subunit a;AltName:
    9::216     7e-22  31%  218 aa  ATP6_MOOTA RecName: Full=ATP synthase subunit a;AltName:
   25::224     1e-21  33%  226 aa  ATP6_HELPY RecName: Full=ATP synthase subunit a;AltName:
   25::224     1e-21  33%  226 aa  ATP6_HELPS RecName: Full=ATP synthase subunit a;AltName:
   25::224     1e-21  33%  226 aa  ATP6_HELPH RecName: Full=ATP synthase subunit a;AltName:
   25::224     1e-21  33%  226 aa  ATP6_HELPG RecName: Full=ATP synthase subunit a;AltName:
   37::225     1e-21  31%  226 aa  ATP6_HELHP RecName: Full=ATP synthase subunit a;AltName:
   11::214     1e-21  31%  223 aa  ATP62_BRASB RecName: Full=ATP synthase subunit a 2;AltName:
   24::224     2e-21  34%  226 aa  ATP6_HELPJ RecName: Full=ATP synthase subunit a;AltName:
   24::224     2e-21  34%  226 aa  ATP6_HELP2 RecName: Full=ATP synthase subunit a;AltName:
   25::224     2e-21  33%  226 aa  ATP6_HELAH RecName: Full=ATP synthase subunit a;AltName:
   34::248     3e-21  28%  252 aa  ATPI_OEDCA RecName: Full=ATP synthase subunit a,
   23::238     3e-21  28%  241 aa  ATP6_SYNS9 RecName: Full=ATP synthase subunit a;AltName:
   38::240     4e-21  30%  242 aa  ATPI_PAUCH RecName: Full=ATP synthase subunit a, organellar
   38::238     4e-21  28%  241 aa  ATP6_SYNS3 RecName: Full=ATP synthase subunit a;AltName:
   23::237     4e-21  29%  241 aa  ATP6_PROMS RecName: Full=ATP synthase subunit a;AltName:
   23::237     5e-21  29%  241 aa  ATP6_PROMP RecName: Full=ATP synthase subunit a;AltName:
   54::248     5e-21  33%  250 aa  ATP6_MYCUA RecName: Full=ATP synthase subunit a;AltName:
   27::248     5e-21  33%  250 aa  ATP6_MYCTU RecName: Full=ATP synthase subunit a;AltName:
   27::248     5e-21  33%  250 aa  ATP6_MYCBO RecName: Full=ATP synthase subunit a;AltName:
   23::237     8e-21  29%  241 aa  ATP6_PROM9 RecName: Full=ATP synthase subunit a;AltName:
   23::237     8e-21  29%  241 aa  ATP6_PROM5 RecName: Full=ATP synthase subunit a;AltName:
   23::237     8e-21  29%  241 aa  ATP6_PROM2 RecName: Full=ATP synthase subunit a;AltName:
   23::237     8e-21  29%  241 aa  ATP6_PROM0 RecName: Full=ATP synthase subunit a;AltName:
   54::248     8e-21  33%  250 aa  ATP6_MYCMM RecName: Full=ATP synthase subunit a;AltName:
   28::242     1e-20  28%  246 aa  ATPI_CHAVU RecName: Full=ATP synthase subunit a,
   17::247     2e-20  33%  250 aa  ATP6_XANP2 RecName: Full=ATP synthase subunit a;AltName:
   21::226     3e-20  30%  228 aa  ATP6_ARCB4 RecName: Full=ATP synthase subunit a;AltName:
   40::245     7e-20  29%  249 aa  ATPI_CHLAT RecName: Full=ATP synthase subunit a,
   51::238     1e-19  32%  241 aa  ATP6_SYNPX RecName: Full=ATP synthase subunit a;AltName:
   43::242     3e-19  26%  246 aa  ATPI_RHDSA RecName: Full=ATP synthase subunit a,
   29::240     3e-19  29%  241 aa  ATP6_WOLPP RecName: Full=ATP synthase subunit a;AltName:
   44::243     6e-19  26%  248 aa  ATPI_GUITH RecName: Full=ATP synthase subunit a,
   34::240     6e-19  29%  241 aa  ATP6_WOLPM RecName: Full=ATP synthase subunit a;AltName:
   32::236     7e-19  28%  239 aa  ATPI_NEPOL RecName: Full=ATP synthase subunit a,
   53::232     1e-18  31%  233 aa  ATPI_OCHNE RecName: Full=ATP synthase subunit a,
   28::244     1e-18  26%  248 aa  ATPI_ANGEV RecName: Full=ATP synthase subunit a,
   51::240     1e-18  30%  242 aa  ATP6_SYNPW RecName: Full=ATP synthase subunit a;AltName:
   39::236     1e-18  29%  252 aa  ATP6_SYNP1 RecName: Full=ATP synthase subunit a;AltName:
   34::239     2e-18  27%  243 aa  ATPI_SCEOB RecName: Full=ATP synthase subunit a,
   86::321     2e-18  29%  333 aa  ATP6_CHLT3 RecName: Full=ATP synthase subunit a;AltName:
   37::242     2e-18  28%  246 aa  ATPI_OLTVI RecName: Full=ATP synthase subunit a,
   60::240     3e-18  31%  241 aa  ATP6_WOLWR RecName: Full=ATP synthase subunit a;AltName:
   51::238     3e-18  30%  241 aa  ATP6_SYNSC RecName: Full=ATP synthase subunit a;AltName:
    9::224     3e-18  29%  226 aa  ATP6_NITSB RecName: Full=ATP synthase subunit a;AltName:
   38::224     3e-18  30%  226 aa  ATP6_CAMJD RecName: Full=ATP synthase subunit a;AltName:
   51::190     4e-18  33%  239 aa  ATPI_CYACA RecName: Full=ATP synthase subunit a,
   69::285     4e-18  30%  289 aa  ATP6_PROMO RecName: Full=ATP synthase subunit a, sodium ion
   32::263     4e-18  31%  295 aa  ATP6_FRASN RecName: Full=ATP synthase subunit a;AltName:
   30::244     5e-18  27%  248 aa  ATPI_STAPU RecName: Full=ATP synthase subunit a,
   36::274     6e-18  32%  275 aa  ATP6_RHOE4 RecName: Full=ATP synthase subunit a;AltName:
   25::223     6e-18  33%  233 aa  ATP62_SYNP2 RecName: Full=ATP synthase subunit a 2;AltName:
   23::192     1e-17  28%  241 aa  ATP6_PROMA RecName: Full=ATP synthase subunit a;AltName:
   41::244     1e-17  28%  248 aa  ATPI_PSINU RecName: Full=ATP synthase subunit a,
   30::243     1e-17  27%  247 aa  ATPI_PHAVU RecName: Full=ATP synthase subunit a,
   58::244     1e-17  28%  248 aa  ATPI_MARPO RecName: Full=ATP synthase subunit a,
   38::243     2e-17  27%  247 aa  ATPI_MESVI RecName: Full=ATP synthase subunit a,
   44::230     2e-17  30%  233 aa  ATPI_GALSU RecName: Full=ATP synthase subunit a,
   38::192     2e-17  30%  241 aa  ATP6_PROM4 RecName: Full=ATP synthase subunit a;AltName:
   10::246     2e-17  30%  247 aa  ATP6_MAGSA RecName: Full=ATP synthase subunit a;AltName:
   25::238     2e-17  30%  241 aa  ATP6_ANAMM RecName: Full=ATP synthase subunit a;AltName:
   13::223     2e-17  30%  223 aa  ATP61_PROA2 RecName: Full=ATP synthase subunit a 1;AltName:
   39::226     2e-17  29%  241 aa  ATP6_SULNB RecName: Full=ATP synthase subunit a;AltName:
   20::249     2e-17  31%  252 aa  ATP6_BARQU RecName: Full=ATP synthase subunit a;AltName:
   37::242     4e-17  25%  246 aa  ATPI_STIHE RecName: Full=ATP synthase subunit a,
   48::237     4e-17  29%  239 aa  ATP6_SYNR3 RecName: Full=ATP synthase subunit a;AltName:
   34::241     4e-17  36%  242 aa  ATP6_RICTY RecName: Full=ATP synthase subunit a;AltName:
   26::227     4e-17  28%  228 aa  ATP6_CAMHC RecName: Full=ATP synthase subunit a;AltName:
   53::239     9e-17  28%  243 aa  ATPI_CHAGL RecName: Full=ATP synthase subunit a,
   53::240     9e-17  28%  249 aa  ATP6_TRIEI RecName: Full=ATP synthase subunit a;AltName:
   35::237     9e-17  31%  252 aa  ATP6_THEEB RecName: Full=ATP synthase subunit a;AltName:
   54::235     9e-17  31%  239 aa  ATP6_SYNFM RecName: Full=ATP synthase subunit a;AltName:
   35::258     9e-17  29%  262 aa  ATP6_HAEIN RecName: Full=ATP synthase subunit a;AltName:
   35::258     9e-17  29%  262 aa  ATP6_HAEIG RecName: Full=ATP synthase subunit a;AltName:
   35::258     9e-17  29%  262 aa  ATP6_HAEIE RecName: Full=ATP synthase subunit a;AltName:
   35::258     9e-17  29%  262 aa  ATP6_HAEI8 RecName: Full=ATP synthase subunit a;AltName:
  142::326     9e-17  30%  352 aa  ATP62_CHLTE RecName: Full=ATP synthase subunit a 2;AltName:
   30::243     1e-16  27%  247 aa  ATPI_CITSI RecName: Full=ATP synthase subunit a,
   34::258     1e-16  33%  262 aa  ATP6_HAEDU RecName: Full=ATP synthase subunit a;AltName:
   43::235     1e-16  37%  238 aa  ATP6_DESMR RecName: Full=ATP synthase subunit a;AltName:
   34::258     1e-16  33%  262 aa  ATP6_ACTPJ RecName: Full=ATP synthase subunit a;AltName:
   34::258     1e-16  33%  262 aa  ATP6_ACTP7 RecName: Full=ATP synthase subunit a;AltName:
   34::258     1e-16  33%  262 aa  ATP6_ACTP2 RecName: Full=ATP synthase subunit a;AltName:
   53::281     2e-16  32%  289 aa  ATP6_PSEE4 RecName: Full=ATP synthase subunit a;AltName:
   31::241     2e-16  30%  243 aa  ATP6_EHRCR RecName: Full=ATP synthase subunit a;AltName:
   37::231     2e-16  30%  240 aa  ATP6_DESPS RecName: Full=ATP synthase subunit a;AltName:
   59::245     2e-16  27%  249 aa  ATPI_PHYPA RecName: Full=ATP synthase subunit a,
   30::244     2e-16  28%  248 aa  ATPI_CRYJA RecName: Full=ATP synthase subunit a,
   35::241     2e-16  25%  245 aa  ATPI_BIGNA RecName: Full=ATP synthase subunit a,
   95::324     2e-16  28%  338 aa  ATP6_CHLPB RecName: Full=ATP synthase subunit a;AltName:
   32::245     3e-16  27%  249 aa  ATPI_MANES RecName: Full=ATP synthase subunit a,
   39::243     3e-16  27%  247 aa  ATPI_JASNU RecName: Full=ATP synthase subunit a,
   30::243     3e-16  26%  247 aa  ATPI_DIOEL RecName: Full=ATP synthase subunit a,
   30::244     3e-16  27%  248 aa  ATPI_CYCTA RecName: Full=ATP synthase subunit a,
   49::256     3e-16  30%  258 aa  ATP6_RUBXD RecName: Full=ATP synthase subunit a;AltName:
   47::214     3e-16  34%  231 aa  ATP6_RHOFD RecName: Full=ATP synthase subunit a;AltName:
   41::236     3e-16  28%  251 aa  ATP6_ANAVT RecName: Full=ATP synthase subunit a;AltName:
   41::236     3e-16  28%  251 aa  ATP6_ANASP RecName: Full=ATP synthase subunit a;AltName:
   30::243     3e-16  28%  247 aa  ATPI_CHLVU RecName: Full=ATP synthase subunit a,
   30::244     3e-16  26%  248 aa  ATPI_ADICA RecName: Full=ATP synthase subunit a,
   30::243     5e-16  26%  247 aa  ATPI_PEA RecName: Full=ATP synthase subunit a,
   19::233     5e-16  25%  236 aa  ATPI_OSTTA RecName: Full=ATP synthase subunit a,
   30::243     5e-16  26%  247 aa  ATPI_CICAR RecName: Full=ATP synthase subunit a,
   50::259     5e-16  31%  266 aa  ATP6_HALHL RecName: Full=ATP synthase subunit a;AltName:
   38::244     5e-16  28%  246 aa  ATP6_GLOVI RecName: Full=ATP synthase subunit a;AltName:
   38::224     5e-16  30%  226 aa  ATP6_CAMJR RecName: Full=ATP synthase subunit a;AltName:
   38::224     5e-16  30%  226 aa  ATP6_CAMJJ RecName: Full=ATP synthase subunit a;AltName:
   34::260     5e-16  30%  261 aa  ATP6_ACTSZ RecName: Full=ATP synthase subunit a;AltName:
   48::244     6e-16  28%  251 aa  ATPI_EUGGR RecName: Full=ATP synthase subunit a,
   37::214     6e-16  29%  227 aa  ATP6_WOLSU RecName: Full=ATP synthase subunit a;AltName:
   25::241     6e-16  29%  242 aa  ATP6_RICCN RecName: Full=ATP synthase subunit a;AltName:
   52::264     6e-16  34%  272 aa  ATP6_PSEMY RecName: Full=ATP synthase subunit a;AltName:
   51::192     6e-16  33%  241 aa  ATP6_PROMM RecName: Full=ATP synthase subunit a;AltName:
   51::192     6e-16  33%  241 aa  ATP6_PROM3 RecName: Full=ATP synthase subunit a;AltName:
   30::243     8e-16  26%  247 aa  ATPI_PHAAO RecName: Full=ATP synthase subunit a,
   39::243     8e-16  27%  247 aa  ATPI_HELAN RecName: Full=ATP synthase subunit a,
   29::234     8e-16  25%  238 aa  ATPI_CHLRE RecName: Full=ATP synthase subunit a,
   25::241     8e-16  29%  242 aa  ATP6_RICPU RecName: Full=ATP synthase subunit a;AltName:
  101::214     8e-16  33%  251 aa  ATP6_NITMU RecName: Full=ATP synthase subunit a;AltName:
   38::225     8e-16  29%  226 aa  ATP6_CAMFF RecName: Full=ATP synthase subunit a;AltName:
   30::243     1e-15  26%  247 aa  ATPI_LEMMI RecName: Full=ATP synthase subunit a,
   36::240     1e-15  27%  244 aa  ATPI_GOSBA RecName: Full=ATP synthase subunit a,
   39::243     1e-15  26%  247 aa  ATPI_EUCGG RecName: Full=ATP synthase subunit a,
   58::244     1e-15  26%  248 aa  ATPI_ANTFO RecName: Full=ATP synthase subunit a,
   25::241     1e-15  29%  242 aa  ATP6_RICM5 RecName: Full=ATP synthase subunit a;AltName:
   25::241     1e-15  32%  242 aa  ATP6_RICFE RecName: Full=ATP synthase subunit a;AltName:
   38::257     1e-15  30%  264 aa  ATP6_COXBU RecName: Full=ATP synthase subunit a;AltName:
   38::257     1e-15  30%  264 aa  ATP6_COXBR RecName: Full=ATP synthase subunit a;AltName:
   38::257     1e-15  30%  264 aa  ATP6_COXB1 RecName: Full=ATP synthase subunit a;AltName:
   38::224     1e-15  30%  226 aa  ATP6_CAMJE RecName: Full=ATP synthase subunit a;AltName:
   38::224     1e-15  30%  226 aa  ATP6_CAMJ8 RecName: Full=ATP synthase subunit a;AltName:
   41::265     1e-15  34%  272 aa  ATP6_BUCAP RecName: Full=ATP synthase subunit a;AltName:
  111::325     1e-15  27%  341 aa  ATP62_PELLD RecName: Full=ATP synthase subunit a 2;AltName:
   36::240     1e-15  27%  244 aa  ATPI_COFAR RecName: Full=ATP synthase subunit a,
   30::243     1e-15  26%  247 aa  ATPI_CARPA RecName: Full=ATP synthase subunit a,
   44::281     1e-15  31%  289 aa  ATP6_PSEAE RecName: Full=ATP synthase subunit a;AltName:
   44::281     1e-15  31%  289 aa  ATP6_PSEAB RecName: Full=ATP synthase subunit a;AltName:
   44::281     1e-15  31%  289 aa  ATP6_PSEA8 RecName: Full=ATP synthase subunit a;AltName:
   44::281     1e-15  31%  289 aa  ATP6_PSEA7 RecName: Full=ATP synthase subunit a;AltName:
   38::257     1e-15  30%  264 aa  ATP6_COXB2 RecName: Full=ATP synthase subunit a;AltName:
   36::230     1e-15  33%  234 aa  ATP62_PELCD RecName: Full=ATP synthase subunit a 2;AltName:
   39::243     2e-15  26%  247 aa  ATPI_SPIOL RecName: Full=ATP synthase subunit a,
   30::243     2e-15  27%  247 aa  ATPI_CALFG RecName: Full=ATP synthase subunit a,
   28::239     2e-15  23%  248 aa  ATPI_PORYE RecName: Full=ATP synthase subunit a,
   56::280     2e-15  31%  288 aa  ATP6_PSYA2 RecName: Full=ATP synthase subunit a;AltName:
   51::192     2e-15  31%  241 aa  ATP6_PROMT RecName: Full=ATP synthase subunit a;AltName:
   51::192     2e-15  31%  241 aa  ATP6_PROM1 RecName: Full=ATP synthase subunit a;AltName:
   28::239     3e-15  23%  248 aa  ATPI_PORPU RecName: Full=ATP synthase subunit a,
   39::243     3e-15  25%  247 aa  ATPI_OENPA RecName: Full=ATP synthase subunit a,
   39::243     3e-15  25%  247 aa  ATPI_OENGL RecName: Full=ATP synthase subunit a,
   39::243     3e-15  25%  247 aa  ATPI_OENEH RecName: Full=ATP synthase subunit a,
   39::243     3e-15  25%  247 aa  ATPI_OENBI RecName: Full=ATP synthase subunit a,
   39::243     3e-15  25%  247 aa  ATPI_OENAR RecName: Full=ATP synthase subunit a,
   30::244     3e-15  26%  248 aa  ATPI_NUPAD RecName: Full=ATP synthase subunit a,
   32::245     3e-15  26%  249 aa  ATPI_LEPVR RecName: Full=ATP synthase subunit a,
   39::243     3e-15  26%  247 aa  ATPI_LACSA RecName: Full=ATP synthase subunit a,
   32::245     3e-15  26%  249 aa  ATPI_DRANE RecName: Full=ATP synthase subunit a,
   30::243     3e-15  26%  247 aa  ATPI_CUCSA RecName: Full=ATP synthase subunit a,
   41::257     3e-15  28%  264 aa  ATP6_SHEFN RecName: Full=ATP synthase subunit a;AltName:
   25::241     3e-15  29%  242 aa  ATP6_RICRS RecName: Full=ATP synthase subunit a;AltName:
   25::241     3e-15  29%  242 aa  ATP6_RICRO RecName: Full=ATP synthase subunit a;AltName:
   21::242     3e-15  31%  248 aa  ATP6_ELUMP RecName: Full=ATP synthase subunit a;AltName:
   38::257     3e-15  29%  264 aa  ATP6_COXBN RecName: Full=ATP synthase subunit a;AltName:
   11::220     3e-15  27%  221 aa  ATP6_CLOAB RecName: Full=ATP synthase subunit a;AltName:
   30::243     4e-15  26%  247 aa  ATPI_VITVI RecName: Full=ATP synthase subunit a,
   40::244     4e-15  27%  248 aa  ATPI_PELHO RecName: Full=ATP synthase subunit a,
   32::245     4e-15  26%  249 aa  ATPI_NASOF RecName: Full=ATP synthase subunit a,
   32::245     4e-15  26%  249 aa  ATPI_LOBMA RecName: Full=ATP synthase subunit a,
   36::240     4e-15  26%  244 aa  ATPI_GOSHI RecName: Full=ATP synthase subunit a,
   39::243     4e-15  26%  247 aa  ATPI_DAUCA RecName: Full=ATP synthase subunit a,
   32::245     4e-15  26%  249 aa  ATPI_CRUWA RecName: Full=ATP synthase subunit a,
   32::245     4e-15  26%  249 aa  ATPI_BARVE RecName: Full=ATP synthase subunit a,
   32::245     4e-15  26%  249 aa  ATPI_ARATH RecName: Full=ATP synthase subunit a,
   32::245     5e-15  26%  249 aa  ATPI_OLIPU RecName: Full=ATP synthase subunit a,
   30::243     5e-15  26%  247 aa  ATPI_BUXMI RecName: Full=ATP synthase subunit a,
   30::243     5e-15  26%  247 aa  ATPI_ACOCL RecName: Full=ATP synthase subunit a,
   30::243     5e-15  26%  247 aa  ATPI_ACOAM RecName: Full=ATP synthase subunit a,
   29::267     5e-15  32%  274 aa  ATP6_YERE8 RecName: Full=ATP synthase subunit a;AltName:
   77::272     5e-15  33%  280 aa  ATP6_THIDA RecName: Full=ATP synthase subunit a;AltName:
   62::239     5e-15  31%  242 aa  ATP6_ANAPZ RecName: Full=ATP synthase subunit a;AltName:
   59::243     6e-15  29%  247 aa  ATPI_SOYBN RecName: Full=ATP synthase subunit a,
   41::243     6e-15  27%  247 aa  ATPI_POPTR RecName: Full=ATP synthase subunit a,
   41::243     6e-15  27%  247 aa  ATPI_POPAL RecName: Full=ATP synthase subunit a,
   39::243     6e-15  26%  247 aa  ATPI_PANGI RecName: Full=ATP synthase subunit a,
   39::243     6e-15  26%  247 aa  ATPI_LOTJA RecName: Full=ATP synthase subunit a,
   39::243     6e-15  26%  247 aa  ATPI_GUIAB RecName: Full=ATP synthase subunit a,
   30::244     6e-15  25%  248 aa  ATPI_AMBTC RecName: Full=ATP synthase subunit a,
   36::263     6e-15  31%  264 aa  ATP6_PASMU RecName: Full=ATP synthase subunit a;AltName:
   65::277     6e-15  33%  284 aa  ATP6_MARAV RecName: Full=ATP synthase subunit a;AltName:
   35::261     6e-15  29%  262 aa  ATP6_MANSM RecName: Full=ATP synthase subunit a;AltName:
   38::257     6e-15  30%  263 aa  ATP6_DICNV RecName: Full=ATP synthase subunit a;AltName:
    9::246     6e-15  31%  249 aa  ATP62_OCHA4 RecName: Full=ATP synthase subunit a 2;AltName:
   39::243     8e-15  26%  247 aa  ATPI_TRACE RecName: Full=ATP synthase subunit a,
   39::244     8e-15  27%  248 aa  ATPI_PINKO RecName: Full=ATP synthase subunit a,
   30::243     8e-15  26%  247 aa  ATPI_MORIN RecName: Full=ATP synthase subunit a,
   59::243     8e-15  28%  247 aa  ATPI_FAGEA RecName: Full=ATP synthase subunit a,
   32::245     8e-15  26%  249 aa  ATPI_AETCO RecName: Full=ATP synthase subunit a,
   54::273     8e-15  33%  281 aa  ATP6_STRLI RecName: Full=ATP synthase subunit a;AltName:
   52::266     8e-15  30%  273 aa  ATP6_SERP5 RecName: Full=ATP synthase subunit a;AltName:
   50::241     8e-15  31%  242 aa  ATP6_RICPR RecName: Full=ATP synthase subunit a;AltName:
   56::280     8e-15  31%  288 aa  ATP6_PSYWF RecName: Full=ATP synthase subunit a;AltName:
   39::244     1e-14  27%  248 aa  ATPI_PINTH RecName: Full=ATP synthase subunit a,
   32::245     1e-14  26%  249 aa  ATPI_AETGR RecName: Full=ATP synthase subunit a,
   66::236     1e-14  31%  245 aa  ATP6_ACIBL RecName: Full=ATP synthase subunit a;AltName:
   39::243     1e-14  27%  247 aa  ATPI_SOLLC RecName: Full=ATP synthase subunit a,
   39::243     1e-14  25%  247 aa  ATPI_PIPCE RecName: Full=ATP synthase subunit a,
   52::238     1e-14  28%  248 aa  ATP6_SYNJA RecName: Full=ATP synthase subunit a;AltName:
   55::275     1e-14  30%  282 aa  ATP6_MARMS RecName: Full=ATP synthase subunit a;AltName:
   23::243     1e-14  32%  244 aa  ATP6_DICDI RecName: Full=ATP synthase subunit a;AltName:
   58::249     1e-14  33%  252 aa  ATP6_BARBK RecName: Full=ATP synthase subunit a;AltName:
   16::254     1e-14  29%  255 aa  ATP6_ALHEH RecName: Full=ATP synthase subunit a;AltName:
   30::244     2e-14  25%  248 aa  ATPI_NYMAL RecName: Full=ATP synthase subunit a,
   30::243     2e-14  26%  247 aa  ATPI_ILLOL RecName: Full=ATP synthase subunit a,
   35::232     2e-14  28%  257 aa  ATP6_SYMTH RecName: Full=ATP synthase subunit a;AltName:
   56::280     2e-14  30%  288 aa  ATP6_PSYCK RecName: Full=ATP synthase subunit a;AltName:
   64::278     2e-14  33%  290 aa  ATP6_PSEU5 RecName: Full=ATP synthase subunit a;AltName:
   44::238     2e-14  30%  253 aa  ATP6_NOSP7 RecName: Full=ATP synthase subunit a;AltName:
   77::275     2e-14  28%  303 aa  ATP6_MYXXD RecName: Full=ATP synthase subunit a;AltName:
   35::243     2e-14  31%  244 aa  ATP6_DICCI RecName: Full=ATP synthase subunit a;AltName:
   35::195     2e-14  29%  244 aa  ATP61_SYNP2 RecName: Full=ATP synthase subunit a 1;AltName:
   29::243     2e-14  27%  247 aa  ATPI_PSEAK RecName: Full=ATP synthase subunit a,
   30::243     2e-14  26%  247 aa  ATPI_LIRTU RecName: Full=ATP synthase subunit a,
   39::243     3e-14  26%  247 aa  ATPI_TOBAC RecName: Full=ATP synthase subunit a,
   39::243     3e-14  26%  247 aa  ATPI_SOLTU RecName: Full=ATP synthase subunit a,
   39::243     3e-14  26%  247 aa  ATPI_SOLBU RecName: Full=ATP synthase subunit a,
   30::243     3e-14  26%  247 aa  ATPI_RANMC RecName: Full=ATP synthase subunit a,
   30::243     3e-14  26%  247 aa  ATPI_PLAOC RecName: Full=ATP synthase subunit a,
   39::243     3e-14  26%  247 aa  ATPI_NICTO RecName: Full=ATP synthase subunit a,
   39::243     3e-14  26%  247 aa  ATPI_NICSY RecName: Full=ATP synthase subunit a,
   30::243     3e-14  25%  247 aa  ATPI_LOLPR RecName: Full=ATP synthase subunit a,
   30::243     3e-14  26%  247 aa  ATPI_CHLSC RecName: Full=ATP synthase subunit a,
   39::243     3e-14  26%  247 aa  ATPI_ATRBE RecName: Full=ATP synthase subunit a,
   44::281     3e-14  30%  289 aa  ATP6_PSEPW RecName: Full=ATP synthase subunit a;AltName:
   44::281     3e-14  30%  289 aa  ATP6_PSEPG RecName: Full=ATP synthase subunit a;AltName:
   60::240     4e-14  28%  241 aa  ATP6_WOLTR RecName: Full=ATP synthase subunit a;AltName:
    9::240     4e-14  29%  241 aa  ATP6_RHORU RecName: Full=ATP synthase subunit a;AltName:
    9::240     4e-14  29%  241 aa  ATP6_RHORT RecName: Full=ATP synthase subunit a;AltName:
   17::246     4e-14  27%  250 aa  ATP6_RHIEC RecName: Full=ATP synthase subunit a;AltName:
   51::265     4e-14  32%  272 aa  ATP6_EDWI9 RecName: Full=ATP synthase subunit a;AltName:
   42::267     4e-14  27%  274 aa  ATP6_BUCBP RecName: Full=ATP synthase subunit a;AltName:
   30::243     6e-14  25%  247 aa  ATPI_WHEAT RecName: Full=ATP synthase subunit a,
   30::243     6e-14  25%  247 aa  ATPI_SACOF RecName: Full=ATP synthase subunit a,
   30::243     6e-14  25%  247 aa  ATPI_SACHY RecName: Full=ATP synthase subunit a,
   30::243     6e-14  25%  247 aa  ATPI_MAIZE RecName: Full=ATP synthase subunit a,
   30::243     6e-14  25%  247 aa  ATPI_HORVU RecName: Full=ATP synthase subunit a,
   30::243     6e-14  25%  247 aa  ATPI_DRIGR RecName: Full=ATP synthase subunit a,
   30::243     6e-14  25%  247 aa  ATPI_AGRST RecName: Full=ATP synthase subunit a,
   52::188     6e-14  29%  248 aa  ATP6_SYNJB RecName: Full=ATP synthase subunit a;AltName:
   18::249     6e-14  26%  255 aa  ATP62_VIBHB RecName: Full=ATP synthase subunit a 2;AltName:
   27::222     6e-14  28%  230 aa  ATP61_CYAA5 RecName: Full=ATP synthase subunit a 1;AltName:
   30::243     7e-14  25%  247 aa  ATPI_SORBI RecName: Full=ATP synthase subunit a,
   30::243     7e-14  28%  247 aa  ATPI_CUSEX RecName: Full=ATP synthase subunit a, plastid;AltName:
   30::243     7e-14  25%  247 aa  ATPI_BRADI RecName: Full=ATP synthase subunit a,
   11::246     7e-14  28%  250 aa  ATP6_SINMW RecName: Full=ATP synthase subunit a;AltName:
   35::259     7e-14  29%  263 aa  ATP6_HAEPS RecName: Full=ATP synthase subunit a;AltName:
   56::237     7e-14  28%  251 aa  ATP62_CYAA5 RecName: Full=ATP synthase subunit a 2;AltName:
   30::243     9e-14  25%  247 aa  ATPI_ORYSJ RecName: Full=ATP synthase subunit a,
   30::243     9e-14  25%  247 aa  ATPI_ORYSI RecName: Full=ATP synthase subunit a,
   30::243     9e-14  25%  247 aa  ATPI_ORYSA RecName: Full=ATP synthase subunit a,
   30::243     9e-14  25%  247 aa  ATPI_CUSRE RecName: Full=ATP synthase subunit a, plastid;AltName:
   32::247     9e-14  29%  250 aa  ATP6_RHOPS RecName: Full=ATP synthase subunit a;AltName:
   49::261     9e-14  30%  265 aa  ATP6_HAES2 RecName: Full=ATP synthase subunit a;AltName:
   91::324     9e-14  27%  342 aa  ATP6_CHLPD RecName: Full=ATP synthase subunit a;AltName:
   59::284     9e-14  30%  291 aa  ATP6_ACIAD RecName: Full=ATP synthase subunit a;AltName:
   18::248     9e-14  28%  255 aa  ATP62_PHOPR RecName: Full=ATP synthase subunit a 2;AltName:
   43::185     9e-14  34%  240 aa  ATP61_ACAM1 RecName: Full=ATP synthase subunit a 1;AltName:
   20::259     1e-13  30%  266 aa  ATP6_PECCP RecName: Full=ATP synthase subunit a;AltName:
   49::261     1e-13  30%  265 aa  ATP6_HAES1 RecName: Full=ATP synthase subunit a;AltName:
   22::222     1e-13  26%  234 aa  ATP62_ACAM1 RecName: Full=ATP synthase subunit a 2;AltName:
   30::243     2e-13  25%  247 aa  ATPI_ORYNI RecName: Full=ATP synthase subunit a,
   30::243     2e-13  25%  247 aa  ATPI_NANDO RecName: Full=ATP synthase subunit a,
   37::242     2e-13  26%  248 aa  ATPI_ANTSP RecName: Full=ATP synthase subunit a,
    6::206     2e-13  30%  207 aa  ATP6_SULSY RecName: Full=ATP synthase subunit a;AltName:
   44::281     2e-13  30%  289 aa  ATP6_PSEPK RecName: Full=ATP synthase subunit a;AltName:
   44::281     2e-13  30%  289 aa  ATP6_PSEP1 RecName: Full=ATP synthase subunit a;AltName:
   20::259     2e-13  30%  266 aa  ATP6_ERWCT RecName: Full=ATP synthase subunit a;AltName:
   54::236     2e-13  27%  249 aa  ATP6_SYNP6 RecName: Full=ATP synthase subunit a;AltName:
   54::236     2e-13  27%  249 aa  ATP6_SYNE7 RecName: Full=ATP synthase subunit a;AltName:
   31::246     2e-13  30%  249 aa  ATP6_RHOPB RecName: Full=ATP synthase subunit a;AltName:
   37::247     2e-13  31%  250 aa  ATP6_AZOC5 RecName: Full=ATP synthase subunit a;AltName:
   11::211     2e-13  30%  234 aa  ATP61_HAHCH RecName: Full=ATP synthase subunit a 1;AltName:
   23::223     2e-13  29%  226 aa  ATP61_CHLP8 RecName: Full=ATP synthase subunit a 1;AltName:
   65::244     3e-13  27%  248 aa  ATPI_WELMI RecName: Full=ATP synthase subunit a,
   39::243     3e-13  26%  247 aa  ATPI_IPOPU RecName: Full=ATP synthase subunit a,
   32::245     3e-13  25%  249 aa  ATPI_ARAHI RecName: Full=ATP synthase subunit a,
   61::257     3e-13  27%  264 aa  ATP6_SHEDO RecName: Full=ATP synthase subunit a;AltName:
   17::246     3e-13  27%  250 aa  ATP6_RHISN RecName: Full=ATP synthase subunit a;AltName:
   17::246     3e-13  27%  250 aa  ATP6_RHIME RecName: Full=ATP synthase subunit a;AltName:
  139::258     3e-13  38%  265 aa  ATP6_IDILO RecName: Full=ATP synthase subunit a;AltName:
   47::261     3e-13  30%  270 aa  ATP6_ALISL RecName: Full=ATP synthase subunit a;AltName:
   32::245     4e-13  25%  249 aa  ATPI_CAPBU RecName: Full=ATP synthase subunit a,
   76::265     4e-13  33%  272 aa  ATP6_ERWT9 RecName: Full=ATP synthase subunit a;AltName:
   38::254     4e-13  31%  261 aa  ATP6_COLP3 RecName: Full=ATP synthase subunit a;AltName:
   37::224     4e-13  29%  225 aa  ATP6_CAMC5 RecName: Full=ATP synthase subunit a;AltName:
   41::224     4e-13  30%  227 aa  ATP6_CAMC1 RecName: Full=ATP synthase subunit a;AltName:
   59::284     4e-13  30%  291 aa  ATP6_ACIBY RecName: Full=ATP synthase subunit a;AltName:
   59::284     4e-13  30%  291 aa  ATP6_ACIBT RecName: Full=ATP synthase subunit a;AltName:
   59::284     4e-13  30%  291 aa  ATP6_ACIBS RecName: Full=ATP synthase subunit a;AltName:
   59::284     4e-13  30%  291 aa  ATP6_ACIBC RecName: Full=ATP synthase subunit a;AltName:
   59::284     4e-13  30%  291 aa  ATP6_ACIB5 RecName: Full=ATP synthase subunit a;AltName:
   59::284     4e-13  30%  291 aa  ATP6_ACIB3 RecName: Full=ATP synthase subunit a;AltName:
   55::269     4e-13  30%  276 aa  ATP62_HAHCH RecName: Full=ATP synthase subunit a 2;AltName:
   14::223     4e-13  27%  223 aa  ATP61_PELLD RecName: Full=ATP synthase subunit a 1;AltName:
  146::266     5e-13  40%  273 aa  ATP6_SHESW RecName: Full=ATP synthase subunit a;AltName:
  146::266     5e-13  40%  273 aa  ATP6_SHEPC RecName: Full=ATP synthase subunit a;AltName:
   61::257     5e-13  30%  264 aa  ATP6_SHELP RecName: Full=ATP synthase subunit a;AltName:
   55::281     5e-13  30%  289 aa  ATP6_PSE14 RecName: Full=ATP synthase subunit a;AltName:
   57::280     5e-13  32%  287 aa  ATP6_CHRSD RecName: Full=ATP synthase subunit a;AltName:
   62::265     5e-13  34%  274 aa  ATP6_BUCAI RecName: Full=ATP synthase subunit a;AltName:
   17::246     5e-13  26%  250 aa  ATP6_AGRVS RecName: Full=ATP synthase subunit a;AltName:
   30::243     6e-13  25%  247 aa  ATPI_CERDE RecName: Full=ATP synthase subunit a,
   39::252     6e-13  28%  259 aa  ATP6_TOLAT RecName: Full=ATP synthase subunit a;AltName:
  131::257     6e-13  36%  264 aa  ATP6_SHEAM RecName: Full=ATP synthase subunit a;AltName:
   52::245     6e-13  29%  248 aa  ATP6_RHOP2 RecName: Full=ATP synthase subunit a;AltName:
   45::246     6e-13  27%  250 aa  ATP6_RHILW RecName: Full=ATP synthase subunit a;AltName:
   45::246     6e-13  28%  250 aa  ATP6_RHIE6 RecName: Full=ATP synthase subunit a;AltName:
   56::282     6e-13  31%  290 aa  ATP6_PSEF5 RecName: Full=ATP synthase subunit a;AltName:
   14::242     6e-13  25%  244 aa  ATP6_PELUB RecName: Full=ATP synthase subunit a;AltName:
   26::191     6e-13  25%  249 aa  ATP6_MICAN RecName: Full=ATP synthase subunit a;AltName:
   60::259     6e-13  30%  260 aa  ATP6_BRANA RecName: Full=ATP synthase subunit a;AltName:
   56::249     6e-13  30%  252 aa  ATP6_BARHE RecName: Full=ATP synthase subunit a;AltName:
  149::269     8e-13  35%  276 aa  ATP6_SHEHH RecName: Full=ATP synthase subunit a;AltName:
   36::245     8e-13  31%  248 aa  ATP6_ROSDO RecName: Full=ATP synthase subunit a;AltName:
   35::194     8e-13  37%  233 aa  ATP6_LAWIP RecName: Full=ATP synthase subunit a;AltName:
  149::348     8e-13  30%  349 aa  ATP62_ARATH RecName: Full=ATP synthase subunit a-2;AltName:
  185::384     8e-13  30%  385 aa  ATP61_ARATH RecName: Full=ATP synthase subunit a-1;AltName:
   47::261     1e-12  29%  270 aa  ATP6_VIBFM RecName: Full=ATP synthase subunit a;AltName:
   47::261     1e-12  29%  270 aa  ATP6_VIBF1 RecName: Full=ATP synthase subunit a;AltName:
  131::257     1e-12  33%  264 aa  ATP6_SHESH RecName: Full=ATP synthase subunit a;AltName:
   31::246     1e-12  29%  249 aa  ATP6_RHOP5 RecName: Full=ATP synthase subunit a;AltName:
   53::246     1e-12  29%  249 aa  ATP6_OLICO RecName: Full=ATP synthase subunit a;AltName:
   40::241     1e-12  27%  243 aa  ATP6_EHRRW RecName: Full=ATP synthase subunit a;AltName:
   40::241     1e-12  27%  243 aa  ATP6_EHRRG RecName: Full=ATP synthase subunit a;AltName:
   63::266     2e-12  28%  278 aa  ATP6_WIGBR RecName: Full=ATP synthase subunit a;AltName:
   55::281     2e-12  30%  289 aa  ATP6_PSESM RecName: Full=ATP synthase subunit a;AltName:
   81::265     2e-12  34%  272 aa  ATP6_ENTS8 RecName: Full=ATP synthase subunit a;AltName:
   47::261     2e-12  29%  270 aa  ATP6_VIBCM RecName: Full=ATP synthase subunit a;AltName:
   47::261     2e-12  29%  270 aa  ATP6_VIBCH RecName: Full=ATP synthase subunit a;AltName:
   47::261     2e-12  29%  270 aa  ATP6_VIBC3 RecName: Full=ATP synthase subunit a;AltName:
  131::257     2e-12  33%  264 aa  ATP6_SHEWM RecName: Full=ATP synthase subunit a;AltName:
   29::267     2e-12  31%  274 aa  ATP6_PROMH RecName: Full=ATP synthase subunit a;AltName:
   48::258     2e-12  28%  259 aa  ATP6_MAGSM RecName: Full=ATP synthase subunit a;AltName:
   50::261     3e-12  30%  270 aa  ATP6_VIBVY RecName: Full=ATP synthase subunit a;AltName:
   50::261     3e-12  30%  270 aa  ATP6_VIBVU RecName: Full=ATP synthase subunit a;AltName:
   48::276     3e-12  29%  284 aa  ATP6_RUTMC RecName: Full=ATP synthase subunit a;AltName:
   50::261     4e-12  30%  270 aa  ATP6_VIBPA RecName: Full=ATP synthase subunit a;AltName:
   50::261     4e-12  30%  270 aa  ATP6_VIBAL RecName: Full=ATP synthase subunit a;AltName:
  131::257     4e-12  33%  264 aa  ATP6_SHEPW RecName: Full=ATP synthase subunit a;AltName:
   50::261     4e-12  30%  270 aa  ATP61_VIBHB RecName: Full=ATP synthase subunit a 1;AltName:
   82::274     5e-12  28%  276 aa  ATP6_SYNY3 RecName: Full=ATP synthase subunit a;AltName:
   47::257     5e-12  26%  264 aa  ATP6_SHESR RecName: Full=ATP synthase subunit a;AltName:
   47::257     5e-12  26%  264 aa  ATP6_SHESM RecName: Full=ATP synthase subunit a;AltName:
   47::257     5e-12  26%  264 aa  ATP6_SHESA RecName: Full=ATP synthase subunit a;AltName:
   47::257     5e-12  26%  264 aa  ATP6_SHEON RecName: Full=ATP synthase subunit a;AltName:
  131::257     5e-12  32%  264 aa  ATP6_SHEB9 RecName: Full=ATP synthase subunit a;AltName:
  145::271     5e-12  32%  278 aa  ATP6_SHEB8 RecName: Full=ATP synthase subunit a;AltName:
  131::257     5e-12  32%  264 aa  ATP6_SHEB5 RecName: Full=ATP synthase subunit a;AltName:
  131::257     5e-12  32%  264 aa  ATP6_SHEB2 RecName: Full=ATP synthase subunit a;AltName:
   50::264     5e-12  29%  271 aa  ATP6_ENT38 RecName: Full=ATP synthase subunit a;AltName:
  147::331     5e-12  27%  350 aa  ATP62_CHLP8 RecName: Full=ATP synthase subunit a 2;AltName:
  133::254     5e-12  37%  262 aa  ATP61_PHOPR RecName: Full=ATP synthase subunit a 1;AltName:
   11::241     7e-12  26%  242 aa  ATP6_RICBR RecName: Full=ATP synthase subunit a;AltName:
   11::241     7e-12  26%  242 aa  ATP6_RICB8 RecName: Full=ATP synthase subunit a;AltName:
   45::259     7e-12  28%  266 aa  ATP6_KLEP7 RecName: Full=ATP synthase subunit a;AltName:
   50::264     7e-12  28%  271 aa  ATP6_KLEP3 RecName: Full=ATP synthase subunit a;AltName:
    1::75      7e-12  39%   78 aa  ATP6_BACAO RecName: Full=ATP synthase subunit a;AltName:
  144::265     9e-12  37%  272 aa  ATP6_SODGM RecName: Full=ATP synthase subunit a;AltName:
   52::245     9e-12  28%  248 aa  ATP6_RHOPT RecName: Full=ATP synthase subunit a;AltName:
   52::245     9e-12  28%  248 aa  ATP6_RHOPA RecName: Full=ATP synthase subunit a;AltName:
   55::281     9e-12  31%  289 aa  ATP6_PSEU2 RecName: Full=ATP synthase subunit a;AltName:
   55::281     9e-12  29%  289 aa  ATP6_PSEPF RecName: Full=ATP synthase subunit a;AltName:
   27::240     9e-12  25%  243 aa  ATP6_EHRCJ RecName: Full=ATP synthase subunit a;AltName:
   20::249     9e-12  30%  252 aa  ATP6_BART1 RecName: Full=ATP synthase subunit a;AltName:
  149::269     1e-11  35%  276 aa  ATP6_SHEPA RecName: Full=ATP synthase subunit a;AltName:
   44::281     1e-11  30%  289 aa  ATP6_PSEFS RecName: Full=ATP synthase subunit a;AltName:
   46::221     1e-11  28%  229 aa  ATP6_GEOUR RecName: Full=ATP synthase subunit a;AltName:
   46::287     1e-11  31%  293 aa  ATP6_BORPE RecName: Full=ATP synthase subunit a;AltName:
   46::287     1e-11  31%  293 aa  ATP6_BORPA RecName: Full=ATP synthase subunit a;AltName:
   46::287     1e-11  31%  293 aa  ATP6_BORBR RecName: Full=ATP synthase subunit a;AltName:
   47::287     1e-11  30%  293 aa  ATP6_BORA1 RecName: Full=ATP synthase subunit a;AltName:
   20::263     1e-11  29%  270 aa  ATP6_PSEA6 RecName: Full=ATP synthase subunit a;AltName:
   31::260     2e-11  29%  261 aa  ATP6_SPHWW RecName: Full=ATP synthase subunit a;AltName:
   10::246     2e-11  29%  249 aa  ATP6_BRAJA RecName: Full=ATP synthase subunit a;AltName:
   34::250     2e-11  30%  251 aa  ATP6_ACICJ RecName: Full=ATP synthase subunit a;AltName:
   37::167     3e-11  34%  217 aa  ATP6_SYNAS RecName: Full=ATP synthase subunit a;AltName:
   80::264     3e-11  29%  271 aa  ATP6_SALTY RecName: Full=ATP synthase subunit a;AltName:
   80::264     3e-11  29%  271 aa  ATP6_SALTI RecName: Full=ATP synthase subunit a;AltName:
   80::264     3e-11  29%  271 aa  ATP6_SALSV RecName: Full=ATP synthase subunit a;AltName:
   80::264     3e-11  29%  271 aa  ATP6_SALPK RecName: Full=ATP synthase subunit a;AltName:
   80::264     3e-11  29%  271 aa  ATP6_SALPC RecName: Full=ATP synthase subunit a;AltName:
   80::264     3e-11  29%  271 aa  ATP6_SALPB RecName: Full=ATP synthase subunit a;AltName:
   80::264     3e-11  29%  271 aa  ATP6_SALPA RecName: Full=ATP synthase subunit a;AltName:
   80::264     3e-11  29%  271 aa  ATP6_SALNS RecName: Full=ATP synthase subunit a;AltName:
   80::264     3e-11  29%  271 aa  ATP6_SALHS RecName: Full=ATP synthase subunit a;AltName:
   80::264     3e-11  29%  271 aa  ATP6_SALG2 RecName: Full=ATP synthase subunit a;AltName:
   80::264     3e-11  29%  271 aa  ATP6_SALEP RecName: Full=ATP synthase subunit a;AltName:
   80::264     3e-11  29%  271 aa  ATP6_SALDC RecName: Full=ATP synthase subunit a;AltName:
   80::264     3e-11  29%  271 aa  ATP6_SALCH RecName: Full=ATP synthase subunit a;AltName:
   80::264     3e-11  29%  271 aa  ATP6_SALAR RecName: Full=ATP synthase subunit a;AltName:
   80::264     3e-11  29%  271 aa  ATP6_SALA4 RecName: Full=ATP synthase subunit a;AltName:
  147::276     3e-11  33%  282 aa  ATP6_AZOSB RecName: Full=ATP synthase subunit a;AltName:
   81::183     3e-11  28%  230 aa  ATP6_LEGPH RecName: Full=ATP synthase subunit a;AltName:
   81::183     3e-11  28%  230 aa  ATP6_LEGPC RecName: Full=ATP synthase subunit a;AltName:
   81::183     3e-11  28%  230 aa  ATP6_LEGPA RecName: Full=ATP synthase subunit a;AltName:
  140::260     4e-11  34%  267 aa  ATP6_PSYIN RecName: Full=ATP synthase subunit a;AltName:
   53::267     4e-11  27%  274 aa  ATP6_PHOLL RecName: Full=ATP synthase subunit a;AltName:
  144::265     4e-11  35%  273 aa  ATP6_BAUCH RecName: Full=ATP synthase subunit a;AltName:
  138::368     4e-11  26%  406 aa  ATP6_ANADF RecName: Full=ATP synthase subunit a;AltName:
   39::252     4e-11  28%  259 aa  ATP6_AERS4 RecName: Full=ATP synthase subunit a;AltName:
   10::244     4e-11  29%  247 aa  ATP61_BRASB RecName: Full=ATP synthase subunit a 1;AltName:
   22::234     6e-11  28%  237 aa  ATP6_RHOCA RecName: Full=ATP synthase subunit a;AltName:
    1::214     6e-11  26%  228 aa  ATP62_PELPD RecName: Full=ATP synthase subunit a 2;AltName:
  143::264     7e-11  34%  271 aa  ATP6_SHISS RecName: Full=ATP synthase subunit a;AltName:
  143::264     7e-11  34%  271 aa  ATP6_SHIDS RecName: Full=ATP synthase subunit a;AltName:
  143::264     7e-11  34%  271 aa  ATP6_SHIB3 RecName: Full=ATP synthase subunit a;AltName:
   91::301     7e-11  26%  311 aa  ATP6_SACD2 RecName: Full=ATP synthase subunit a;AltName:
   50::260     7e-11  25%  271 aa  ATP6_PARUW RecName: Full=ATP synthase subunit a;AltName:
   25::221     7e-11  29%  284 aa  ATP6_FRASC RecName: Full=ATP synthase subunit a;AltName:
  143::264     7e-11  34%  271 aa  ATP6_ESCF3 RecName: Full=ATP synthase subunit a;AltName:
  143::264     7e-11  34%  271 aa  ATP6_ECOUT RecName: Full=ATP synthase subunit a;AltName:
  143::264     7e-11  34%  271 aa  ATP6_ECOSM RecName: Full=ATP synthase subunit a;AltName:
  143::264     7e-11  34%  271 aa  ATP6_ECOSE RecName: Full=ATP synthase subunit a;AltName:
  143::264     7e-11  34%  271 aa  ATP6_ECOLU RecName: Full=ATP synthase subunit a;AltName:
  143::264     7e-11  34%  271 aa  ATP6_ECOLI RecName: Full=ATP synthase subunit a;AltName:
  143::264     7e-11  34%  271 aa  ATP6_ECOLC RecName: Full=ATP synthase subunit a;AltName:
  143::264     7e-11  34%  271 aa  ATP6_ECOL6 RecName: Full=ATP synthase subunit a;AltName:
  143::264     7e-11  34%  271 aa  ATP6_ECOL5 RecName: Full=ATP synthase subunit a;AltName:
  143::264     7e-11  34%  271 aa  ATP6_ECOK1 RecName: Full=ATP synthase subunit a;AltName:
  143::264     7e-11  34%  271 aa  ATP6_ECOHS RecName: Full=ATP synthase subunit a;AltName:
  143::264     7e-11  34%  271 aa  ATP6_ECODH RecName: Full=ATP synthase subunit a;AltName:
  143::264     7e-11  34%  271 aa  ATP6_ECOBW RecName: Full=ATP synthase subunit a;AltName:
  143::264     7e-11  34%  271 aa  ATP6_ECO8A RecName: Full=ATP synthase subunit a;AltName:
  143::264     7e-11  34%  271 aa  ATP6_ECO81 RecName: Full=ATP synthase subunit a;AltName:
  143::264     7e-11  34%  271 aa  ATP6_ECO7I RecName: Full=ATP synthase subunit a;AltName:
  143::264     7e-11  34%  271 aa  ATP6_ECO5E RecName: Full=ATP synthase subunit a;AltName:
  143::264     7e-11  34%  271 aa  ATP6_ECO57 RecName: Full=ATP synthase subunit a;AltName:
  143::264     7e-11  34%  271 aa  ATP6_ECO55 RecName: Full=ATP synthase subunit a;AltName:
  143::264     7e-11  34%  271 aa  ATP6_ECO45 RecName: Full=ATP synthase subunit a;AltName:
  143::264     7e-11  34%  271 aa  ATP6_ECO27 RecName: Full=ATP synthase subunit a;AltName:
  143::264     7e-11  34%  271 aa  ATP6_ECO24 RecName: Full=ATP synthase subunit a;AltName:
   34::281     7e-11  28%  287 aa  ATP6_DIAST RecName: Full=ATP synthase subunit a;AltName:
   29::267     1e-10  29%  274 aa  ATP6_YERPG RecName: Full=ATP synthase subunit a;AltName:
   81::280     1e-10  28%  281 aa  ATP6_OENBE RecName: Full=ATP synthase subunit a;AltName:
  130::262     1e-10  32%  269 aa  ATP6_NITEU RecName: Full=ATP synthase subunit a;AltName:
   20::233     1e-10  26%  234 aa  ATP6_DESDA RecName: Full=ATP synthase subunit a;AltName:
   52::250     1e-10  28%  253 aa  ATP6_BEII9 RecName: Full=ATP synthase subunit a;AltName:
   29::267     1e-10  29%  274 aa  ATP6_YERPY RecName: Full=ATP synthase subunit a;AltName:
   29::267     1e-10  29%  274 aa  ATP6_YERPS RecName: Full=ATP synthase subunit a;AltName:
   29::267     1e-10  29%  274 aa  ATP6_YERPP RecName: Full=ATP synthase subunit a;AltName:
   29::267     1e-10  29%  274 aa  ATP6_YERPN RecName: Full=ATP synthase subunit a;AltName:
   29::267     1e-10  29%  274 aa  ATP6_YERPE RecName: Full=ATP synthase subunit a;AltName:
   29::267     1e-10  29%  274 aa  ATP6_YERPB RecName: Full=ATP synthase subunit a;AltName:
   29::267     1e-10  29%  274 aa  ATP6_YERPA RecName: Full=ATP synthase subunit a;AltName:
   29::267     1e-10  29%  274 aa  ATP6_YERP3 RecName: Full=ATP synthase subunit a;AltName:
  143::264     1e-10  37%  271 aa  ATP6_SHIFL RecName: Full=ATP synthase subunit a;AltName:
  143::264     1e-10  37%  271 aa  ATP6_SHIF8 RecName: Full=ATP synthase subunit a;AltName:
  107::322     1e-10  25%  340 aa  ATP6_PELPB RecName: Full=ATP synthase subunit a;AltName:
   39::252     1e-10  28%  260 aa  ATP6_AERHH RecName: Full=ATP synthase subunit a;AltName:
   46::222     2e-10  28%  230 aa  ATP6_GEOLS RecName: Full=ATP synthase subunit a;AltName:
   51::244     2e-10  28%  247 aa  ATP6_BRASO RecName: Full=ATP synthase subunit a;AltName:
   56::221     2e-10  29%  229 aa  ATP6_BDEBA RecName: Full=ATP synthase subunit a;AltName:
   30::259     2e-10  32%  262 aa  ATP6_ALLAR RecName: Full=ATP synthase subunit a;AltName:
   67::256     2e-10  26%  261 aa  ATP6_RHOS5 RecName: Full=ATP synthase subunit a;AltName:
   53::242     2e-10  27%  247 aa  ATP6_RHOS4 RecName: Full=ATP synthase subunit a;AltName:
   67::256     2e-10  27%  261 aa  ATP6_RHOS1 RecName: Full=ATP synthase subunit a;AltName:
   19::245     2e-10  29%  248 aa  ATP6_DINSH RecName: Full=ATP synthase subunit a;AltName:
   80::264     2e-10  31%  271 aa  ATP6_CITK8 RecName: Full=ATP synthase subunit a;AltName:
   34::281     2e-10  28%  287 aa  ATP6_ACISJ RecName: Full=ATP synthase subunit a;AltName:
   25::241     3e-10  26%  242 aa  ATP6_RICAE RecName: Full=ATP synthase subunit a;AltName:
   97::326     3e-10  24%  345 aa  ATP6_CHLCH RecName: Full=ATP synthase subunit a;AltName:
   30::259     3e-10  32%  262 aa  ATP6_ALLMA RecName: Full=ATP synthase subunit a;AltName:
  132::252     3e-10  35%  259 aa  ATP61_METCA RecName: Full=ATP synthase subunit a 1;AltName:
  101::214     3e-10  27%  221 aa  ATP61_CHLTE RecName: Full=ATP synthase subunit a 1;AltName:
   55::229     4e-10  28%  233 aa  ATP6_SOLUE RecName: Full=ATP synthase subunit a;AltName:
   25::241     4e-10  28%  242 aa  ATP6_RICAH RecName: Full=ATP synthase subunit a;AltName:
   53::221     4e-10  29%  229 aa  ATP6_GEOSF RecName: Full=ATP synthase subunit a;AltName:
   25::241     5e-10  27%  242 aa  ATP6_RICCK RecName: Full=ATP synthase subunit a;AltName:
   11::241     5e-10  26%  242 aa  ATP6_ORITI RecName: Full=ATP synthase subunit a;AltName:
   36::243     5e-10  27%  249 aa  ATP6_GLUOX RecName: Full=ATP synthase subunit a;AltName:
   42::172     5e-10  29%  228 aa  ATP62_METCA RecName: Full=ATP synthase subunit a 2;AltName:
   11::241     6e-10  25%  242 aa  ATP6_ORITB RecName: Full=ATP synthase subunit a;AltName:
   30::188     6e-10  31%  229 aa  ATP6_DESOH RecName: Full=ATP synthase subunit a;AltName:
   55::241     8e-10  24%  242 aa  ATPI_ODOSI RecName: Full=ATP synthase subunit a,
   35::256     8e-10  28%  259 aa  ATP6_YEAST RecName: Full=ATP synthase subunit a;AltName:
  111::267     8e-10  32%  273 aa  ATP6_JANMA RecName: Full=ATP synthase subunit a;AltName:
   70::295     8e-10  34%  302 aa  ATP6_ALCBS RecName: Full=ATP synthase subunit a;AltName:
   24::259     1e-09  30%  260 aa  ATP6_NOVAD RecName: Full=ATP synthase subunit a;AltName:
   13::222     1e-09  31%  226 aa  ATP6_PHOVI RecName: Full=ATP synthase subunit a;AltName:
   59::222     1e-09  34%  226 aa  ATP6_HIPAM RecName: Full=ATP synthase subunit a;AltName:
   32::250     1e-09  25%  251 aa  ATP6_GRABC RecName: Full=ATP synthase subunit a;AltName:
   20::221     1e-09  26%  226 aa  ATP6_APILI RecName: Full=ATP synthase subunit a;AltName:
   51::287     2e-09  29%  293 aa  ATP6_BORPD RecName: Full=ATP synthase subunit a;AltName:
   81::310     2e-09  24%  324 aa  ATP62_PROA2 RecName: Full=ATP synthase subunit a 2;AltName:
  137::263     2e-09  35%  270 aa  ATP6_CHRVO RecName: Full=ATP synthase subunit a;AltName:
   13::222     3e-09  30%  226 aa  ATP6_FELCA RecName: Full=ATP synthase subunit a;AltName:
   57::252     3e-09  29%  253 aa  ATP6_CHOCR RecName: Full=ATP synthase subunit a;AltName:
   33::260     4e-09  29%  261 aa  ATP6_SPHAL RecName: Full=ATP synthase subunit a;AltName:
   22::257     4e-09  25%  260 aa  ATP6_PARL1 RecName: Full=ATP synthase subunit a;AltName:
   33::221     4e-09  27%  229 aa  ATP6_GEOSM RecName: Full=ATP synthase subunit a;AltName:
   35::244     4e-09  27%  247 aa  ATP6_ACACA RecName: Full=ATP synthase subunit a;AltName:
   13::222     5e-09  29%  226 aa  ATP6_RHIUN RecName: Full=ATP synthase subunit a;AltName:
   32::240     5e-09  25%  243 aa  ATP6_NEOSM RecName: Full=ATP synthase subunit a;AltName:
   13::222     5e-09  30%  226 aa  ATP6_HALGR RecName: Full=ATP synthase subunit a;AltName:
   33::221     5e-09  27%  229 aa  ATP6_GEOBB RecName: Full=ATP synthase subunit a;AltName:
   30::246     5e-09  24%  250 aa  ATP6_AGRRK RecName: Full=ATP synthase subunit a;AltName:
   21::265     7e-09  29%  266 aa  ATP6_ZYMMO RecName: Full=ATP synthase subunit a;AltName:
  167::301     7e-09  31%  311 aa  ATP6_TERTT RecName: Full=ATP synthase subunit a;AltName:
  176::278     7e-09  34%  297 aa  ATP6_MYCGA RecName: Full=ATP synthase subunit a;AltName:
   13::222     7e-09  29%  226 aa  ATP6_EQUAS RecName: Full=ATP synthase subunit a;AltName:
   13::222     7e-09  30%  226 aa  ATP6_CERSI RecName: Full=ATP synthase subunit a;AltName:
   41::230     7e-09  27%  234 aa  ATP61_PELCD RecName: Full=ATP synthase subunit a 1;AltName:
   30::251     9e-09  25%  254 aa  ATP6_VANPO RecName: Full=ATP synthase subunit a;AltName:
   39::262     9e-09  25%  269 aa  ATP6_BLOPB RecName: Full=ATP synthase subunit a;AltName:
   17::246     9e-09  26%  249 aa  ATP61_OCHA4 RecName: Full=ATP synthase subunit a 1;AltName:
   26::216     1e-08  27%  217 aa  ATP6_HYDS0 RecName: Full=ATP synthase subunit a;AltName:
  152::345     1e-08  28%  384 aa  ATP6_ANAD2 RecName: Full=ATP synthase subunit a;AltName:
   66::222     2e-08  33%  226 aa  ATP6_LEMCA RecName: Full=ATP synthase subunit a;AltName:
   50::246     2e-08  26%  250 aa  ATP6_RHIL3 RecName: Full=ATP synthase subunit a;AltName:
   54::251     2e-08  30%  252 aa  ATP6_MARPO RecName: Full=ATP synthase subunit a;AltName:
   13::222     2e-08  29%  226 aa  ATP6_HORSE RecName: Full=ATP synthase subunit a;AltName:
   45::221     2e-08  27%  229 aa  ATP6_GEOSL RecName: Full=ATP synthase subunit a;AltName:
   13::248     3e-08  23%  251 aa  ATP6_METS4 RecName: Full=ATP synthase subunit a;AltName:
  142::263     3e-08  29%  272 aa  ATP6_BLOFL RecName: Full=ATP synthase subunit a;AltName:
   11::246     3e-08  27%  249 aa  ATP6_AGRT5 RecName: Full=ATP synthase subunit a;AltName:
   28::221     3e-08  26%  229 aa  ATP61_PELPD RecName: Full=ATP synthase subunit a 1;AltName:
   60::222     5e-08  31%  226 aa  ATP6_MACRO RecName: Full=ATP synthase subunit a;AltName:
  173::251     5e-08  42%  253 aa  ATP6_HYPNA RecName: Full=ATP synthase subunit a;AltName:
   45::221     5e-08  26%  229 aa  ATP6_GEOMG RecName: Full=ATP synthase subunit a;AltName:
   59::222     5e-08  31%  226 aa  ATP6_BALPH RecName: Full=ATP synthase subunit a;AltName:
   66::222     6e-08  32%  226 aa  ATP6_MOUSE RecName: Full=ATP synthase subunit a;AltName:
   68::222     6e-08  32%  226 aa  ATP6_BALMU RecName: Full=ATP synthase subunit a;AltName:
  210::342     8e-08  27%  381 aa  ATP6_ANADE RecName: Full=ATP synthase subunit a;AltName:
   64::270     8e-08  33%  277 aa  ATP6_ALTMD RecName: Full=ATP synthase subunit a;AltName:
   68::225     1e-07  34%  231 aa  ATP6_LUMTE RecName: Full=ATP synthase subunit a;AltName:
   36::264     1e-07  26%  266 aa  ATP6_ARTAT RecName: Full=ATP synthase subunit a;AltName:
  213::345     1e-07  27%  384 aa  ATP6_ANASK RecName: Full=ATP synthase subunit a;AltName:
   13::222     1e-07  29%  226 aa  ATP6_CANLU RecName: Full=ATP synthase subunit a;AltName:
   13::222     1e-07  29%  226 aa  ATP6_CANFA RecName: Full=ATP synthase subunit a;AltName:
   19::229     2e-07  28%  229 aa  ATP6_STRPU RecName: Full=ATP synthase subunit a;AltName:
   53::245     2e-07  26%  248 aa  ATP6_PARDP RecName: Full=ATP synthase subunit a;AltName:
   55::249     2e-07  29%  252 aa  ATP6_RHILO RecName: Full=ATP synthase subunit a;AltName:
  221::277     2e-07  42%  285 aa  ATP6_PSEHT RecName: Full=ATP synthase subunit a;AltName:
  146::286     2e-07  31%  292 aa  ATP6_ACIAC RecName: Full=ATP synthase subunit a;AltName:
   13::222     3e-07  27%  226 aa  ATP6_DUGDU RecName: Full=ATP synthase subunit a;AltName:
   25::253     4e-07  26%  254 aa  ATP6_USTMA RecName: Full=ATP synthase subunit a;AltName:
  187::272     4e-07  43%  276 aa  ATP6_NOCSJ RecName: Full=ATP synthase subunit a;AltName:
   20::225     4e-07  26%  233 aa  ATP6_DESDG RecName: Full=ATP synthase subunit a;AltName:
   72::227     5e-07  30%  227 aa  ATP6_TETNG RecName: Full=ATP synthase subunit a;AltName:
   66::222     5e-07  32%  226 aa  ATP6_RAT RecName: Full=ATP synthase subunit a;AltName:
   68::222     5e-07  32%  226 aa  ATP6_PIG RecName: Full=ATP synthase subunit a;AltName:
   66::222     5e-07  32%  226 aa  ATP6_CRIGR RecName: Full=ATP synthase subunit a;AltName:
  162::243     7e-07  35%  249 aa  ATP6_GLUDA RecName: Full=ATP synthase subunit a;AltName:
   10::222     7e-07  30%  226 aa  ATP6_BOVIN RecName: Full=ATP synthase subunit a;AltName:
   27::215     7e-07  25%  216 aa  ATP6_AQUAE RecName: Full=ATP synthase subunit a;AltName:
  141::285     9e-07  28%  287 aa  ATP6_VEREI RecName: Full=ATP synthase subunit a;AltName:
    7::232     9e-07  30%  232 aa  ATP6_PARLI RecName: Full=ATP synthase subunit a;AltName:
   66::222     9e-07  31%  226 aa  ATP6_GORGO RecName: Full=ATP synthase subunit a;AltName:
   68::222     9e-07  32%  226 aa  ATP6_BOSMU RecName: Full=ATP synthase subunit a;AltName:
   10::222     9e-07  30%  226 aa  ATP6_BOSIN RecName: Full=ATP synthase subunit a;AltName:
   66::222     1e-06  32%  226 aa  ATP6_RABIT RecName: Full=ATP synthase subunit a;AltName:
   74::253     1e-06  27%  260 aa  ATP6_CANGA RecName: Full=ATP synthase subunit a;AltName:
   84::283     2e-06  27%  291 aa  ATP6_VICFA RecName: Full=ATP synthase subunit a;AltName:
   10::222     2e-06  28%  226 aa  ATP6_SHEEP RecName: Full=ATP synthase subunit a;AltName:
   66::222     2e-06  31%  226 aa  ATP6_HUMAN RecName: Full=ATP synthase subunit a;AltName:
   36::264     2e-06  29%  266 aa  ATP6_ARTS2 RecName: Full=ATP synthase subunit a;AltName:
   53::221     2e-06  25%  229 aa  ATP63_PELPD RecName: Full=ATP synthase subunit a 3;AltName:
   17::246     3e-06  24%  249 aa  ATP6_MESSB RecName: Full=ATP synthase subunit a;AltName:
  150::245     4e-06  37%  248 aa  ATP6_PYLLI RecName: Full=ATP synthase subunit a;AltName:
   33::244     6e-06  25%  247 aa  ATP6_NITHX RecName: Full=ATP synthase subunit a;AltName:
  181::380     7e-06  25%  386 aa  ATP6_WHEAT RecName: Full=ATP synthase subunit a;AltName:
  181::380     7e-06  25%  386 aa  ATP6_TRITI RecName: Full=ATP synthase subunit a;AltName:
   66::222     7e-06  30%  226 aa  ATP6_PANTR RecName: Full=ATP synthase subunit a;AltName:
   34::255     7e-06  25%  258 aa  ATP6_MARMM RecName: Full=ATP synthase subunit a;AltName:
   94::227     7e-06  33%  227 aa  ATP6_ANAPL RecName: Full=ATP synthase subunit a;AltName:
    9::244     9e-06  26%  247 aa  ATP6_NITWN RecName: Full=ATP synthase subunit a;AltName:
   78::277     9e-06  25%  291 aa  ATP6_MAIZE RecName: Full=ATP synthase subunit a;AltName:
   35::261     9e-06  26%  262 aa  ATP6_ERYLH RecName: Full=ATP synthase subunit a;AltName:
   20::225     9e-06  26%  233 aa  ATP6_DESVV RecName: Full=ATP synthase subunit a;AltName:
   20::225     9e-06  26%  233 aa  ATP6_DESVH RecName: Full=ATP synthase subunit a;AltName:
  184::383     2e-05  27%  395 aa  ATP6_TOBAC RecName: Full=ATP synthase subunit a;AltName:
   27::256     2e-05  23%  257 aa  ATP6_PENCH RecName: Full=ATP synthase subunit a;AltName:
   77::260     2e-05  29%  263 aa  ATP6_ASHGO RecName: Full=ATP synthase subunit a;AltName:
   66::222     3e-05  29%  226 aa  ATP6_DIDMA RecName: Full=ATP synthase subunit a;AltName:
  177::270     5e-05  34%  293 aa  ATP6_MYCPN RecName: Full=ATP synthase subunit a;AltName:
  177::263     5e-05  35%  292 aa  ATP6_MYCGE RecName: Full=ATP synthase subunit a;AltName:
   77::230     6e-05  30%  230 aa  ATP6_ASTPE RecName: Full=ATP synthase subunit a;AltName:
   58::212     8e-05  26%  212 aa  ATP6_TROMO RecName: Full=ATP synthase subunit a;AltName:
   68::254     8e-05  31%  255 aa  ATP6_TRIRU RecName: Full=ATP synthase subunit a;AltName:
   66::222     8e-05  29%  226 aa  ATP6_SPETR RecName: Full=ATP synthase subunit a;AltName:
  114::224     8e-05  36%  228 aa  ATP6_PISOC RecName: Full=ATP synthase subunit a;AltName:
   90::197     8e-05  28%  199 aa  ATP6_CAEBR RecName: Full=ATP synthase subunit a;AltName:
  154::226     1e-04  46%  229 aa  ATP6_METSE RecName: Full=ATP synthase subunit a;AltName:
   68::222     1e-04  37%  226 aa  ATP6_CAPHI RecName: Full=ATP synthase subunit a;AltName:
   67::256     2e-04  28%  257 aa  ATP6_SCHPO RecName: Full=ATP synthase subunit a;AltName:
  140::212     4e-04  38%  212 aa  ATP6_TROHI RecName: Full=ATP synthase subunit a;AltName:
  177::263     5e-04  35%  264 aa  ATP6_PODAN RecName: Full=ATP synthase subunit a;AltName:
  165::251     5e-04  35%  252 aa  ATP6_NEUCR RecName: Full=ATP synthase subunit a;AltName:
  156::223     5e-04  46%  228 aa  ATP6_MYXGL RecName: Full=ATP synthase subunit a;AltName:
  133::222     5e-04  36%  226 aa  ATP6_DINSE RecName: Full=ATP synthase subunit a;AltName:
   90::197     5e-04  28%  199 aa  ATP6_ASCSU RecName: Full=ATP synthase subunit a;AltName:
    1::238

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MEESINPIISIGPVIFNLTMLAMTLLIVGVIFVFIYWASRNMTLKPKGKQNILEYVYDFVIGFTEPNIGS
ATP6_STRP4      MEESINPIISIGPVIFNLTMLAMTLLIVGVIFVFIYWASRNMTLKPKGKQNILEYVYDFVIGFTEPNIGS
ATP6_STRZT      MEESINPIISIGPVIFNLTMLAMTLLIVGVIFVFIYWASRNMTLKPKGKQNVLEYVYDFVIGFTEPNIGS
ATP6_STRZP      MEESINPIISIGPVIFNLTMLAMTLLIVGVIFVFIYWASRNMTLKPKGKQNVLEYVYDFVIGFTEPNIGS
ATP6_STRZJ      MEESINPIISIGPVIFNLTMLAMTLLIVGVIFVFIYWASRNMTLKPKGKQNVLEYVYDFVIGFTEPNIGS
ATP6_STRR6      MEESINPIISIGPVIFNLTMLAMTLLIVGVIFVFIYWASRNMTLKPKGKQNVLEYVYDFVIGFTEPNIGS
ATP6_STRPS      MEESINPIISIGPVIFNLTMLAMTLLIVGVIFVFIYWASRNMTLKPKGKQNVLEYVYDFVIGFTEPNIGS
ATP6_STRPN      MEESINPIISIGPVIFNLTMLAMTLLIVGVIFVFIYWASRNMTLKPKGKQNVLEYVYDFVIGFTEPNIGS
ATP6_STRPJ      MEESINPIISIGPVIFNLTMLAMTLLIVGVIFVFIYWASRNMTLKPKGKQNVLEYVYDFVIGFTEPNIGS
ATP6_STRPI      MEESINPIISIGPVIFNLTMLAMTLLIVGVIFVFIYWASRNMTLKPKGKQNVLEYVYDFVIGFTEPNIGS
ATP6_STRP2      MEESINPIISIGPVIFNLTMLAMTLLIVGVIFVFIYWASRNMTLKPKGKQNVLEYVYDFVIGFTEPNIGS
ATP6_STRP7      MEESINPIISIGPVIFNLTMLAMTLLIVGVIFVFIYWASRNMTLKPKGKQNVLEYVYDFVIGFTEPNIGS
ATP6_STRSV      MEESINPTINIGPVTFDLTLLAMTLLTVFVTFGLVYWASRKMTIKPSRKQNALEYIYDFVIDFTKGNVGE
ATP6_STRGC      MEESVNPTIQLGPVTXXXXXXXXXXXXXXXXXXXXYWASRKMTLKPSGKQNALEYLYDFVIDFTKGNIGS
ATP6_STRS7      MEEAKVPMVELGPITFNLTLLAVCIVTILLIFGFVFWASRQMTLKPKGKQTALEYLISFVNGIGEEHLDS
ATP6_STREM      MEEAKVPMVELGPITFNLTLLAVCIVTILLIFGFVFWASRQMTLKPKGKQTALEYLISFVNGIGEEHLDS
ATP6_STRE4      MEEAKVPMVELGPITFNLTLLAVCIVTILLIFGFVFWASRQMTLKPKGKQTALEYLISFVNGIGEEHLDS
ATP6_STRPZ      MEEAKIPMLKLGPITFNLTLLAVCIVTIAVIFAFVFWASRQMKLKPEGKQTALEYLISFVDGIGEEHLDH
ATP6_STRPM      MEEAKIPMLKLGPITFNLTLLAVCIVTIAVIFAFVFWASRQMKLKPEGKQTALEYLISFVDGIGEEHLDH
ATP6_STRPG      MEEAKIPMLELGPITFNLTLLAVCIVTIAVIFAFVFWASRQMKLKPEGKQTALEYLISFVDGIGEEHLDH
ATP6_STRPF      MEEAKIPMLKLGPITFNLTLLAVCIVTIAVIFAFVFWASRQMKLKPEGKQTALEYLISFVDGIGEEHLDH
ATP6_STRPD      MEEAKIPMLKLGPITFNLTLLAVCIVTIAVIFAFVFWASRQMKLKPEGKQTALEYLISFVDGIGEEHLDH
ATP6_STRPC      MEEAKIPMLKLGPITFNLTLLAVCIVTIAVIFAFVFWASRQMKLKPEGKQTALEYLISFVDGIGEEHLDH
ATP6_STRPB      MEEAKIPMLKLGPITFNLTLLAVCIVTIAVIFAFVFWASRQMKLKPEGKQTALEYLISFVDGIGEEHLDH
ATP6_STRP8      MEEAKIPMLKLGPITFNLTLLAVCIVTIAVIFAFVFWASRQMKLKPEGKQTALEYLISFVDGIGEEHLDH
ATP6_STRP6      MEEAKIPMLKLGPITFNLTLLAVCIVTIAVIFAFVFWASRQMKLKPEGKQTALEYLISFVDGIGEEHLDH
ATP6_STRP3      MEEAKIPMLKLGPITFNLTLLAVCIVTIAVIFAFVFWASRQMKLKPEGKQTALEYLISFVDGIGEEHLDH
ATP6_STRP1      MEEAKIPMLKLGPITFNLTLLAVCIVTIAIVFAFVFWASRQMKLKPEGKQTALEYLISFVDGIGEEHLDH
ATP6_STRA5      MESTSNPTVSFLGIDFDLTILAMSXXXXXXXXXXVFWASRKMTIKPKGKQNVLEYVYELVNNTISQNLG-
ATP6_STRA1      MESTSNPTVSFLGIDFDLTILAMSXXXXXXXXXXVFWASRKMTIKPKGKQNVLEYVYELVNNTISQNLG-
ATP6_STRA3      MESTSNPTVSFLGIDFDLTILAMSXXXXXXXXXXVFWASRKMTIKPKGKQNVLEYVYELVNNTISQNLG-
ATP6_STRMU      MEKTINPTVKFLGIEFDLTILMMSXXXXXXXXXXXXWTSRHLKIKPTGRQNVLEWIYDFVLGIIKPNLGS
ATP6_ENTFA      -------LFNIGPIWFDGTIVLMVLLTCIIVFAFVYACTRNMKLRPKGKQTVIEWLVDFIRGIITDNLPR
ATP6_ENTHR      ----------IGPVWFDGTVCMMVLLTCLIVFFLVYFFTRNLKMKPTGKQNALEWVIDFTRGIVTDNLPR
ATP6_OCEIH      ----VHDIFGIPGANLNLSNLMMTXXXXXXXXXXXXWGSRKLQMKPKGIQNFMEWAVEFVRGIIQDNMDW
ATP6_LISMF      MEEEF-PTISLLGIDFNLSNILMITVTCVIVLLIAIICTRNLQRRPTGKQNFIEWVMDFVRGIINSNMDW
ATP6_LISMC      MEEEF-PTISLLGIDFNLSNILMITVTCVIVLLIAIICTRNLQRRPTGKQNFIEWVMDFVRGIINSNMDW
ATP6_LISIN      MEEEF-PTISLLGIDFNLSNILMITVTCVIVLLIAIICTRNLQRRPTGKQNFIEWVMDFVRGIINSNMDW
ATP6_LISMO      MEEEF-PTISLLGIDFNLSNILMITVTCVIVLLIAIICTRNLQRRPTGKQNFIEWVMDFVRGIINSNMDW
ATP6_LISW6      ------PTISLLGIDFNLSNILMITVTCVIVLLIAIICTRNLQRRPTGKQNFIEWIMDFVRGIINSNMDW
ATP6_STAAW      -------------IVFNLSSILMILVTAFLVFLLAIICTRNLKKRPTGKQNFVEWIFDFVRGIIEGNMAW
ATP6_STAAT      -------------IVFNLSSILMILVTAFLVFLLAIICTRNLKKRPTGKQNFVEWIFDFVRGIIEGNMAW
ATP6_STAAS      -------------IVFNLSSILMILVTAFLVFLLAIICTRNLKKRPTGKQNFVEWIFDFVRGIIEGNMAW
ATP6_STAAR      -------------IVFNLSSILMILVTAFLVFLLAIICTRNLKKRPTGKQNFVEWIFDFVRGIIEGNMAW
ATP6_STAAN      -------------IVFNLSSILMILVTAFLVFLLAIICTRNLKKRPTGKQNFVEWIFDFVRGIIEGNMAW
ATP6_STAAM      -------------IVFNLSSILMILVTAFLVFLLAIICTRNLKKRPTGKQNFVEWIFDFVRGIIEGNMAW
ATP6_STAAE      -------------IVFNLSSILMILVTAFLVFLLAIICTRNLKKRPTGKQNFVEWIFDFVRGIIEGNMAW
ATP6_STAAC      -------------IVFNLSSILMILVTAFLVFLLAIICTRNLKKRPTGKQNFVEWIFDFVRGIIEGNMAW
ATP6_STAAB      -------------IVFNLSSILMILVTAFLVFLLAIICTRNLKKRPTGKQNFVEWIFDFVRGIIEGNMAW
ATP6_STAA9      -------------IVFNLSSILMILVTAFLVFLLAIICTRNLKKRPTGKQNFVEWIFDFVRGIIEGNMAW
ATP6_STAA8      -------------IVFNLSSILMILVTAFLVFLLAIICTRNLKKRPTGKQNFVEWIFDFVRGIIEGNMAW
ATP6_STAA3      -------------IVFNLSSILMILVTAFLVFLLAIICTRNLKKRPTGKQNFVEWIFDFVRGIIEGNMAW
ATP6_STAA2      -------------IVFNLSSILMILVTAFLVFLLAIICTRNLKKRPTGKQNFVEWIFDFVRGIIEGNMAW
ATP6_STAA1      -------------IVFNLSSILMILVTAFLVFLLAIICTRNLKKRPTGKQNFVEWIFDFVRGIIEGNMAW
ATP6_GEOSW      ------PLYEFLGLTFNLANVLMITITSVIVFIIAVAATRNLSMKPTGMQNFLEWVVDFVKGIIKSNMDW
ATP6_PEDPA      --ESISTFQFLG-LTFNTTNLISGLVSALIVFCVVFALSRNLKLKPTGKQNILEWIVDFTNGILRDSVDE
ATP6_BACPF      MNDHKPPIEEFMGLSFNMSTVLMTTIACLIVFLITFIGTRRLSMNPSGLQNFLEWVVDFIRGIIKANMDW
ATP6_BACA2      --------IDLFGLTFNLTNILMITVASVIVLLIAILTTRTLSIRPGKAQNFMEWIVDFVRNIIGSTMDL
ATP6_BACSU      ---------------FNLTNILMITVASVIVLLIAILTTRTLSIRPGKAQNFMEWIVDFVRNIIGSTMDL
ATP6_BACME      -----SPTIEFLGLTFSQSNLLMVTVASVIVFLIAVLCTRTLAMKPSGAQNFIEWVLDFVKGLVNSNMDW
ATP6_MACCJ      -------------MIFDLSSMLMLTVTAAIVFLIAMLFTRNLSVRPHGKQNFIEWIFDFTRGIINSNMAW
ATP6_BACSK      ---------------------------------------RKLAMRPTGLQNFIEWVVDFCRGIIKANMDW
ATP6_STAES      -------------IVFNLASVLMVVITAILVFILAIVCTRNLKKRPTGKQNFIEWVFDFVRGIIESNMAW
ATP6_STAEQ      -------------IVFNLASVLMVVITAILVFILAIVCTRNLKKRPTGKQNFIEWVFDFVRGIIESNMAW
ATP6_LYSSC      ------PLLEVGFLTFNKSTVMMXXXXXXXXXXXXXXSTRSLKLKPTGMQNFMEWIMDFVKNIIKSNMDW
ATP6_GEOKA      ------PLVEFLGLTFNLSDMLMITITSLIVFIIAVAATRSLQLRPTGMQNFMEWVFDFVRGIINSTMDW
ATP6_BACST      ------PLVEFLGLTFNLSDMLMITITCLIVFIIAVAATRSLQLRPTGMQNFMEWVFDFVRGIINSTMDW
ATP6_BACP3      ------PLVEFLGLTFNLSDMLMITITCLIVFIIAVAATRSLQLRPTGMQNFMEWVFDFVRGIINSTMDW
ATP6_ANOFW      ------PLYTWFGLTFNLANVLMITVTSVIVFVIAVLATRNLAMKPTGMQNFLEWVMDFVKGIIKSNMDW
ATP6_STACT      ---------------FNLASILMVIITSLIVLVIAIACTRNLQKRPTGKQNFIEWVFDFVRGIIESNLAW
ATP6_LACF3      ---------------FNWTNLISGTIVFVITFFLLFGLSRHLQMKPTGGQNVLEWIVEFTNGIVRGQMPS
ATP6_STAS1      -------------VVFNLSSIMMLXXXXXXXXXXXXXCTRNLKKRPTGKQNFIEWVFDFVRGIIESNMAW
ATP6_LACRJ      ---------------FNTTNIVSGLIIYAIVFFTLYGMSRKIQMKPTGAQNVFEWLVDFTNGIVRSQMPA
ATP6_LACRD      ---------------FNTTNIVSGLIIYAIVFFTLYGMSRKIQMKPTGAQNVFEWLVDFTNGIVRSQMPA
ATP6_STAHJ      -----NPLVSWNDLVFNLASIMMXXXXXXXXXXXXXXCTRNLKKRPSGKQNFIEWIFDFVRSIIESNMAW
ATP6_BACCA      ------PLVEFLGLTFNLSDMLMITITCLIVFIIAVAATRSLQLRPTGMQNFMEWVFDFVRGIINSTMDW
ATP6_BACP2      ---------------FNLSNVLMXXXXXXXXXXXXXXXXXXXSIRPTKAQNFMEWIVDFVRNIIGSSMDM
ATP6_DESRM      --------------------MIMTWITMALVLLFAWACTKNQNVRSPGKQATFEVLWEFLGGQVFSNLGN
ATP6_SULDN      -----------GLISHDKTFIYMTLLAAGIALMLVKMAMSNLKVVPTGTQNVMEAYISGVLKMGTDVMGQ
ATP6_MYCLE      ----------------------------------------NSTGVPCGMQLFWEAITVQMRTQIESAIGM
ATP6_ACIC1      ---------------------------------YMRWTARSGV--PSKMQLLFEMLVSWVNRQVEESMGL
ATP6_MOOTA      -------IFHLGPIPIYSTVVN-TWIIMILLLAGIFLATRKLSFIPRGAQHVLEMFLEFFYGLLEEIIGK
ATP6_HELPY      ------------------------VLTAVLMFLISLGASRKMQMVPMGLQNVYESIISAILSVAKDIIGE
ATP6_HELPS      ------------------------VLTAVLMFLISLGASRKMQMVPMGLQNVYESIISAILSVAKDIIGE
ATP6_HELPH      ------------------------VLTAVLMFLISLGASRKMQMVPMGLQNVYESIISAILSVAKDIIGE
ATP6_HELPG      ------------------------VLTAVLMFLISLGASRKMQMVPMGLQNVYESIISAILSVAKDIIGE
ATP6_HELHP      ------------------------------------YATHKMQVVPSGIQNVFEFIISGIISFAKDIVGE
ATP62_BRASB     -------LFHIGPVAITRPVVT-TWVIMAALALVCRFVTRRLAILPDGRQALLEGIVTSVAGQIEDVI-R
ATP6_HELPJ      ------------------------VVLTAVLMFFILGASRKMQMVPMGLQNVYESIISAILSVAKDIIGE
ATP6_HELP2      ------------------------VVLTAVLMFFILGASRKMQMVPMGLQNVYESIISAILSVAKDIIGE
ATP6_HELAH      ------------------------VLTAVLMFLISLGASRKMQMVPMGLQNVYESIISAILSVAKDIIGE
ATPI_OEDCA      ----------IGDYQLHGQVLITSWIVLGGVIIFTLLANSDLKPLPVGLQNFTELVTEFIRDLAKTQIGE
ATP6_SYNS9      ----------IGDLYLHGQVFLSSWILIGILLAFVLVGTRGMKRDPIGLQNLLEFLWDFIRDLARDQIGE
ATPI_PAUCH      -------------------------VVISALLVLVITGTRKMERDPQGVQNLLEFLWDYLRDLAREQIGE
ATP6_SYNS3      -------------------------ILIGALLAFVLVGTKNLSRDPKGAQNLLEFLWDYIRDLSRDQIGE
ATP6_PROMS      ----------IGNIRLHGQVFLTSWILLGALLVFISFGTKKMENDPKGLQNLLEFLWDYIRDLARTQIGE
ATP6_PROMP      ----------IGNIRLHGQVFLTSWILLGALLVFISVGTKKMENDPKGLQNLLEFLWDYIRDLSRTQIGE
ATP6_MYCUA      ------------------------------------------TAVPGGVQLFFEAITIQMRGQVESAIGM
ATP6_MYCTU      ------------------TDTVLSTAIAGLIVIFYLRAKVTSTDVPGGVQLFFEAITIQMRNQVESAIGM
ATP6_MYCBO      ------------------TDTVLSTAIAGLIVIFYLRAKVTSTDVPGGVQLFFEAITIQMRNQVESAIGM
ATP6_PROM9      ----------IGNIRLHGQVFLTSWILLGALLVFISLGTKKMENDPKGLQNLLEFLWDYIRDLARTQIGE
ATP6_PROM5      ----------IGNIRLHGQVFLTSWILLGSLLVFISLGTKKMENDPKGLQNLLEFLWDYIRDLARTQIGE
ATP6_PROM2      ----------IGNIRLHGQVFLTSWILLGALLVFISLGTKKMENDPKGLQNLLEFLWDYIRDLARTQIGE
ATP6_PROM0      ----------IGNIRLHGQVFLTSWILLGALLVFISLGTKKMENDPKGLQNLLEFLWDYIRDLARTQIGE
ATP6_MYCMM      ------------------------------------------TAVPGGVQLFFEAITIQMRGQVESAIGM
ATPI_CHAVU      ----------IGNFEVHAQVLITSWIVIGLILGLTFLATQNLQFIPTQNQNLIEYILEFIRDLTKSQIGE
ATP6_XANP2      -------LLNFGGVQFSFTNAALFMFIVAIIFFFLTFATRGRTLVPGRAQSAAEMSYEFIAKMVRDSAGS
ATP6_ARCB4      -------------------ILSHYVLVIGIIFIIARAATRKLQLVPTGSQNVLEAFVGGIISMGADTMGE
ATPI_CHLAT      -------------------VLITSWVVMAIIIITSVIASRNLQPIPSGTQNFLEYVLEFIRDLTKTQVGE
ATP6_SYNPX      --------------------------------------TRNMQRDPLGLQNLLEFLWNFIRDIARDNIGE
ATPI_RHDSA      -------------------------LVIAALIGFALVGTKDLKQAPQGIQNFMEYVYEFLQDIAKNQIGE
ATP6_WOLPP      ----------------NSSLFMMISVILMVLFLLL--GIRKGAVIPGYLQAAVEYVYDFVVSIIESNTGS
ATPI_GUITH      -------------------------LVMLALIIFALNGTRKLNQIPSGIQNFMEYVYEFLQDIAKNQIGE
ATP6_WOLPM      -----------------------TMISVILMILFLLFGIKKGSVIPGYLQAAVEYVYDFVISIIENNTGS
ATPI_NEPOL      -------------------VLITSWFVIGFLLIGCFVASRNLQEIPEGGQNFLEYVLEFIRDLAKTQIGH
ATPI_OCHNE      ---------------------------------------------PKGVQNFLESVFEYVSGIAKDQIGE
ATPI_ANGEV      --------LQIGNFQVHAQVLITSWVVIAILLGLSIVATRDLQTIPTGSQNFIEYVLEFIRDLTRTQIGE
ATP6_SYNPW      --------------------------------------TRKMERDPKGVQNLLEYLWDYLRELAREQIGE
ATP6_SYNP1      -----------------------TWIVMGILIVAALAASRNIQRVPSGIQNLMEYALEFIRDLTKSQMGE
ATPI_SCEOB      -------------------VLLVSWFVLAVIFGLSFVGNSNLKSTPDGLQNFTEFVTEFIRDLAKTQIGE
ATP6_CHLT3      ------PKIEVGGFDISLTRHVVMMWIAAAILLLIMFGVGNQYKKPKGMANLMEVLVDFILDVAKQNIGH
ATPI_OLTVI      -------------------VLLVSWFVLAVIIGFGLTANSNLKPTPDGLQNLSEYVTEFIRDLAKTQIGE
ATP6_WOLWR      -------------------------------------------------QAAVEYVYDFVISIIENNTGS
ATP6_SYNSC      --------------------------------------TRGMKRDPIGLQNLLEFLWNFIRDIARDNIGE
ATP6_NITSB      -----------GVISENHTFLFVSHMFLAALLTLIVLATKRLQVVPTGCQNVMEAYLEGVVAMGRDVIGE
ATP6_CAMJD      --------------------------------------TRSMQLVPRGMQNLAEAFLEGVLSMGRDTMGS
ATPI_CYACA      ----------------------------------------NMQKEPRGFQNFLEYVFEFLQDISKNQIEE
ATP6_PROMO      -----------------ITVISTWFVMLFLIMVF-RWSSKNLEVVPERKQAFFETIYGFLDDLYGQLLGN
ATP6_FRASN      ----------LGPIDFYFNKWALTLFVALFVGGFLWLGFRKATLVPRGLQNFCESIYDFVDLQIAQNVIG
ATPI_STAPU      ----------IGDLRVHGQVLITSWVVIGILLTVAFLGTRKLETVPNATQNFVEYVLQFIRDLARTQIGE
ATP6_RHOE4      -------LIHAGPFELDRLMLIRLLMSVLVAAFFVI-AMRSPRLVPRGMQNAAELALDFVINIAEEILGK
ATP62_SYNP2     ------------------TWLTMALLVIGAA-----WVTKKLVVRPKLPQNFLEIVVDGIYQHIA-EVTQ
ATP6_PROMA      ----------IGKLRIHGQVFMTSWILIGALLTLVVVGTKKMERDPKGVQNLLEFLWDYIRDLARTQIGE
ATPI_PSINU      -----------------ITSWVVIVLLSGLAFV----TTRDLRTIPTGGQNFVEYVLEFIRDLTRTQIGE
ATPI_PHAVU      ----------IGGFLVHAQVLITSWVVIAILLVSAFLVIRNLQTIPAFGQNFFEYVLEFIRDVSKTQIGE
ATPI_MARPO      --------------------------------------TRNLQTIPMGGQNFVEYVLEFIRDLTRTQIGE
ATPI_MESVI      -------------------VLLVSWFVMTIIISLSIFGTRNLQTIPTGTQNFVEYVLEFIRDLAKTQIGE
ATPI_GALSU      --------------------------------------TNKMSQTPRGLQNFLEYVLEFIQDITKSQIGE
ATP6_PROM4      -------------------------LLIGALLTLVVVGTKKMERDPKGVQNLLEFLWDYIRDLARTQIGE
ATP6_MAGSA      ----IQPLVKVGSVDISFTSSAMMVLSICLITLFLTLSVRSRALVPGRWQSMAEVFYEFIAGMLRDNVGQ
ATP6_ANAMM      ---------------FTNCSLVMVLASVSSILL-LCWALRKINVVPGPSQTAVELIYGFVANTLESNAGA
ATP61_PROA2     ---------------YGVVKLNQTIVMTWVIMVFLAGGSAFLTIRISRWQSFLEMIVTMAMQQIR-EIGL
ATP6_SULNB      -------------------------------------ATKSFRAVPNGTQNVMEAYLGGVVAMGKDVIGE
ATP6_BARQU      --------ISVGNMDLSFTNVSFFIIATVVATVFLFISSSSRGLVPTRMQSISEIAYEFVASTLRESCGV
ATPI_STIHE      -------------------VLLTSWFVLGTVILFGLIANKDLKPLPEGLQNFSELVTEFIRDLAKTQVGE
ATP6_SYNR3      --------------------------------------TRKMERDPRGVQNLLEFLWDYLRDLARDQIGE
ATP6_RICTY      ------------------------LLASTLALTYFYLAFYNRKLIPSRLQVSAEIVYNFVVDMLNQNIGI
ATP6_CAMHC      ------------------------LLVVAITMFIAVAVTKSMRLVPRGLQNIIEAYLSGVIALGKDAMGS
ATPI_CHAGL      --------------------------------------TRKLETIPNTTQNFIEYVLEFIRDLTRTQIGE
ATP6_TRIEI      -------------------------------------SSLNVQRIPSGMQNFMESVLEFIRSLTKDQIGE
ATP6_THEEB      --------------VFITTWFVMALLIA-VAFV----ASRNIQRVPSGIQNLMEYALEFIRDLTKSQMGE
ATP6_SYNFM      -------------------------------------AAKGLEMVPKGAQNFFEVVITGIEDFMISITGE
ATP6_HAEIN      -------------------------ILAAVIFLFVFSGKKATTGVPGKMQCLVEIVVEWVNGIVKENFGP
ATP6_HAEIG      -------------------------ILAAVIFLFVFSGKKATTGVPGKMQCLVEIVVEWVNGIVKENFGP
ATP6_HAEIE      -------------------------ILAAVIFLFVFSGKKATTGVPGKMQCLVEIVVEWVNGIVKENFGP
ATP6_HAEI8      -------------------------ILAAVIFLFVFSGKKATTGVPGKMQCLVEIVVEWVNGIVKENFGP
ATP62_CHLTE     ---------------------------------------------PKGVANVFESLVDFISNVAKPNIGH
ATPI_CITSI      ----------IGGFQVHAQVLITSWVVIAILLGSAFIAVRNPQTVPTATQNFFEYVLEFIRDVSKTQIGE
ATP6_HAEDU      -------------------------LVAGVLFLVVFSVAKNATTGVPGKQCLVEMVVEWVDGLVKDNFGP
ATP6_DESMR      ---------------------AMVLLIIGTL------ATRKLAMVPSGLQNFFEVVVGGLESFVVENIGE
ATP6_ACTPJ      -------------------------LLAGVIFLFVFSVAKNATSGVPGKQCFVEIVIGWVDGLVKDNFGP
ATP6_ACTP7      -------------------------LLAGVIFLFVFSVAKNATSGVPGKQCFVEIVIGWVDGLVKDNFGP
ATP6_ACTP2      -------------------------LLAGVIFLFVFSVAKNATSGVPGKQCFVEIVIGWVDGLVKDNFGP
ATP6_PSEE4      -------------------------LAMGLLFIWLFRAKRATTGVPGGLQNFVEVLVQFVDSSVKDTFHG
ATP6_EHRCR      ----------------SLFMVLSTL----IISLFCYIGLRKENILPNSMQLIIEAIYNFIVSTIESNVGR
ATP6_DESPS      --------------------MTYTWLVMAFLFLVSKFTLGNLEIIPGKGQNFWEMIIGGMDDFFADNMGR
ATPI_PHYPA      --------------------------------------TRDLQTIPTSGQNFVEYVLEFIRDLTRTQIGE
ATPI_CRYJA      ----------IGGFQVHAQVLITSWIVIAVLLGSATLAVRDPQIIPNGAQNFLEYVLEFVRDLARTQIGE
ATPI_BIGNA      --------------------LMTSWFVISLIMIIAFLSNLNMKKIPLAKQNLAEFVTEFILDLARTQVGK
ATP6_CHLPB      ------PKIVIGGFDLSITVVFMWLAALILLLVFGYVGNKYKSIKPGGVANAMEALVEFILDVAKSNIGE
ATPI_MANES      ----------IGGFQVHAQVLITSWVVIAILLGSAIVAVRNPQTIPTGGQNFFEYVLEFIRDVSKTQIGE
ATPI_JASNU      -------------------VLITSWVVIAILLGSATLAVRNPQTIPTGGQNFFEYVLEFIRDMSKTQIGE
ATPI_DIOEL      ----------IGALQIHAQVLITSWVVIAILLGSVIIAVRNPQTIPSGGQNFFEYVLEFIRDLSKAQIGE
ATPI_CYCTA      ----------IGGFKVHAQVLITSWVVIAVLLGSATIAVRDPQTIPTGGQNFVEYVLGFVRDLTRTQIGE
ATP6_RUBXD      -----------------------------ITFLFMYVGARTLRDRPGAYQVLVEELFRFGRDMFGGQINE
ATP6_RHOFD      -------------------------------------------LKRSRWQNLLEIVVTAIEKQIE-EVGL
ATP6_ANAVT      --------------------------VIGVLVLASVAASSNVKRIPSGIQNLLEYALEFIRDLAKNQIGE
ATP6_ANASP      --------------------------VIGVLVLASVAASSNVKRIPSGIQNLLEYALEFIRDLAKNQIGE
ATPI_CHLVU      -------------------VLITSWIVVAVIGVICLLGTQNLATAPKGLQNLTEYITEFIRDLAKTQIGE
ATPI_ADICA      ----------IGNFQVHAQVLITSWVVVAILVALPATTTGNLQSIPTGTQNFIEYVLEFIRDLTRTQMGE
ATPI_PEA        ----------IGDFQVHAQVLITSWVVIAILLISTILVVRNPQTIPTSGQNFFEYVLEFIRDVSKTQIGE
ATPI_OSTTA      ---------SLGGFQMHGQVLINSWIVLGLIIAFAVTTTRDLKPVPEGGQNLAEFVVEYIRDIAKTQVGH
ATPI_CICAR      ----------IGDFQVHAQVLITSWVVIAILLISTILVVRNPQTIPTSGQNFFEYVLEFIRDVSKTQIGE
ATP6_HALHL      ---------------------------LGALFCYVFWAARQATPGPGGLQNFVEAMIEFIDKTVKETFHA
ATP6_GLOVI      -----------------ITTWVVMLLLIGLTFI----GTRKLQRVPSGLQNFLEYAYDLLASIARNQIGE
ATP6_CAMJR      --------------------------------------TRSMQLVPRGMQNLGEAFLEGVLSMGRDTMGS
ATP6_CAMJJ      --------------------------------------TRSMQLVPRGMQNLGEAFLEGVLSMGRDTMGS
ATP6_ACTSZ      -------------------------IVSALIFLFVF---RNVAKKPGKLQCMVEIVVEWINGIVKENFGP
ATPI_EUGGR      ----------------------IVILIIGFLSIY---TTKNLTLVPANKQIFIELVTEFITDISKTQIGE
ATP6_WOLSU      -------------------------------------ATRSLQVVPGALQNVFEALLDGILMMARDVIGE
ATP6_RICCN      ----------------SFTNSSIYMLLASILLTYFYLAFYNRKLVPSRLQVSAEIVYNLVADMLNQNIGV
ATP6_PSEMY      -------------------------LFMGLIFITLFRAKKAVTGVPSGLQNMAEMCIEFVQGIVKDTFHG
ATP6_PROMM      --------------------------------------TRKMERDPHGVQNLLEFLWDYIRDLARTQIGE
ATP6_PROM3      --------------------------------------TRKMERDPHGVQNLLEFLWDYIRDLARTQIGE
ATPI_PHAAO      ----------IGGLQIHAQVLITSWVVIAILLGSVIIAVRNPQTIPTNGQNFFEYVLEFIQDLSKTQIGE
ATPI_HELAN      -------------------VLITSWVVIAILLGSAALAVRNPQTIPTGGQNFFEYVLEFIRDVSKTQIGE
ATPI_CHLRE      -------------------VLITSWVVLGILAVLSFLGNTNLKSTPDGFQNFTELVTEFIRDLAKTQIGE
ATP6_RICPU      ----------------SFTNSSIYMLLASILLTYFYLAFYNRKLVPSRLQVSAEIVYNLVADMLNQNIGV
ATP6_NITMU      ----------------------------------------------------------------------
ATP6_CAMFF      --------------------------------------TRSMQLVPRGSQNLLEAYLEGIVSMGRDVMGS
ATPI_LEMMI      ----------IGGLQVHAQVLITSWVVIAILLGSVTLAVRNPQTIPADGQNFFEYLLEFIRDLSKTQIGE
ATPI_GOSBA      -------------------VLITSWVVIAILLGSAVIAVRNPQTIPTAGQNFFEYVLEFIRDVSKTQIGE
ATPI_EUCGG      -------------------VLITSWVVIAILLGSASIAVRNPQTIPNDSQNFFEYVLEFIRDVSKTQIGE
ATPI_ANTFO      --------------------------------------TQNLQTIPTSGQNFVEYILEFIRDLTRTQIGE
ATP6_RICM5      ----------------SFTNSSIYMLLASILLTYFYLAFYNRKLVPSRLQVSAEIVYNLVADMLNQNIGV
ATP6_RICFE      ----------------SFTNSSIYMLLASILLTYFYLAFYNRKLVPSRLQVSAEIVYNLVADMLNQNIGV
ATP6_COXBU      ----------------NLDTLIISVVLGALFILIFYIVARRATASVPGKQNAIEMAVEAVDGTVKDSFGD
ATP6_COXBR      ----------------NLDTLIISVVLGALFILIFYIVARRATASVPGKQNAIEMAVEAVDGTVKDSFGD
ATP6_COXB1      ----------------NLDTLIISVVLGALFILIFYIVARRATASVPGKQNAIEMAVEAVDGTVKDSFGD
ATP6_CAMJE      --------------------------------------TRSMQLVPRGMQNLGEAFLEGVLSMGRDTMGS
ATP6_CAMJ8      --------------------------------------TRSMQLVPRGMQNLGEAFLEGVLSMGRDTMGS
ATP6_BUCAP      -------VLNIDSIIFSL--------VLGCFFLSIFYAKKITTGVPNGLQASIELIFDFI----RSNVKS
ATP62_PELLD     ----------------HVVMLWIVSAILLVLFSFVGAAYRKITPKPSGVANTMEALVEFILDVAKSNIGH
ATPI_COFAR      -------------------VLITSWVVIAILLGSAAIAVRDPQTIPTGGQNFFEYVLEFIRDVSKTQIGE
ATPI_CARPA      ----------IGGLQVHAQVLITSWVVIAILLGSAIIAVRNPQTIPTAGQNFFEYVLEFIRDVSKTQIGE
ATP6_PSEAE      ---------------FHVDTLGWSVLL-GVVFLFIFRAKKATSGQPGGLQNFVEVMVEFVDTSVKPLIAP
ATP6_PSEAB      ---------------FHVDTLGWSVLL-GVVFLFIFRAKKATSGQPGGLQNFVEVMVEFVDTSVKPLIAP
ATP6_PSEA8      ---------------FHVDTLGWSVLL-GVVFLFIFRAKKATSGQPGGLQNFVEVMVEFVDTSVKPLIAP
ATP6_PSEA7      ---------------FHVDTLGWSVLL-GVVFLFIFRAKKATSGQPGGLQNFVEVMVEFVDTSVKPLIAP
ATP6_COXB2      ----------------NLDTLIISVVLGALFILIFYIIARRATASVPGKQNAIEMAVEAVDGTVKDSFGD
ATP62_PELCD     ------------------TWLVMAILIVGLL------ATHRAGLVPGGMQNFMELVLVEIRGMVRDTMGP
ATPI_SPIOL      -------------------VLITSWVVIAILLGSAAIAVRSPQTIPTGGQNFFEYVLEFIRDVSKTQIGE
ATPI_CALFG      ----------IGGFQVHAQVLITSWVVIAILLGSAAIAVRNPQTIPTDGQNFFEYVLEFIRDLTKTQIGE
ATPI_PORYE      ----------IGSLQLHGQVFIVSWLVIATLLTLSFLGTRNLQRIPEKFQNFMEFILEFLQDIAKNQIGE
ATP6_PSYA2      ---------------------------LGIVFCAIFWVARKVTSGVPGK---LQAAVEMIIEFVDNNVRD
ATP6_PROMT      --------------------------------------TKKMERDPRGVQNLLEFLWDYIRDLARTQIGE
ATP6_PROM1      --------------------------------------TKKMERDPRGVQNLLEFLWDYIRDLARTQIGE
ATPI_PORPU      ----------IGSLQLHGQVFIVSWLVIAALLTISFLGTRNLQRIPEKFQNFMEFILEFLQDIAKNQIGE
ATPI_OENPA      -------------------VLITSWVVIAILLGSASIAVRNPQTIPNDSQNFFEYILEFIRDVSKTQIGE
ATPI_OENGL      -------------------VLITSWVVIAILLGSASIAVRNPQTIPNDSQNFFEYILEFIRDVSKTQIGE
ATPI_OENEH      -------------------VLITSWVVIAILLGSASIAVRNPQTIPNDSQNFFEYILEFIRDVSKTQIGE
ATPI_OENBI      -------------------VLITSWVVIAILLGSASIAVRNPQTIPNDSQNFFEYILEFIRDVSKTQIGE
ATPI_OENAR      -------------------VLITSWVVIAILLGSASIAVRNPQTIPNDSQNFFEYILEFIRDVSKTQIGE
ATPI_NUPAD      ----------IGGFQVHAQVLITSWVVIAILLGSAAIAVRNPQTIPTDGQNFFEYVLEFIRDVSKTQIGE
ATPI_LEPVR      ----------IGGFQVHAQVLITSWVVIAILLGSAVLAIRNPQTIPTDGQNFFEFVLEFIRDVSQTQIGE
ATPI_LACSA      -------------------VLITSWVVIAILLASATLAVRNPQTIPTSGQNFFEYVLEFIRDVSKTQIGE
ATPI_DRANE      ----------IGGFQVHAQVLITSWVVIAILLGSAVLAVRNPQTIPTDGQNFFEFVLEFIRDVSQTQIGE
ATPI_CUCSA      ----------IGGFQVHAQVLITSWVVIAILLGSAIIAVRNPQTIPTDGQNFFEYVLEFIRDVSKTQIGE
ATP6_SHEFN      ---------------------------LGMLFLWLFYAGKKATTGVPGKQCFVEIIVEFVDSSVKPVIAP
ATP6_RICRS      ----------------SFTNSSIYMLLASILLTYFYLAFYKRKLVPSRLQVSAEIVYNLVADMLNQNIGV
ATP6_RICRO      ----------------SFTNSSIYMLLASILLTYFYLAFYKRKLVPSRLQVSAEIVYNLVADMLNQNIGV
ATP6_ELUMP      -----------GVIPLSSNLITLFCITIGVFILFTLIAKRRPVLLMTAIEGLVVFIRDEIV---VANFGE
ATP6_COXBN      ----------------NLDTLIISVVLGALFILIFYIVARRATASVPGKQNAIEMAVEAADGTVKDSFGD
ATP6_CLOAB      --------MKLGSYNFAITTVVLQWIIMAVIILLAIFLTKNLKKVPNRKQSVIEMIVNLINGLVKENMGE
ATPI_VITVI      ----------IGGFQVHAQVLITSWVVIAILLGSATLAVRNPQTIPTDGQNFFEYVLEFIRDVSKTQIGE
ATPI_PELHO      -------------------VLITSWVVIAILLGSSILAVRNPQTIPTDVQNFFEYVLEFIRDVSKTQIGE
ATPI_NASOF      ----------IGGFQVHAQVLITSWVVIAILLGSAVLAIRNPQTIPTDGQNFFEFVLEFIRDVSKTQIGE
ATPI_LOBMA      ----------IGGFQVHAQVLITSWVVIAILLGSAVLAVRNPQTIPTDGQNFFEFVLEFIRDVSKTQIGE
ATPI_GOSHI      -------------------VLITSWVVIAILLGSAVIAVRNPQTIPTAGQNFFEYVLEFIRDVSKTQIGE
ATPI_DAUCA      -------------------VLITSWVVIAILLGSATLAVRNPQTIPTSGQNFFEYVLEFIRDVSKTQIGE
ATPI_CRUWA      ----------IGGFQVHAQVLITSWVVIAILLGSAVLAIRNPQTIPTDGQNFFEFVLEFIRDVSKTQIGE
ATPI_BARVE      ----------IGGFQVHAQVLITSWVVIAILLGSAVIAIRNPQTIPTDGQNFFEFVLEFIRDVSQTQIGE
ATPI_ARATH      ----------IGGFQVHAQVLITSWVVIAILLGSAVLAIRNPQTIPTDGQNFFEFVLEFIRDVSKTQIGE
ATPI_OLIPU      ----------IGGFQVHAQVLITSWVVIAILLGSSVLAIRNPQTIPTDGQNFFEFVLEFIRDVSKTQIGE
ATPI_BUXMI      ----------IGGFQVHAQVLITSWVVIAILLGSATIAVRNPQTIPTDGQNFFEYVLEFIRDLSKTQIGE
ATPI_ACOCL      ----------IGGFQVHAQVLITSWVVIAILLGSVTVAVRNPQTIPTNGQNFFEYVLEFIRDLSKTQIGE
ATPI_ACOAM      ----------IGGFQVHAQVLITSWVVIAILLGSVTVAVRNPQTIPTNGQNFFEYVLEFIRDLSKTQIGE
ATP6_YERE8      --ELVNPH-SPGPATFNIDSLFFSV-VLGLAFLFVFRVAAGATSGVPGK---LQTAVELIIGFVDNSVRD
ATP6_THIDA      ---------------------------------------------PTGLQNFVEWVIEFI----DTSVRG
ATP6_ANAPZ      ----------------------------------------------------VELIYNFVVGAIESNAGV
ATPI_SOYBN      ---------------------------------------RNLQTIPAFGQNFFEYVLEFIRDVSKTQIGE
ATPI_POPTR      -----------------ITSWVVIVILLGSAIVTV----RNPQTIPTDGQNFFEYILEFIRDVSKTQIGE
ATPI_POPAL      -----------------ITSWVVIVILLGSAIVTV----RNPQTIPTDGQNFFEYILEFIRDVSKTQIGE
ATPI_PANGI      -------------------VLITSWVVIAILLGSATIAVRNPQTIPTGGQNFFEYVLEFIRDVSKTQIGE
ATPI_LOTJA      -------------------VLITSWVVIAILLGSTILVVRNPQTIPNFGQNFFEYVLEFIRDVSKTQIGE
ATPI_GUIAB      -------------------VLITSWVVIAILLGSATLAVRNPQTIPTGGQNFFEYVLEFIRDVSKTQIGE
ATPI_AMBTC      ----------IGGFQVHAQVLITSWVVIAILLGSATIVVRNPQTIPTDGQNFFEYVLEFIRDLTKTQIGE
ATP6_PASMU      -------------------------IISGAIFLFVFSAKKATPGVPSKMQCFVEIMVDWIDGIVKENFGP
ATP6_MARAV      --------------------IAMGILFLGL---FRFVANRVTEGTPSGLQNLIEMTFEFVQGIVRDVFHG
ATP6_MANSM      -------------------------VLAAIIFLAVFRSAKKATSGVPGKQCMVEILVEWINGIVKENFGP
ATP6_DICNV      -------------------------ILLGCSFCWLFYSKKAESGVPGFAQNVAEMVFDFIFGESRSDIGS
ATP62_OCHA4     ---AIKPIVELGPVAFTNSALFMVLTVLGAA-AFMFLSSRRGTVVPGRWQSSAEILYEFVSKTLRENAGE
ATPI_TRACE      -------------------VLITSWVVIAILLGSAALAVRKPQTIPTGIQNFFEYVLEFIRDVSKTQIGE
ATPI_PINKO      -------------------VLITSWIVIAVLLGSATIAVRDPQTIPTGGQNFVEYILEFFRDLTRTQIGE
ATPI_MORIN      ----------IGGFQVHAQVLITSWVVIAILLGSSIIAVRNPQTIPTDGQNFFEYVLEFIRDVSRTQIGE
ATPI_FAGEA      ---------------------------------------RNPQTIPTDGQNFFEYVLEFIRDVSKTQIGE
ATPI_AETCO      ----------IGGFQVHAQVLITSWVVIAILLGSAVLVVRNPQTIPTDGQNFFEFVLEFIRDVSQTQIGE
ATP6_STRLI      ---------------FNKPMLLA--LLGSIVIVGFFWAARKPKVVPGKLQMVAEAGYDFIRGVVYETIGK
ATP6_SERP5      -------------------------VVLGALFLFIFKKVANTATS--GVPGKLQTAVELIMGFVDSSVRD
ATP6_RICPR      ----------------------------------------NRKLIPSRLQVSAEIVYNLVADMLNQNIGI
ATP6_PSYWF      ---------------------------LGIVFCALFWVAKKATAGVPGK---LQAAIEMIVEFVDTNVRD
ATPI_PINTH      -------------------VLLTSWVVIAVLLGSATIAVRDPQTIPTGGQNFVEYILEFFRDLTRTQIGE
ATPI_AETGR      ----------IGGFQVHAQVLITSWVVIAILLGSAVLVVRNPQTIPTDGQNFFEFVLEFIRDVSKTQIGE
ATP6_ACIBL      --------------------------------------------KPGVLQHIAEGMNNFVSNQGEEMIGH
ATPI_SOLLC      -------------------VLITSWVVIAILLGSATIAVRNPQTIPTGGQNFFEYVLEFIRDVSKTQIGE
ATPI_PIPCE      -------------------VLITSWVVIAILLGSVTIAVRNPQTIPTNSQNFFEYVLEFIRDLSKTQIGE
ATP6_SYNJA      --------------------------------------TRQLQREPAGLQNFIEYTLEFVQSIARAQIGE
ATP6_MARMS      -------------------------IALGFLFLWLFRAKKISADTPSGLQNFVELMVEFVDGSVKETFHG
ATP6_DICDI      --------ISITTITVYLGLLMV--IVIGMYKVSLYKAT---IIGGNNWQHIGEMIYEFVVDLIIEQVGK
ATP6_BARBK      ---------------------------------------------PTRMQSISEMAYEFVASTLRESAGV
ATP6_ALHEH      -----NLAVGEGYWTFHVDSLIMSFSL-GALFCYLFWARRATAGVPSGLQNFVELMVEFVDQTTRETFQS
ATPI_NYMAL      ----------IGGFQVHAQVLITSWVVIAILLGSAAIAVRNPQTIPTDGQNFFEYVLEFIRDVSKTQIGE
ATPI_ILLOL      ----------IGGFQVHAQVLITSWVVIAILLGSAAIAVRNPQTIPTDGQNFFEYVLEFIRDLSKTQIGE
ATP6_SYMTH      ----------------NNMIITQWLIVAGLLALAFVINRAVLSGRPSKLRGSLELLIDFLEGWFASFIGS
ATP6_PSYCK      ---------------------------LGIVFCAIFWVARKVTSGVPGKT---QAAVEMIVEFVDNNVRD
ATP6_PSEU5      -------------------------LLMGAIFILLFRAAKAATAGVPGKQNLVEMCVEFVEGVVKDTFHG
ATP6_NOSP7      --------------------------VISILVVASIAATRNAQRIPKGIQNLMEYALEFIRDLAKNQLGE
ATP6_MYXXD      ------------------------------------WGNRDKTLVPRGAANILEMLVLFVRDLAIKNIGK
ATP6_DICCI      ----------------------LMVIVIGMYKVSLYKAT---LIGNNNWQHIGEMIYEFVVDLILEQVGK
ATP61_SYNP2     -------------------VLMTSWFVIAVLVLASILATRNVQRVPGGFQNFMEYALEFIRDLAKNQLGE
ATPI_PSEAK      ----------IGEYSVHGQVLMTSWFVFAVIAILSIAGNRDLKAIPEGLQNLTEYITEFIRDLAKTQIGE
ATPI_LIRTU      ----------IGGFQVHAQVLITSWVVIAILLGSATIAVRNPQTIPTDGQNFFEYVLEFIRDLSKTQIGE
ATPI_TOBAC      -------------------VLITSWVVIAILLGSATIAVRNPQTIPTGGQNFFEYVLEFIRDVSKTQIGE
ATPI_SOLTU      -------------------VLITSWVVIAILLGSATIAVRNPQTIPTGGQNFFEYVLEFIRDVSKTQIGE
ATPI_SOLBU      -------------------VLITSWVVIAILLGSATIAVRNPQTIPTGGQNFFEYVLEFIRDVSKTQIGE
ATPI_RANMC      ----------IGGFQVHAQVLITSWFVIAILLGSAIIAVRNPQTIPTDGQNFFEYVLEFIRDLSKTQIGE
ATPI_PLAOC      ----------IGGFQVHAQVLITSWVVIAILLGSATVAVRNPQTIPTDGQNFFEYVLEFIRDLSKTQIGE
ATPI_NICTO      -------------------VLITSWVVIAILLGSATIAVRNPQTIPTGGQNFFEYVLEFIRDVSKTQIGE
ATPI_NICSY      -------------------VLITSWVVIAILLGSATIAVRNPQTIPTGGQNFFEYVLEFIRDVSKTQIGE
ATPI_LOLPR      ----------IGSFQIHAQVLITSWVVITILLGSVVIAVRNPQTVPMDGQNFFEYVLEFIRDLSKTQIGE
ATPI_CHLSC      ----------IGGFQVHAQVLITSWVVIAILLGSATIAVRNPQTIPTDGQNFFEYVLEFIRDLSKTQIGE
ATPI_ATRBE      -------------------VLITSWVVIAILLGSATIAVRNPQTIPTGGQNFFEYVLEFIRDVSKTQIGE
ATP6_PSEPW      ---------------FHLDTLGWSVAL-GLIFLFIFRAKKATSGQPGGLQNFVEVMVDFVNGSVKDSFHG
ATP6_PSEPG      ---------------FHLDTLGWSVAL-GLIFLFIFRAKKATSGQPGGLQNFVEVMVDFVNGSVKDSFHG
ATP6_WOLTR      -------------------------------------------------QAAVEYVYDFITSIIESNTGS
ATP6_RHORU      ---AIKPLVSIQDVSFTNSSLLM-LLTVGLAAAFFWNATARRTLIPGRLQSAAEMLYEFVANMIRDNVGK
ATP6_RHORT      ---AIKPLVSIQDVSFTNSSLLM-LLTVGLAAAFFWNATARRTLIPGRLQSAAEMLYEFVANMIRDNVGK
ATP6_RHIEC      --------IEIGGIDFSFTNASLFMXXXXXXXXFLYFSTSNRAIVPGRSQSVAEMSYEFIANMLKEGAGK
ATP6_EDWI9      -------------------------VVLGLIFLALFRVAKNATSGVPGK---FQTAVELIIGFVDGSVRD
ATP6_BUCBP      --------------VCNFDSIFLSIFLGLVILISFFKISKTFTIQTPNK---IQICIELIIDFINNNVKE
ATPI_WHEAT      ----------IGGFQIHAQVLITSWVVITILLGSVVIAVRNPQTIPTDGQNFFEYVLEFIRDLSKTQIGE
ATPI_SACOF      ----------IGGFQIHAQVLITSWVVITILLGSVIIAVRNPQTIPTDGQNFFEYVLEFIRDLSKTQIGE
ATPI_SACHY      ----------IGGFQIHAQVLITSWVVITILLGSVIIAVRNPQTIPTDGQNFFEYVLEFIRDLSKTQIGE
ATPI_MAIZE      ----------IGGFQIHAQVLITSWVVITILLGSVIIAVRNPQTIPTDGQNFFEYVLEFIRDLSKTQIGE
ATPI_HORVU      ----------IGGFQIHAQVLITSWVVITILLGSVVIAVRNPQTIPTDGQNFFEYVLEFIRDLSKTQIGE
ATPI_DRIGR      ----------IGGFQVHAQVLITSWVVIAILLGSATIAVRNPQTIPTKSQNFFEYVLEFIRDLSKTQIGE
ATPI_AGRST      ----------IGGFQIHAQVLITSWVVITILLGSVVIAVRNPQTIPTDGQNFFEYVLEFIRDLSKTQIGE
ATP6_SYNJB      --------------------------------------TRQLQREPAGLQNFVEYALEFVQSIARAQIGE
ATP62_VIBHB     --------LTAGDGWFGINLDSMIMVLTGLVFIFRYAVTKGTKGVPGRFQCLIEIIFEFVDDIVK-EIFQ
ATP61_CYAA5     --------------------LVMLILVLGSWLI-----TRNLSIEPPLSRWQVALXXXXXXXXXXXXDAS
ATPI_SORBI      ----------IGGFQIHAQVLITSWFVITILLGSVIIAVRNPQTIPTDGQNFFEYVLEFIRDLSKTQIGE
ATPI_CUSEX      ----------IGDFLVHGQVLITSWVVIAILLGSATVAVRNPQTIPTGGQNFFEYVLEFIRDVSKTQIGE
ATPI_BRADI      ----------IGGFQIHAQVLITSWVVITILLGSVLIAVRNPQTIPTDGQNFFEYILEFIRDLSKTQIGE
ATP6_SINMW      ----VNKIVSIGGIDFSFTNASLFMVAVGAAAGFLYLTTSQRGLIPTRMQSVSEMSYEFIASMLREGAGS
ATP6_HAEPS      -------------------------LVAGATFLFFFSVAKNATDGVPGKQCFVEMIVEWVDGLVKDNFGS
ATP62_CYAA5     --------------------------------------TRNIQRVPSGMQNFMEYVLEFLRDLARTQLGE
ATPI_ORYSJ      ----------IGGFQIHAQVLITSWVVITILLGSVIIAVRNPQTIPTDGQNFFEYVLEFIRDLSKTQIGE
ATPI_ORYSI      ----------IGGFQIHAQVLITSWVVITILLGSVIIAVRNPQTIPTDGQNFFEYVLEFIRDLSKTQIGE
ATPI_ORYSA      ----------IGGFQIHAQVLITSWVVITILLGSVIIAVRNPQTIPTDGQNFFEYVLEFIRDLSKTQIGE
ATPI_CUSRE      ----------IGDFLVHGQVLITSWVVIAILLGSATVAVRNPQTIPTVGQNLFEYVLEFIRDVSKTQIGE
ATP6_RHOPS      ---------------------AYMFLSVGVISLLMIGGMAGRQLVPGRIQSVAELSYEFVAGIIRSTAGK
ATP6_HAES2      -------------------------------------ASKATSGVPGKFQCLVEMLVEWVDGVVKDNIGS
ATP6_CHLPD      --EIVLPKIVVGGFDISITKHVVTLWVVSVLIVFTIIGSKYKTMSPKGFVNAMEALVEFILDVAKANIGP
ATP6_ACIAD      ---------------------------LGIIFCLVFWCAAKAAKAPSKFQSAIEMIIEFVDSSVRDTFHG
ATP62_PHOPR     --------LTLGKGFWSINIDSMIMVMVGLLFVFRYVAIRGTKGVPGRLQCFIEITFDFVNNLVK-EIFK
ATP61_ACAM1     -------------------------------------ATRKVERIPSGLQNFMEYALEFVRDLTKNQIGE
ATP6_PECCP      --------LQVGTGFWSINVDSMFFSILGILFLVIFHVAKRATSGVPGK---LQTAVELIIGFVDGTVRD
ATP6_HAES1      -------------------------------------ASKATSGVPGKFQCLVEMLVEWVDGVVKDNIGS
ATP62_ACAM1     --------------------LIFTWLVMGVLVVGSWFVTRHLSASTQISQNLLEVI---VLGIRDQEIID
ATPI_ORYNI      ----------IGGFQIHAQVLITSWVVITILLGSVIIAVRNPQTIPTDGQNFFEYVLEFIRDLSKTQIGE
ATPI_NANDO      ----------IGGFQVHAQVLITSWVVMAILLGSATIVVRNPQTIPTDGQNFFEYVLEFIRDLSKTQIGE
ATPI_ANTSP      --------------VFIVSWLVMIVLISLAIA-----GTRNLTRTPQKFQNFMEFILEFLQDIAKNQIGE
ATP6_SULSY      -------------------IMALTVLIVVPVIFTIF--AKKPSLIPTPIQNVFEIYIEFIDNLIKENMGE
ATP6_PSEPK      ---------------FHLDTLGWSVAL-GLIFLLIFRAKKATSGQPGGLQNFVEVMVDFVNGSVKDSFHG
ATP6_PSEP1      ---------------FHLDTLGWSVAL-GLIFLLIFRAKKATSGQPGGLQNFVEVMVDFVNGSVKDSFHG
ATP6_ERWCT      --------LQVGTGFWSINVDSMFFSILGILFLVIFHVAKRATSGVPGK---LQTAVELLIGFVDGTVRD
ATP6_SYNP6      --------------------------------------NRNLQRIPSGLQNFMEYVLDFIRNLARTQIGE
ATP6_SYNE7      --------------------------------------NRNLQRIPSGLQNFMEYVLDFIRNLARTQIGE
ATP6_RHOPB      ---------------------AYMLVAVAVISLLMIGGVAGRQMVPGRIQSLAEISYEFVAGTIRSTAGV
ATP6_AZOC5      --------------------------IVALIFFFLTYATRGRTLVPGRMQSVAEMGYEFIAKMVRESAGT
ATP61_HAHCH     --------LHIGPLEIHETVVT-TWLIMLVLVVASILLTRRLSLQPGRLQAMLEGVV-LTLESAIANADS
ATP61_CHLP8     -----------------VTTWAVMLLLAGGSWLITRRLSTGITISRW--QSVLEIIVTMAIG----EVGL
ATPI_WELMI      ---------------------------------------------PTGQQNFAEYLLEFIRDLARTQIGE
ATPI_IPOPU      -------------------VLITSWVVIAILLGSATIAVRNPQTIPTGGQNFFEYVLEFIRDVSKTQIGE
ATPI_ARAHI      ----------IGGFQVHAQVLITSWVVIAILLGSAVLAVRNPQTIPTDGQNFFEFVLEFIRDVSQTQIGE
ATP6_SHEDO      ---------------------------------------------PGKLQCLIEMIVEFVDASVKPVIAP
ATP6_RHISN      --------IEIGGIDFSFTNASLFMVAVGVAAGFLYLTTSQRGVIPTRMQSVSEVSYEFIASMLREGAGS
ATP6_RHIME      --------LEIGGIDFSFTNASLFMVAVGAAAGFLYLTTSQRGLIPTRMQSVSEMSYEFIASMLREGAGS
ATP6_IDILO      ----------------------------------------------------------------------
ATP6_ALISL      -------------------------VLTGMLFLWVFRSAKKATTGVPGK---LQCFVEMVVEFVADNVKE
ATPI_CAPBU      ----------IGGFQVHAQVLITSWVVIAILLGSAVLAIRNPQTIPTDGQNFFEFVLEFIRDVSKTQIGE
ATP6_ERWT9      ----------------------------------------------------LQAAIELVIGFVDNNVRD
ATP6_COLP3      -------------------------VFLGLVFLTIFRSAKKATSGVPGK---LQCAVEMVVGFVDDSVKS
ATP6_CAMC5      -------------------------------------ATSKMQLVPRGLQNIVEAYLEGVISMGRDTLGS
ATP6_CAMC1      -----------------------------------------MQLVPRGLQNIVEAYLEGVISMGKDTLGS
ATP6_ACIBY      ---------------------------LGVIFCLLFWARAANAGVPTKFQSAIEMIIEFVDSSVRDTFHG
ATP6_ACIBT      ---------------------------LGVIFCLLFWARAANAGVPTKFQSAIEMIIEFVDSSVRDTFHG
ATP6_ACIBS      ---------------------------LGVIFCLLFWARAANAGVPTKFQSAIEMIIEFVDSSVRDTFHG
ATP6_ACIBC      ---------------------------LGVIFCLLFWARAANAGVPTKFQSAIEMIIEFVDSSVRDTFHG
ATP6_ACIB5      ---------------------------LGVIFCLLFWARAANAGVPTKFQSAIEMIIEFVDSSVRDTFHG
ATP6_ACIB3      ---------------------------LGVIFCLLFWARAANAGVPTKFQSAIEMIIEFVDSSVRDTFHG
ATP62_HAHCH     -------------------------IALGALFV---WLFRKAAVKPSGLQNFVEIMVDFVDKSVKETIAP
ATP61_PELLD     -----------GFVKLNLT-IATTWALMLVLVGGSAFASRRLSNRPRW-QNVLEIIVGMARRQIE-EVGL
ATP6_SHESW      ----------------------------------------------------------------------
ATP6_SHEPC      ----------------------------------------------------------------------
ATP6_SHELP      ---------------------------------------------PGKLQCFIEMIVEFVDGSVKPVIAP
ATP6_PSE14      ---------------------------LGLIFVLIFRAKKATSGQPGALQNFVEVLVDFVDGSVKDSFHG
ATP6_CHRSD      ---------------------------LGVLFLWLFRAKSVSTGVPGGLQNFVEMMVEFVDNSVRETFHS
ATP6_BUCAI      -----------------------------------YMVGKKITQGIPGKQTAIELIFEFV----NLNVKS
ATP6_AGRVS      --------IEIGGIDFSFTNASLFMVAVACAAGFLYFATSNRGLIPGRAQSVAEMSYEFVASMLREGAGS
ATPI_CERDE      ----------IGGFQIHAQVLITSWVVIAILLGSAAIAVRNPQTIPTDGQNFFEYVLEFIRDLSKTQIGE
ATP6_TOLAT      -------------------------VVLGTLFI---WLFRRVAVKASGVPGKLQCFVEIVFGFVDDTVKG
ATP6_SHEAM      ----------------------------------------------------------------------
ATP6_RHOP2      -------------------------------------------LVPGRFQSVAELSYEFVANMIRSTAGK
ATP6_RHILW      -----------------------------------YFATSNRAIVPGRSQSVAEMSYEFIANMLKEGAGK
ATP6_RHIE6      -----------------------------------YFATSNRAIVPGRSQSVAEMSYEFIANMLKEGAGK
ATP6_PSEF5      ---------------------------LGVIFILLFRAKKATSGVPGALQNFVEVMVGFVDGSVKDSFHG
ATP6_PELUB      ----IGPEIKLGAIDISFTNASLFMVISSLAILLIFLGSKKNSLLPSKMQLLSELSYTFVSKMISDTAGS
ATP6_MICAN      ----------IGGLKIHGQVIAVSWIVFAILIIASIAATRKIQKVPSGIQNLMEYVLEFLRDLAKNQLGE
ATP6_BRANA      -------------------------------------------LVPNAWQSLVELLYDFVLNLVKEQIGG
ATP6_BARHE      -------------------------------------------LVPTRMQSVSEMAYEFVASTLRESSGV
ATP6_SHEHH      ----------------------------------------------------------------------
ATP6_ROSDO      ------------------TALWMGFSIIAVVLLLVVGSSKRAVV-PSRAQSVAELAYGFIYKMVEDICGK
ATP6_LAWIP      ------------------TWIAMLILIVGLI------VRRKLTLVPGRLQNFFEVLISSFENFTVINIGE
ATP62_ARATH     -------------------------------------------LVPNAWQSLVELLYDFVLNLVKEQIGG
ATP61_ARATH     -------------------------------------------LVPNAWQSLVELLYDFVLNLVKEQIGG
ATP6_VIBFM      -------------------------VFTGMLFLWVFRSAKKATTGVPGK---LQCFVEMIVEFVADNVKE
ATP6_VIBF1      -------------------------VFTGMLFLWVFRSAKKATTGVPGK---LQCFVEMIVEFVADNVKE
ATP6_SHESH      ----------------------------------------------------------------------
ATP6_RHOP5      ---------------------AYMLLAVAIISLLMIGGSAGRQMVPGRLQSLAELSYEFVANTIRSTAGV
ATP6_OLICO      -------------------------------------------LVPTRFQSMAELSYEFVVNMVRESLGE
ATP6_EHRRW      -----------------------------LISLSCYVGLRKESVIPNPLQSIIEIIYDFIVSTIESNVGK
ATP6_EHRRG      -----------------------------LISLSCYVGLRKESVIPNPLQSIIEIIYDFIVSTIESNVGK
ATP6_WIGBR      ------------------------------------YISKKFTIGTPGRQASIEILVEFINSNVKDIFGH
ATP6_PSESM      ---------------------------LGLIFVLIFRAKKATSGQPGALQNFVEVLVEFVDGSVKDSFHG
ATP6_ENTS8      ---------------------------------------------------------ELVIGFVHGSVQD
ATP6_VIBCM      -------------------------VLTGLIFLGVFRAARKATAGVPGK---LQCAVEMVVEFVDKNVKD
ATP6_VIBCH      -------------------------VLTGLIFLGVFRAARKATAGVPGK---LQCAVEMVVEFVDKNVKD
ATP6_VIBC3      -------------------------VLTGLIFLGVFRAARKATAGVPGK---LQCAVEMVVEFVDKNVKD
ATP6_SHEWM      ----------------------------------------------------------------------
ATP6_PROMH      --ELVNPHAENTPSVLNIDSLFFSVLM-GLLFLWIF---RKVAVKASGVPGKFQTAVEMVIGFVDSSVRD
ATP6_MAGSM      -------------------------LAVAVAFLFMKWSFRGRALIPTKMQSLAEMTFTFVRQIVDQNIGG
ATP6_VIBVY      ----------------------------GLIFLGIFYAARKTTAGVPGK---LQCAVEMIVEFVATNVKD
ATP6_VIBVU      ----------------------------GLIFLGIFYAARKTTAGVPGK---LQCAVEMIVEFVATNVKD
ATP6_RUTMC      ---------------FHLDTLSISFILGALFLIFFYKVGKKMTSDPSGAQNFIESVIDFINDNVRGSFNS
ATP6_VIBPA      ----------------------------GLIFLGIFYVAKRTTAGVPGK---LQCAVEMIVEFVADNVKD
ATP6_VIBAL      ----------------------------GLIFLGIFYVAKRTTAGVPGK---LQCAVEMIVEFVADNVKD
ATP6_SHEPW      ----------------------------------------------------------------------
ATP61_VIBHB     ----------------------------GLIFLGIFYVAKRTTAGVPGK---LQCAVEMIVEFVAENVKD
ATP6_SYNY3      --------------------------------------TRNVQRVPSGIQNLMEYVLEFLRDLARNQLGE
ATP6_SHESR      ------------------------------------WIFRSVGKKASGVPGKLQCFIEMIVEFVDNSVKE
ATP6_SHESM      ------------------------------------WIFRSVGKKASGVPGKLQCFIEMIVEFVDNSVKE
ATP6_SHESA      ------------------------------------WIFRSVGKKASGVPGKLQCFIEMIVEFVDNSVKE
ATP6_SHEON      ------------------------------------WIFRSVGKKASGVPGKLQCFIEMIVEFVDNSVKE
ATP6_SHEB9      ----------------------------------------------------------------------
ATP6_SHEB8      ----------------------------------------------------------------------
ATP6_SHEB5      ----------------------------------------------------------------------
ATP6_SHEB2      ----------------------------------------------------------------------
ATP6_ENT38      -------------------------VVLGLLFLAMFRSAKKATSGVPGK---FQTAIELVIGFVHGSVKD
ATP62_CHLP8     ---------------------------------------------PSGIANVMEALVDFILDVAKSNIGH
ATP61_PHOPR     ----------------------------------------------------------------------
ATP6_RICBR      ----IKKLIDIKVMDFDITNSAAYMLLASVLLTYFYLAFSNPRLVPSRLQISGEIIYNLVTDMLNQNVGS
ATP6_RICB8      ----IKKLIDIKVMDFDITNSAAYMLLASVLLTYFYLAFSNPRLVPSRLQISGEIIYNLVTDMLNQNVGS
ATP6_KLEP7      -------------------------VVLGLLFLAMFRSAKKATSGVPGK---FQTFIEMIIGFVHGSVKD
ATP6_KLEP3      -------------------------VVLGLLFLAMFRSAKKATSGVPGK---FQTFIEMIIGFVHGSVKD
ATP6_BACAO      ----------------------------------------------------------------------
ATP6_SODGM      ----------------------------------------------------------------------
ATP6_RHOPT      -------------------------------------------LVPGRLQSIAELSYEFVANMIRSTAGK
ATP6_RHOPA      -------------------------------------------LVPGRLQSIAELSYEFVANMIRSTAGK
ATP6_PSEU2      ---------------------------LGLIFVLIFRAKKATSGQPGALQNFVEVLVEFVDGSVKDSFHG
ATP6_PSEPF      ---------------------------LGLIFVLLFRAKKATSGQPGALQNFVEVLVEFVDGSVKDSFHG
ATP6_EHRCJ      ---------------FTNASLFMVLSTISVA-LFCYIGLKKESIIPNGIQSIVEFIYEFIVSTIESNVGK
ATP6_BART1      --------ISIGNMFTNVSLFXXXXXXXXAAFLFISSSSRGLV--PTRMQSLSEMAYEFVASTLRESSGV
ATP6_SHEPA      ----------------------------------------------------------------------
ATP6_PSEFS      ---------------FHLDTLGWSVAL-GLIFVLIFRAKKATSGQPGALQNFVEVLVEFVDGSVKDSFHG
ATP6_GEOUR      --------------------------------------TKGLKTVPGGLQNFMEVIIGGVENMVVETMG-
ATP6_BORPE      -------------------------ILMGLLVVFCLWAARRATAGVPGRQGFIEMIVDMVDDQAKSIVTN
ATP6_BORPA      -------------------------ILMGLLVVFCLWAARRATAGVPGRQGFIEMIVDMVDDQAKSIVTN
ATP6_BORBR      -------------------------ILMGLLVVFCLWAARRATAGVPGRQGFIEMIVDMVDDQAKSIVTN
ATP6_BORA1      --------------------------LMGLIVIFCLWAARRATAGVPGRQGFVEMIVDMVNDQAKGIVQN
ATP6_PSEA6      -----NASVGEGFWTFHVDTLAWSV-VLGLVFILSFRAAKKASAGVPGKW---QACVELIVEFVDDTVKS
ATP6_SPHWW      -------------IAFTNSAMWMVVTLAALLIFMIGGMKRDLV--PGRWQAAVESFTGFVAGMMATNIGP
ATP6_BRAJA      ---NIEPLFTIGHITIAFTNSSLYMLIAVAIISLLMLAS-GAQLVPGRLQSVAEISYEFVASTIRSTAGS
ATP6_ACICJ      -------------------MMLLAAVIVTSLFVV---ALRQRALVPGRMQGLAEISYEFVHNMVLDTIGE
ATP6_SYNAS      -----------------------------------------MEILPGSFQSFMEVVIGGFDSLVTDTMGH
ATP6_SALTY      ---------------------------------------------------------ELIVGFVHGSVKD
ATP6_SALTI      ---------------------------------------------------------ELIVGFVHGSVKD
ATP6_SALSV      ---------------------------------------------------------ELIVGFVHGSVKD
ATP6_SALPK      ---------------------------------------------------------ELIVGFVHGSVKD
ATP6_SALPC      ---------------------------------------------------------ELIVGFVHGSVKD
ATP6_SALPB      ---------------------------------------------------------ELIVGFVHGSVKD
ATP6_SALPA      ---------------------------------------------------------ELIVGFVHGSVKD
ATP6_SALNS      ---------------------------------------------------------ELIVGFVHGSVKD
ATP6_SALHS      ---------------------------------------------------------ELIVGFVHGSVKD
ATP6_SALG2      ---------------------------------------------------------ELIVGFVHGSVKD
ATP6_SALEP      ---------------------------------------------------------ELIVGFVHGSVKD
ATP6_SALDC      ---------------------------------------------------------ELIVGFVHGSVKD
ATP6_SALCH      ---------------------------------------------------------ELIVGFVHGSVKD
ATP6_SALAR      ---------------------------------------------------------ELIVGFVHGSVKD
ATP6_SALA4      ---------------------------------------------------------ELIVGFVHGSVKD
ATP6_AZOSB      ----------------------------------------------------------------------
ATP6_LEGPH      ----------------------------------------------------------------------
ATP6_LEGPC      ----------------------------------------------------------------------
ATP6_LEGPA      ----------------------------------------------------------------------
ATP6_PSYIN      ----------------------------------------------------------------------
ATP6_PHOLL      -------------------------VVLGILFLYVFRVAVNATSGVPGK---LQTAIELIMGFVDNSVRD
ATP6_BAUCH      ----------------------------------------------------------------------
ATP6_ANADF      -----------GPLVFGKVDMTPTKHVVAILLLVVFAAVRKKSLVPRGLYNFIEMLVQFVRNIAVKNIGE
ATP6_AERS4      -------------------------VILGALFIWIFRAATATSGVPGKLQCFVEMVVEFVDD-TVKGIFH
ATP61_BRASB     ----LNKIFTIGHIIAFTNSTAYMLLAVVLIAGMMLAAGR--ALVPGRFQSVVELSYEFVANTLRTSAGS
ATP6_RHOCA      --------------------MAIGVLMIALLMVV---GTLRRAIVPGRIQSLAELTYGFIHKMVEDVAGK
ATP62_PELPD     MLETTQALFHLGPLAVGTTVVT-TWGIMVVLSLGAWLASRRLRLDPGPFQVALEGVVQTIRAAVEEVVPR
ATP6_SHISS      ----------------------------------------------------------------------
ATP6_SHIDS      ----------------------------------------------------------------------
ATP6_SHIB3      ----------------------------------------------------------------------
ATP6_SACD2      ------------------------------------------TGKPSGLLSFVEFLVEGINSFHHKNIAP
ATP6_PARUW      --------------------IIFAILVASLISLVAYLGARKKEIIPSKFQNLLEIAVEKFSHLILEVLGP
ATP6_FRASC      --------VGIGSVNLYLNK-ATALTIFAALFVVIFWLGRRAKIIPRGLQNLCESAYDFILQIARGVIGE
ATP6_ESCF3      ----------------------------------------------------------------------
ATP6_ECOUT      ----------------------------------------------------------------------
ATP6_ECOSM      ----------------------------------------------------------------------
ATP6_ECOSE      ----------------------------------------------------------------------
ATP6_ECOLU      ----------------------------------------------------------------------
ATP6_ECOLI      ----------------------------------------------------------------------
ATP6_ECOLC      ----------------------------------------------------------------------
ATP6_ECOL6      ----------------------------------------------------------------------
ATP6_ECOL5      ----------------------------------------------------------------------
ATP6_ECOK1      ----------------------------------------------------------------------
ATP6_ECOHS      ----------------------------------------------------------------------
ATP6_ECODH      ----------------------------------------------------------------------
ATP6_ECOBW      ----------------------------------------------------------------------
ATP6_ECO8A      ----------------------------------------------------------------------
ATP6_ECO81      ----------------------------------------------------------------------
ATP6_ECO7I      ----------------------------------------------------------------------
ATP6_ECO5E      ----------------------------------------------------------------------
ATP6_ECO57      ----------------------------------------------------------------------
ATP6_ECO55      ----------------------------------------------------------------------
ATP6_ECO45      ----------------------------------------------------------------------
ATP6_ECO27      ----------------------------------------------------------------------
ATP6_ECO24      ----------------------------------------------------------------------
ATP6_DIAST      --------------VVNLDSVAVSV-ILGVLGLFVMWAARTATSGVPGRQAAVEMLVEMVDNQAKANIHN
ATP6_YERPG      --ELVNPH-STGPATFNIDSLFFSV-VLGLAFLLVFRVAASATSGVPGK---LQTAVELIIGFVDNSVRD
ATP6_OENBE      -------------------------------------------LVPNAWQSLVELIYDFVLNLVNEQIGG
ATP6_NITEU      ----------------------------------------------------------------------
ATP6_DESDA      --------ITIGGQVVEFKHVFYSWVCMAILFAVAWVLRRRLTLVPGGLQNFFEAMVDTIENFIVSTMGE
ATP6_BEII9      --------------------------------------TRNHSLVPGRLQSIAEVSYEFIASTLQLSSGR
ATP6_YERPY      --ELVNPH-STGPATFNIDSLFFSV-VLGLAFLLVFRVAASATSGVPGK---LQTAVELIIGFVDNSVRD
ATP6_YERPS      --ELVNPH-STGPATFNIDSLFFSV-VLGLAFLLVFRVAASATSGVPGK---LQTAVELIIGFVDNSVRD
ATP6_YERPP      --ELVNPH-STGPATFNIDSLFFSV-VLGLAFLLVFRVAASATSGVPGK---LQTAVELIIGFVDNSVRD
ATP6_YERPN      --ELVNPH-STGPATFNIDSLFFSV-VLGLAFLLVFRVAASATSGVPGK---LQTAVELIIGFVDNSVRD
ATP6_YERPE      --ELVNPH-STGPATFNIDSLFFSV-VLGLAFLLVFRVAASATSGVPGK---LQTAVELIIGFVDNSVRD
ATP6_YERPB      --ELVNPH-STGPATFNIDSLFFSV-VLGLAFLLVFRVAASATSGVPGK---LQTAVELIIGFVDNSVRD
ATP6_YERPA      --ELVNPH-STGPATFNIDSLFFSV-VLGLAFLLVFRVAASATSGVPGK---LQTAVELIIGFVDNSVRD
ATP6_YERP3      --ELVNPH-STGPATFNIDSLFFSV-VLGLAFLLVFRVAASATSGVPGK---LQTAVELIIGFVDNSVRD
ATP6_SHIFL      ----------------------------------------------------------------------
ATP6_SHIF8      ----------------------------------------------------------------------
ATP6_PELPB      ----------------HVVMLWVVSAILLILFSLVGSKYKKMTARPTGLVNAMEALVEFIIDVAKANIGV
ATP6_AERHH      -------------------------VLLGALFI---WSFRRVAVKPGKLQCFVEMLVEFVSGNVKDIFHG
ATP6_GEOLS      -------------------------------------ATRALKTIPSGVQNFMEVVVDGIENMIVETMGE
ATP6_BRASO      -------------------------------------------LVPGRFQSVVELAYEFVANTIRTSAGS
ATP6_BDEBA      -------------------------------------------------RGIFELLTEMTSGLADMVIGE
ATP6_ALLAR      --------------ITSLTNIAI-LFIIGLLVLTIFQISASSHLKPTRWNIVLETWVASILGIVKDQIGN
ATP6_RHOS5      --------------------------------------TRRRAIVPSRSQSVAELLYGFIHNMVEEVTGH
ATP6_RHOS4      --------------------------------------TRRRAIVPSRSQSVAELLYGFIHNMVEEVTGH
ATP6_RHOS1      --------------------------------------TRRRAIVPSRSQSVAELLYGFIHNMVEEVTGH
ATP6_DINSH      ----VSPLFGDGPVHF-YTPTNVTLWMXXXXXXXXXXGTRGRAVVPSRAQSIAELAYGFVYKMVEDVTGK
ATP6_CITK8      ---------------------------------------------------------ELVIGFVHGSVKD
ATP6_ACISJ      --------------VVNLDSVAVSV-ILGVLGLFVMWAARTATSGPSRFQAAVEMLVEMVDNQAKANIHN
ATP6_RICAE      ----------------SFTNSSIYMLLASILLTYFYLAFYNRKLVPSRLQVSAEIVYNLVADMLNQNIGV
ATP6_CHLCH      ------PKIVVAGFDISITKHVVMLWVVSAIVIALFAAANGQMRAPKGIANALEALVDFILDVAKANIGK
ATP6_ALLMA      --------------ITSLTNIAI-LFIIGLLVLTIFQISASSHLKPTRWNIVLETWVASILGIVKDQIGN
ATP61_METCA     ----------------------------------------------------------------------
ATP61_CHLTE     ----------------------------------------------------------------------
ATP6_SOLUE      --------------------------------------------RPGKLQHTFELVYGFLHEQAEEQIGH
ATP6_RICAH      ----------------SFTNSSIYMLLASILLTYFYLAFYNRKLVPSRLQVSAEIVYNLVADMLNQNIGV
ATP6_GEOSF      ---------------------------------------------PGKMQNFMEVIIGGIENMVVETMGE
ATP6_RICCK      ----------------SFTNSSIYMLLASILLTYFYLAFYNWKLVPSRLQVSAEIVYNLVADMLNQNIGA
ATP6_ORITI      ----IKPIIPLEALGYNISITAVAMIFVSIAAMLLITAFVNSKLVPSRWQAFGEILYESNIKLVHSIIGP
ATP6_GLUOX      ------------------------LIAAAVVLVFLYVGMRPAAVVPGRLQAAAEISYDFVHDLAVSTIGE
ATP62_METCA     ---------------------------------------RRRTALPDRVQVVLEGIVSACENAVRDVIPT
ATP6_ORITB      ----IKPIIPLKALGYNISITAVAMIFVSIAALLLIIAFVNSKLVPSRWQAFGEILYESNIKLVHSIIGP
ATP6_DESOH      ------------------TWVVMALLILGVL------GARNIQIVPTKMQNFLEVLISGIEEFMVSVTGE
ATPI_ODOSI      --------------------------------------TRDIDRIPNSWQNFAESAVDFVTDIARDQLGE
ATP6_YEAST      ----------------NLTTFSLYTIIVLLVITSLYTLTNNNN-KIIGSRWLIEAIYDTIMNMTKGQIGG
ATP6_JANMA      ----------------------------------------------------------------------
ATP6_ALCBS      ---------------------------LGIIMCLLFWARKATAGVPSGFLNFVEIIIEFIDTQVRDSFHS
ATP6_NOVAD      ---------SIGGYNIAFTNSALWMAITTAVLIVFVAGGAKRELVPGRWQMAVEGLTGFVDNLLQANIGK
ATP6_PHOVI      ------------------TMMGLPIVILIVLFPSILFPSPDRLIN-----NRLASIQQWLIQLTSKSIHN
ATP6_HIPAM      ------------------------------------------------------------------NIHN
ATP6_GRABC      ----------------NEIMVLGTAIVLGIIAL----GMRQRAVVPGRLQSLVEISYNFIMGLCIEQIGH
ATP6_APILI      ----------------NLSMNWLFMMLPIIIFPSIFWLIQSRIMF------IMKTLMNFMYNEFKVVSKS
ATP6_BORPD      -----------------------------VVVLFLWLAARRASAGVPGRQAFVEMIVDMVDEQAKGIVTN
ATP62_PROA2     ------PQIVIGGFDISITMMWIASAILLVVFLLVGNRYKTMTSRPGGMANAMEALVEFILDVAKSNIGA
ATP6_CHRVO      ----------------------------------------------------------------------
ATP6_FELCA      ------------------TMMGLPIVILIIMFPSILFPSPNRLIN-----NRLVSLQQWLVQLTSKQIHN
ATP6_CHOCR      ------------------------------------------TLIPNNWQLVKESIYEITASMVQDNLGS
ATP6_SPHAL      ------------------TNSALWMVVAAITLGLFMWGGMRRQLVPGRWQVAVEGFTGFISSMMMANIGT
ATP6_PARL1      ----VQPLINIGGLDASFTNASLWMVVTVVIGLFMTLGMRSGAMVPGRMQSVVESFYTFIANMVRDNAGH
ATP6_GEOSM      ------------------------LIMIGLVVLSIA-ATKRLQAVPSGLQNFMEVIVGGIENMLVETMGE
ATP6_ACACA      ------------------------VILIGFTFLFYVNYSTN-TYIPSKWQYAVENIYLFVLQLFKQQINN
ATP6_RHIUN      ------------------TMMGLPIVILIIMSPSIMFPSPNRLIN-----NRLISIQQWLLQLTSKQMMS
ATP6_NEOSM      -------------------------MVLTVVFLFLFAGVFRGKVIPGPMQSFVEIVCSFVLGIIKGSCG-
ATP6_HALGR      ------------------TMMGLPIVILIVLFPSILFPSPDRLIN-----NRLTSIQQWLIQLTSKSIHN
ATP6_GEOBB      ------------------------LIMIGLVVLSIA-ATKRLQAVPSGLQNFMEVIVGGIENMLVETMGE
ATP6_AGRRK      ----------------SLFMVASAVLSAG----FLYFATSARSVIPGRSQSVAEMAYEFIASMLKEGAGT
ATP6_ZYMMO      --------LHIGKYDISFTNSALWMVIAMAALAIFMAGGRRKALIPGRWQMAVEVMTRFVNDMVSTNIGP
ATP6_TERTT      ----------------------------------------------------------------------
ATP6_MYCGA      ----------------------------------------------------------------------
ATP6_EQUAS      ------------------TMMGLPIVILIIMFPSILFPSSNRLIN-----NRLISIQQWLVQLTSKQIHN
ATP6_CERSI      ------------------TIMGLPIVILIIMFPSIMFPSPNRLIN-----NRLVSTQQWLLQLTSKSIHN
ATP61_PELCD     ------------------------LLLTGVALLL----KRRLSEVPGGLQNLVEIVLVELGRLADETMGP
ATP6_VANPO      ----------------NITTFGLYIIIVLMVIVSXXXXXXXXXXXXGSRWNLLEMIYDTILNTTKGQIGG
ATP6_BLOPB      -------VLNVDSMFFSILLATLFLLIFG----------RLATVATYAVPTKLQVFIELVILFIDSNVKD
ATP61_OCHA4     --------IDVGGVDLSFTNVAFMVATVVVASGFLYLTSSGRGLIPTRLQSVSEMAYEFVATSLRDSAGS
ATP6_HYDS0      --------------------------------------------KPKIMPSKLQFVIESYINFCKSNMGE
ATP6_ANAD2      ---------------------------------------RKKSLVPRGLYNFIEVLVAFVRNIAVKNIGE
ATP6_LEMCA      ----------------------------------------------------------------------
ATP6_RHIL3      ----------------------------------------NRAIVPGRSQSVAEIFYEFIAKMLTEGAGK
ATP6_MARPO      -------------------------------------------LVPNAWQSFVEMIYDFVLNLVNEQISG
ATP6_HORSE      ------------------TMVGLPIVILIIMFPSILFPSPNRLIN-----NRLISIQQWLVQLTSKQIHN
ATP6_GEOSL      -------------------------------------ATKALKAVPTGMQNFMEVVIGGIENMVEETMGE
ATP6_METS4      ----LKPLVSFGHIAFTQSALYM-FAAVGIIALITLVATRQRALVPGRMQSLAEAFYEFIASTVHQSAGH
ATP6_BLOFL      ----------------------------------------------------------------------
ATP6_AGRT5      ----VQPIIEIGGVDFSFTNASLFMVAVAAASGFLYFATSNRGLIPTRMQSVAEMSYEFIASMLREGAGK
ATP61_PELPD     --------------------VAYTWLIMXXXXXXXXXATRALKMIPCGLQNFMEVVVGGVENMIVETMGE
ATP6_MACRO      -------------------------------------------------------------------IHN
ATP6_HYPNA      ----------------------------------------------------------------------
ATP6_GEOMG      -------------------------------------ATKALKAVPTGMQNFMEVVVGGIENMVEETMGE
ATP6_BALPH      ------------------------------------------------------------------NVHS
ATP6_MOUSE      ----------------------------------------------------------------------
ATP6_BALMU      ----------------------------------------------------------------------
ATP6_ANADE      ----------------------------------------------------------------------
ATP6_ALTMD      -------------------------------------ASKATTGVPGKMQAFVELVVEFV----DDNVKS
ATP6_LUMTE      ----------------------------------------------------------------------
ATP6_ARTAT      ---------------FSKQMLLVILSVV-IIATFFILAARKQQLVPGKLQFAGEMAYGFVRGIAKDIIGG
ATP6_ANASK      ----------------------------------------------------------------------
ATP6_CANLU      ------------------SMMGLPIVVLIVMFPSILFPTPSRLIN-----NRLISIQQWLIQLTSKQIHN
ATP6_CANFA      ------------------SMMGLPIVVLIVMFPSILFPTPSRLIN-----NRLISIQQWLIQLTSKQIHN
ATP6_STRPU      -----------------MNVFSMAFCLSWLVFIYVNWASRFQSIWLGFRSNILEMIFQNTSPNTAPWAG-
ATP6_PARDP      ------------------------------------FGTRGRAIVPNRVQSIAELLYGMVHKMVEDVTGK
ATP6_RHILO      ------------------------------------------SLVPGRLQSISEMAYEFVANMLRDAAGT
ATP6_PSEHT      ----------------------------------------------------------------------
ATP6_ACIAC      ----------------------------------------------------------------------
ATP6_DUGDU      ------------------TMMGLPIVILVIVFPAMLYPSPNRLINNR-LISIQQWLVQLILK-QMLLIHN
ATP6_USTMA      ----------LGYINLSLTNLGLTILTVYLVLALHIMGSNNKQLIPSRWSIALESSFASVHGLVKSQIGA
ATP6_NOCSJ      ----------------------------------------------------------------------
ATP6_DESDG      --------INVGGQSVEFKHVFYTWCVMAMLFAVSFIVRGKIKMVPGKLQNIFEVIIGGLEEFVVSITGE
ATP6_TETNG      ----------------------------------------------------------------------
ATP6_RAT        ----------------------------------------------------------------------
ATP6_PIG        ----------------------------------------------------------------------
ATP6_CRIGR      ----------------------------------------------------------------------
ATP6_GLUDA      ----------------------------------------------------------------------
ATP6_BOVIN      ----------ITPVILGLPLVTLIVLFPSLLFPTSLVSNRFVTLQ----QWMLQLVSKQMM-----SIHN
ATP6_AQUAE      ------------------------------------------SLKPTKYQALLEGYLRFVRNMLLENVGE
ATP6_VEREI      ----------------------------------------------------------------------
ATP6_PARLI      --------VSIFGQFFPETLLFIPMNLFSIVFAFIYWASRFQSIWASFRANVLEMIFQNTSPNTAPWAG-
ATP6_GORGO      ----------------------------------------------------------------------
ATP6_BOSMU      ----------------------------------------------------------------------
ATP6_BOSIN      ----------ITPVILGLPLVTLIVLFPSLLFPTSLVSNRFVTLQ----QWMLQLVSKQMM-----SIHN
ATP6_RABIT      ----------------------------------------------------------------------
ATP6_CANGA      -----------------------------------------------------EVIYDTILNMVKGQIKG
ATP6_VICFA      ---------------------------------------------PNAWQSLVELIYDFVPNLVNEQIGG
ATP6_SHEEP      ----------ITPMMFGLPLVTLIVLFPSLLFPTSNRLVNNRLISLQ--QWMLQLVSKQMM-----SIHN
ATP6_HUMAN      ----------------------------------------------------------------------
ATP6_ARTS2      ---------------FSKQMLLVILSVV-IIATFFLLAARKQQLVPGKLQFAGEAAYGFVRNSIAKDIGK
ATP63_PELPD     ---------------------------------------------PGGLQNFMEIIVGGIENMVTETMGE
ATP6_MESSB      --------IEIGGLDFSFTNSSLFMVAVAAAGAFLYLTTSSRGLVPSRMQSVSEMSYEFVASMLRDAAGS
ATP6_PYLLI      ----------------------------------------------------------------------
ATP6_NITHX      -------------------------MLVAVVLTSLLMLATGRKLVPGRMQSIAEISYEFVADTIHTTAGK
ATP6_WHEAT      ---------------------------------------------PNAWQSLVELIYDFVLNLVNEQIGG
ATP6_TRITI      ---------------------------------------------PNAWQSLVELIYDFVLNLVNEQIGG
ATP6_PANTR      ----------------------------------------------------------------------
ATP6_MARMM      ----------------------MVLTTVLTIVLFMV-AMSSRALVPNRAQSVAEIIYGFVADMVRSTAGQ
ATP6_ANAPL      ----------------------------------------------------------------------
ATP6_NITWN      ---NIEPIFTIGHIIAFTNSSAYMFLAVALTSLLMLGTGRRLV--PGRMQSIAEISYEFVADTIRTTAGK
ATP6_MAIZE      ---------------------------------------------PNAFQSLVELIYDFVPNLVNEQIGG
ATP6_ERYLH      ------------------TNSAAWMALTTVLLAVFVWGGMKGQLVPGRWQMMVESFTSFIDDMLEVNIGK
ATP6_DESVV      --------ITIGGATVEFKHVFYTWCAMAILFSLGLIVRSSLKVVPGALQNVFEVVIGGLEDFVVGNIGE
ATP6_DESVH      --------ITIGGATVEFKHVFYTWCAMAILFSLGLIVRSSLKVVPGALQNVFEVVIGGLEDFVVGNIGE
ATP6_TOBAC      ---------------------------------------------PNAWQSLVELIYDFVLNPVNEQIGG
ATP6_PENCH      ----------LGNLHLSLTNIGLYLTIIFLILTYSLLATNNNKIIPNNQESIYATVHGIVVNQINPNKGQ
ATP6_ASHGO      -----------------------------------------------------EMIYDTIMNMVKTQIGG
ATP6_DIDMA      ----------------------------------------------------------------------
ATP6_MYCPN      ----------------------------------------------------------------------
ATP6_MYCGE      ----------------------------------------------------------------------
ATP6_ASTPE      ----------------------------------------------------------------------
ATP6_TROMO      ----------------------------------------------------------------------
ATP6_TRIRU      ------------------------------------------------KESIYATVHSVVIN----QINS
ATP6_SPETR      ----------------------------------------------------------------------
ATP6_PISOC      ----------------------------------------------------------------------
ATP6_CAEBR      ----------------------------------------------------------------------
ATP6_METSE      ----------------------------------------------------------------------
ATP6_CAPHI      ----------------------------------------------------------------------
ATP6_SCHPO      ----------------------------------------------------MEAIYFTMLNLVENQIHS
ATP6_TROHI      ----------------------------------------------------------------------
ATP6_PODAN      ----------------------------------------------------------------------
ATP6_NEUCR      ----------------------------------------------------------------------
ATP6_MYXGL      ----------------------------------------------------------------------
ATP6_DINSE      ----------------------------------------------------------------------
ATP6_ASCSU      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           RYMKDYSLFFLCLFLFMVIANNLGLMTKLQTIDGTNWWSSPTANLQYDLTLSFLVILLTHIESVRRRGFK
ATP6_STRP4      RYMKDYSLFFLCLFLFMVIANNLGLMTKLQTIDGTNWWSSPTANLQYDLTLSFLVILLTHIESVRRRGFK
ATP6_STRZT      RYMKDYSLFFLCLFLFMVIANNLGLMTKLQTIDGTNWWSSPTANLQYDLTLSFLVILLTHIESVRRRGFK
ATP6_STRZP      RYMKDYSLFFLCLFLFMVIANNLGLMTKLQTIDGTNWWSSPTANLQYDLTLSFLVILLTHIESVRRRGFK
ATP6_STRZJ      RYMKDYSLFFLCLFLFMVIANNLGLMTKLQTIDGTNWWSSPTANLQYDLTLSFLVILLTHIESVRRRGFK
ATP6_STRR6      RYMKDYSLFFLCLFLFMVIANNLGLMTKLQTIDGTNWWSSPTANLQYDLTLSFLVILLTHIESVRRRGFK
ATP6_STRPS      RYMKDYSLFFLCLFLFMVIANNLGLMTKLQTIDGTNWWSSPTANLQYDLTLSFLVILLTHIESVRRRGFK
ATP6_STRPN      RYMKDYSLFFLCLFLFMVIANNLGLMTKLQTIDGTNWWSSPTANLQYDLTLSFLVILLTHIESVRRRGFK
ATP6_STRPJ      RYMKDYSLFFLCLFLFMVIANNLGLMTKLQTIDGTNWWSSPTANLQYDLTLSFLVILLTHIESVRRRGFK
ATP6_STRPI      RYMKDYSLFFLCLFLFMVIANNLGLMTKLQTIDGTNWWSSPTANLQYDLTLSFLVILLTHIESVRRRGFK
ATP6_STRP2      RYMKDYSLFFLCLFLFMVIANNLGLMTKLQTIDGTNWWSSPTANLQYDLTLSFLVILLTHIESVRRRGFK
ATP6_STRP7      RYMKDYSLFFLCLFLFMVIANNLGLMTKIQTIDGTNWWSSPTANLQYDLTLSFLVILLTHIESVRRRGFK
ATP6_STRSV      HYMKNYXXXXXXXXXXVAVANNLGLMAKVQTTNGFNLWTSPTANLAFDLGFSLLVTVFCHVEGIRRQGIK
ATP6_STRGC      KYMKNYXXXXXXXXXXXVVANNLGLMAKLQTTSGENLWTSPTANIAFDLSMSFLITLICHVEGIRRRGFK
ATP6_STRS7      HLQKSYSLLLFTIFLFVAVANNLGLFTKLETTSGYNLWTSPTANLAFDLALSLFVTLLVHIEGIRRRGFG
ATP6_STREM      HLQKSYSLLLFTIFLFVAVANNLGLFTKLETTSGYNLWTSPTANLAFDLALSLFVTLLVHIEGIRRRGFG
ATP6_STRE4      HLQKSYSLLLFTIFLFVAVANNLGLFTKLETTSGYNLWTSPTANLAFDLALSLFVTLLVHIEGIRRRGFG
ATP6_STRPZ      NLQKSYSLLLFTIFLFVAVANNLGLFTKLETVNGYNLWTSPTANLAFDLALSLFITLMVHIEGVRRRGLV
ATP6_STRPM      NLQKSYSLLLFTIFLFVAVANNLGLFTKLETVNGYNLWTSPTANLAFDLALSLFITLMVHIEGVRRRGLV
ATP6_STRPG      NLQKSYSLLLFTIFLFVAVANNLGLFTKLETVNGYNLWTSPTANLAFDLALSLFITLMVHIEGVRRRGLV
ATP6_STRPF      NLQKSYSLLLFTIFLFVAVANNLGLFTKLETVNGYNLWTSPTANLAFDLALSLFITLMVHIEGVRRRGLV
ATP6_STRPD      NLQKSYSLLLFTIFLFVAVANNLGLFTKLETVNGYNLWTSPTANLAFDLALSLFITLMVHIEGVRRRGLV
ATP6_STRPC      NLQKSYSLLLFTIFLFVAVANNLGLFTKLETVNGYNLWTSPTANLAFDLALSLFITLMVHIEGVRRRGLV
ATP6_STRPB      NLQKSYSLLLFTIFLFVAVANNLGLFTKLETVNGYNLWTSPTANLAFDLALSLFITLMVHIEGVRRRGLV
ATP6_STRP8      NLQKSYSLLLFTIFLFVAVANNLGLFTKLETVNGYNLWTSPTANLAFDLALSLFITLMVHIEGVRRRGLV
ATP6_STRP6      NLQKSYSLLLFTIFLFVAVANNLGLFTKLETVNGYNLWTSPTANLAFDLALSLFITLMVHIEGVRRRGLV
ATP6_STRP3      NLQKSYSLLLFTIFLFVAVANNLGLFTKLETVNGYNLWTSPTANLAFDLALSLFITLMVHIEGVRRRGLV
ATP6_STRP1      NLQKSYSLLLFTIFLFVAVANNLGLFTKLETVNGYNLWTSPTANLAFDLALSLFITLMVHIEGVRRRGLV
ATP6_STRA5      HYTKNYSLLMFILFSFVFIANNLGLMTSLKTHEH-NFWTSPTANFGVDITLSLLVAFICHIEGIRKKGIG
ATP6_STRA1      HYTKNYSLLMFILFSFVFIANNLGLMTSLKTHEH-NFWTSPTANFGVDITLSLLVAFICHIEGIRKKGIG
ATP6_STRA3      HYTKNYSLLMFILFSFVFVANNLGLMTSLKTHEH-NFWTSPTANFGVDITLSLLVAFICHIEGIRKKGIG
ATP6_STRMU      -YTKNYSXXXXXXXXXXXXXNNIGLLTKIQVKD-YNLWTSPTANFAVDFGLSLMVAVICHFEGIRKHGLK
ATP6_ENTFA      KEVSNFHLMAFTLFMFVLVSNILGLVTKIVVGDDLSVWKSPTADPIVTLTLAMMMIVLTHFFGMKRFGFK
ATP6_ENTHR      KEXXXXXXXXXXXXXXXXXXXXIGLITKIVLPSETTLWKSPTANPFVTLTLAFIMITLTHLFGVKKLGFK
ATP6_OCEIH      KTGRIFLPLGLTLIFYILVSNLIGVAT-VGVVEHDLWWKSPTADAVMTLTLSTMIIALTHYYGIKLRGTK
ATP6_LISMF      KTGGRFHVLGITLLMFIFVANMLGLPFQI-AINDEVWWRSPTADPIVTLTLAIMVLGLTHYYGIKMRGFK
ATP6_LISMC      KTGGRFHVLGITLLMFIFVANMLGLPFQI-AINDEVWWRSPTADPIVTLTLAIMVLGLTHYYGIKMRGFK
ATP6_LISIN      KTGGRFHVLGITLLMFIFVANMLGLPFQI-AINDEVWWRSPTADPIVTLTLAIMVLGLTHYYGIKMRGFK
ATP6_LISMO      KTGGRFHVLGITILMFVFVANMLGLPLQIAVNDEV-WWRSPTADPIVTLTLAIMVLGLTHYYGIKMRGFK
ATP6_LISW6      KTGGRFHVLGITLLMFIFVANMLGLPFQI-AINDEVWWRSPTADPIVTLTLAIMVLGLTHYYGIKMRGFK
ATP6_STAAW      KKGGQFHFLAVTLILYIFIANMLGLPFSIVTKDHTLWWKSPTADAXXXXXXXXXXXXXXHFYGIKMRGTK
ATP6_STAAT      KKGGQFHFLAVTLILYIFIANMLGLPFSIVTKDHTLWWKSPTADAXXXXXXXXXXXXXXHFYGIKMRGTK
ATP6_STAAS      KKGGQFHFLAVTLILYIFIANMLGLPFSIVTKDHTLWWKSPTADAXXXXXXXXXXXXXXHFYGIKMRGTK
ATP6_STAAR      KKGGQFHFLAVTLILYIFIANMLGLPFSIVTKDHTLWWKSPTADAXXXXXXXXXXXXXXHFYGIKMRGTK
ATP6_STAAN      KKGGQFHFLAVTLILYIFIANMLGLPFSIVTKDHTLWWKSPTADAXXXXXXXXXXXXXXHFYGIKMRGTK
ATP6_STAAM      KKGGQFHFLAVTLILYIFIANMLGLPFSIVTKDHTLWWKSPTADAXXXXXXXXXXXXXXHFYGIKMRGTK
ATP6_STAAE      KKGGQFHFLAVTLILYIFIANMLGLPFSIVTKDHTLWWKSPTADAXXXXXXXXXXXXXXHFYGIKMRGTK
ATP6_STAAC      KKGGQFHFLAVTLILYIFIANMLGLPFSIVTKDHTLWWKSPTADAXXXXXXXXXXXXXXHFYGIKMRGTK
ATP6_STAAB      KKGGQFHFLAVTLILYIFIANMLGLPFSIVTKDHTLWWKSPTADAXXXXXXXXXXXXXXHFYGIKMRGTK
ATP6_STAA9      KKGGQFHFLAVTLILYIFIANMLGLPFSIVTKDHTLWWKSPTADAXXXXXXXXXXXXXXHFYGIKMRGTK
ATP6_STAA8      KKGGQFHFLAVTLILYIFIANMLGLPFSIVTKDHTLWWKSPTADAXXXXXXXXXXXXXXHFYGIKMRGTK
ATP6_STAA3      KKGGQFHFLAVTLILYIFIANMLGLPFSIVTKDHTLWWKSPTADAXXXXXXXXXXXXXXHFYGIKMRGTK
ATP6_STAA2      KKGGQFHFLAVTLILYIFIANMLGLPFSIVTKDHTLWWKSPTADAXXXXXXXXXXXXXXHFYGIKMRGTK
ATP6_STAA1      KKGGQFHFLAVTLILYIFIANMLGLPFSIVTKDHTLWWKSPTADAXXXXXXXXXXXXXXHFYGIKMRGTK
ATP6_GEOSW      KTGGRFHLLGMTLIMYIFVANMLGLPFSI-VIDGKLWWKSPTADPVITLTLAIMVVALSHYYGIKLRGFQ
ATP6_PEDPA      EEEKNFGLYAFTLFLFIFVSNQIGLFLQIAWND-VSYLRSPTADPIVTLTLSLITMMLAHYSGVAKFGFK
ATP6_BACPF      KVGGRFIVLAYALLFYVFVANMLGLPFELYNPTTHEWWKSPTSDPVLTLTMAAFVVILTHYYGIKIQGFG
ATP6_BACA2      KTGANFLALGVTLLMYIFVSNMLGLPFSV-TVGHELWWKSPTADPAITLTLAVMVVSLTHYYGVKMKGLK
ATP6_BACSU      KTGANFLALGVTLLMYIFVSNMLGLPFSI-TIGHELWWKSPTADPAITLTLAVMVVALTHYYGVKMKGLK
ATP6_BACME      KTGGRFLTLGVTLLMYIFVSNMLGLPFAI-VIDHNLWWKSPTADPAITLTLAVMVVVLSHYYGIKMRGFS
ATP6_MACCJ      NKGGRFHFLAVTLLLFIFVANMLGL--PFAIINGTLWWKSPTADPXXXXXXXXXXXXXXHFYGVKMRGTG
ATP6_BACSK      KVGGRFIVLAYALLFYVFVANMMGIPFELVTKEGHNFWKSPTSDPVLTLTMAVFIVVLTHIYGIMVTGPS
ATP6_STAES      KKGGNFHFLAVTLILFIFVANMLGLPFAIVTHDHTLWWKSPTADAXXXXXXXXXXXXXXHYYGIKMRGTK
ATP6_STAEQ      KKGGNFHFLAVTLILFIFVANMLGLPFAIVTHDHTLWWKSPTADAXXXXXXXXXXXXXXHYYGIKMRGTK
ATP6_LYSSC      KTGGRFHILGITLIMFIAVSNLLGLPFSI-VYGHELWWKSPTADPTVTMTLATMILVLSHFYGVKMKGTG
ATP6_GEOKA      QTGGRFLTLGVTLIMYVFVANMLGLPFSVH-VNGELWWKSPXXXXXXXXXXXXXXXXXXHYYGVKMKGAS
ATP6_BACST      QTGGRFLTLGVTLIMYVFVANMLGLPFSVH-VNGELWWKSPXXXXXXXXXXXXXXXXXXHYYGVKMKGAS
ATP6_BACP3      QTGGRFLTLGVTLIMYVFVANMLGLPFSVH-VNGELWWKSPXXXXXXXXXXXXXXXXXXHYYGVKMKGAS
ATP6_ANOFW      KTGGRFHMLGMTLIMYIFVANMLGLPFSV-VIDNKLWWKSPTADPXXXXXXXXXXXXXSHYYGIKLNGFK
ATP6_STACT      KKGGQFHFLTVTLILFIFVGNMLGLPFAI-VIDHTLWWKSPXXXXXXXXXXXXXXXXXXHYYGIKMRGTK
ATP6_LACF3      ETSGFYSXXXXXXXXXXXISNQLGLIIQFGW-NGHEIVKSPTADPVVTMTLALCAVTLSHFAGVARQGVK
ATP6_STAS1      SKGGQFHFLAVTLIFFIFVSNMLGL--PFQLISGTLWWKSPTADAXXXXXXXXXXXXXXHFYGVRMKGTK
ATP6_LACRJ      SEQGHYSXXXXXXXXXXXXXXXXGLIFQFHW-NGAEVLRSPTADPXXXXXXXXXXXXXAFAAGVAHNGLG
ATP6_LACRD      SEQGHYSXXXXXXXXXXXXXXXXGLIFQFHW-NGAEVLRSPTADPXXXXXXXXXXXXXAFAAGVAHNGLG
ATP6_STAHJ      KKGGQFHFLAVTLILFIFVANMLGLPFAIVTKDHYLWWKSPTADAXXXXXXXXXXXXXXHYYGVKMRGTK
ATP6_BACCA      QTGGRFLTLGVTLIMYVFVANMLGLP----------FWLDVTVNFGGNRRPTDATVTLTHYYGVKMKGAS
ATP6_BACP2      KTGAPFLALGVTLLMYIFVSNMLGLPFSI-SVDHNLWWKSPTADPAITMTLAVMVMGLTHYYGVKAKGVK
ATP6_DESRM      KLGAAMMPIIVTFFIYIVFANLLGLIPTL---------SSPTADKNTTFGLALIVVLLIHYHGLKANGVG
ATP6_SULDN      EAARRYLPLVATIGLFVGIANLIGVVPGFE---------APTAFLEFAFTLALSVFIYYNYEGIRRQGVV
ATP6_MYCLE      RIAPFVLPLAVTIFVFILISNWLSVLPLQYTADGTEVLSSAAADINYVLALAFFVFVCYHLAGIWRRGIV
ATP6_ACIC1      RVAPFVAPMAVTLFVYILLCNWIGVLPS----GHPEHLPAPTADINLTLTLALVVIVPMHIVSLKRRGLG
ATP6_MOOTA      EGRR-YLPLVATLFIFILSLNLSWFIPGMKP---------PTMDLSTTAAFAVTTIILVQIFGIRKLGLR
ATP6_HELPY      ELARKYFPLAGTIALYVFFSNMIGIIPGFE---------SPTASWSFTLVLALIVFFYYHFEGIRVQGFF
ATP6_HELPS      ELARKYFPLAGTIALYVFFSNMIGIIPGFE---------SPTASWSFTLVLALIVFFYYHFEGIRVQGFF
ATP6_HELPH      ELARKYFPLAGTIALYVFFSNMIGIIPGFE---------SPTASWSFTLVLALIVFFYYHFEGIRVQGFF
ATP6_HELPG      ELARKYFPLAGTIALYVFFSNMIGIIPGFE---------SPTASWSFTLVLALIVFFYYHFEGIRVQGFF
ATP6_HELHP      QVARKYFPLAATIAFLVFFGNAIGIIPGFE---------APTSSWSFTLVLALVVFFYYHFEGIRAQGVL
ATP62_BRASB     KDARPFLPLLGTLIIFLVVANLSGVLPGVE---------APTSKIETPAALALIVFFSVHYFGVRERGLR
ATP6_HELPJ      ELARKYFPLAGTIALYVFFSNMIGIIPGFE---------SPTASWSFTLVLALIVFFYYHFEGIRVQGFF
ATP6_HELP2      ELARKYFPLAGTIALYVFFSNMIGIIPGFE---------SPTASWSFTLVLALIVFFYYHFEGIRVQGFF
ATP6_HELAH      ELARKYFPLAGTIALYVFFSNMIGIIPSFE---------SPTASWSFTLVLALIVFFYYHFEGIRVQGFF
ATPI_OEDCA      EEYLKWVPFLGTIFIFVFVSNWAGALLPWRLIELPNGLAAPTNDINTTVSLALLTSVSYFYAGIRKKGLG
ATP6_SYNS9      KYYRDWLPFIGTLFLFIFVSNWGGALIPWKIIEPEGELGAPTADINTTVAMALLVSLAYFYAGLSRKGL-
ATPI_PAUCH      KAYRDWLPFIGTLFLFIFGCNWGGALVPWKLIELPNGLGAPTADINTTVAMALLVSLSYFYAGLSRKGL-
ATP6_SYNS3      KYYREWLPFIGTLFLFIFVSNWGGALIPWKVIEPEGELGAPTADINTTVAMALLVTLAYFYAGLSKKGW-
ATP6_PROMS      KVYRDWMPFIGTLFLFVFVSNWGGALIPWRLIKPSGELGAPTADINTTIALALLVSLSYFYAGLSNKGW-
ATP6_PROMP      KVYRDWMPFIGTLFLFVFVSNWGGALIPWRLIKPSGELGAPTADINTTIALALLVSLSYFYAGLSNKGW-
ATP6_MYCUA      RIAPFVLPLAVTIFVFILISNWLSVLPVQYTDEHTELLKPAAADINYVLALALFVFVCYHAAGIWRRGIV
ATP6_MYCTU      RIAPFVLPLAVTIFVFILISNWLAVLPVQYTDKHTELLKSAAADINYVLALALFVFVCYHTAGIWRRGIV
ATP6_MYCBO      RIAPFVLPLAVTIFVFILISNWLAVLPVQYTDKHTELLKSAAADINYVLALALFVFVCYHTAGIWRRGIV
ATP6_PROM9      KVYRDWMPFIGTLFLFVFVSNWGGALIPWRLIKPSGELGAPTADINTTIALALLVSLSYFYAGLSNKGW-
ATP6_PROM5      KVYRDWMPFIGTLFLFVFVSNWGGALIPWRLIKPSGELGAPTADINTTIALALLVSLSYFYAGLSNKGW-
ATP6_PROM2      KVYRDWMPFIGTLFLFVFVSNWGGALIPWRLIKPSGELGAPTADINTTIALALLVSLSYFYAGLSNKGW-
ATP6_PROM0      KVYRDWMPFIGTLFLFVFVSNWGGALIPWRLIKPSGELGAPTADINTTIALALLVSLSYFYAGLSNKGW-
ATP6_MYCMM      RIAPFVLPLAVTIFVFILISNWLSVLPVQYTDEHTELLKPAAADINYVLALALFVFVCYHAAGIWRRGIV
ATPI_CHAVU      SEYRPWIPFIGTMFLFIFVSNWSGALIPFKLVQLPNGLAAPTNDINTTVALALLTSVAYFYAGLRKKGLS
ATP6_XANP2      EGMVFFPLVF-SLFTFVLVSNVVGLIPYTFTV---------TAHLIVTAAMALLVIGTVIVYGFVRHGFL
ATP6_ARCB4      KNARTYMPLIGSLALVIFVSNMIGVIPGFE---------APTSNINFTLSLALIVFVYYNYLGIKKNGFV
ATPI_CHLAT      EEYRSWVPFVGTLFLFIFISNWSGALIPWRLIEPSGELAAPTNDINTTVALALLTSVAYFYAGLSKKGLS
ATP6_SYNPX      KYYRDWLPFIGTLFLFIFISNWGGALIPWKIIEPEGELGAPTADINTTVAMALLVSLAYFYAGLSRKGL-
ATPI_RHDSA      EEYRPWVPYIATVFLFIFGANWAGALIPWKLIQPEGELAAPTNDINVTVALALLTSLSYFYAGLSKKGIG
ATP6_WOLPP      KGLEHIPLIFT-VFIFILSCNLVGVLPYSFTV---------TSHVIVTFALSMVVFTYITIVGFKERGVE
ATPI_GUITH      EDYRPWVPYISTVFLFIFGANWAGALIPWKLIQPEGELAAPTNDINVTVALALLTSISYFYAGISKKGIS
ATP6_WOLPM      KGLQHIPLIFT-VFIFILSCNLVGVLPYSFTV---------TSHVIVTFALSMVVFIYITIVGFKEREVE
ATPI_NEPOL      ESRK-WVPYLGTLFLFIFVSNWSGALVPWRLIELPNGLGAPTADINTTVALALMTSTAYFYAGLTKKGFG
ATPI_OCHNE      YHYRPWVPFVGTLFLFIFVANWLGALIPWKLIHPEGELAAPTNDINTTVALSLLTSISYFYAGFKEKGLG
ATPI_ANGEV      EEYRPWVPFIGTMFLFIFVSNWSGALFPWRIIQLPHGLAAPTNDINTTVALALLTSVAYFYAGLHKRGLS
ATP6_SYNPW      KAYRDWLPFVGTLFLFIFVCNWGGALIPWRLVELPNGLGAPTADINTTVAMALLVSLSYFYAGLSRKGL-
ATP6_SYNP1      HEYRAWVPFVGTLFLFIFVCNWSGALVPWKLIEPEGELAAPTNDINTTXXXXXXXXXXXXXXGLRKRGLK
ATPI_SCEOB      EEYLKWVPYLGTVFLFIFVSNWSGALLPWALIELPNGLAAPTNDINTTVALALLTSISYFYAGIRKKGLR
ATP6_CHLT3      GYER-FMPFLLTIFFFILVCNLIGLVP---------YSATATGNINVTATLAIFTFLVTQASAIRAHGFL
ATPI_OLTVI      EDYLSWVPFLGTIFLFVFVSNWSGALVPWALIEPSGELAAPTNDINTTVALALLTSIAYFYAGINKKGLG
ATP6_WOLWR      KGLQHIPLIFT-VFIFILSCNLVGVLPYSFTV---------TSHVIVTFALSMVVFIYITIVGFKERGVE
ATP6_SYNSC      KYYRDWLPFIGTLFLFIFVSNWGGALIPWKIFEPEGELGAPTADINTTVAMALLVSLAYFYAGLSRKGL-
ATP6_NITSB      SYAKKYLPLVATLGLFIFFAN------LMEIIPG---FEPPSGNINFTLALALIVFIYYNFEGIRKNGVI
ATP6_CAMJD      KGVRKYLPLVATLGIIVFFSNIIGILPGFH---------APTASLNLTLSLAIIVFVYYHFEGIRAQGFI
ATPI_CYACA      KYYKSWVPFISTLFLFIFVSNWLGALVPWKLIKPEGELAAPTNDINTTVALAMLTSVSYFYAGLSKKGLR
ATP6_PROMO      -WKKKYFTYIGTLFLFLLISNIVGFSSENGVFSIAPALRTPTADLNTTVGLALLTTYSFIAASFRTSGFF
ATP6_FRASN      ERGRTFSPYLTILFCFILVSNVMAVIPVAQ--------FPTTSRIALPMILAAVSWFIFNIVGIREHGAG
ATPI_STAPU      EEYRDWVPFVGTLFLFIFVSNWSGALVPWKLIELPHGLAAPTNDINTTVALALLTSGAYFYAGFHKRGLS
ATP6_RHOE4      EQGKRFLPVITTIF-FIVVASNMASIIPFLNI-------SPNARIGMPLVLAALAYIVFNYVGIKKYGFF
ATP62_SYNP2     QEPEPYLAFVGTLFLFILTANLLTVVPGYQ---------APTGSLSTTTALAIAVFIAVPIYGIRQRGIL
ATP6_PROMA      KVYRDWMPFIGTLFLFIFVSNWGGALIPWKLIEPSGELGAPTADINTTVALALLVSLSYFYAGLSNKGL-
ATPI_PSINU      EEYRPWVPFIGTLFLFIFVSNWSGALFPWKIIQLPHGLAAPTNDINTTVALALLTSVAYFYAGLHKKGLS
ATPI_PHAVU      EY-GPWVPFIGTLFLFIFVSNWSGALFPWKIIQLPHGLAAPTNDINTTVALALLTSVAYFYAGLSKKGLA
ATPI_MARPO      EEYRPWVPFIGTMFLFIFVSNWSGALFPWRVFELPNGLAAPTNDINTTVALALLTSVAYFYAGLHKKGLS
ATPI_MESVI      EDYRSWVPFIGTIFLFIFVSNWSGALVPWKLIEIPNGLAAPTNDINTTAALALLTSISYFYAGFSKKGL-
ATPI_GALSU      PHYRDWVPFIGTLFLFIFVSNWSGALIPWKMIEGE--LSAPTNDINXXXXXXXXXXXXYFYAGISKKGLR
ATP6_PROM4      KVYRDWMPFIGTLFLFIFVSNWGGALVPWRLIRPSGELGAPTADINTTVALALLVSLSYFYAGLSNKGL-
ATP6_MAGSA      EGRK-YFPFIFSLFMFVLFGNLLGMM-PIPVIGFTY-----TSHVIVTFAMALVVFVGVTVIGFARHGFF
ATP6_ANAMM      EGLR-YIPLVMTTFLFVLACNLVGILP---------FGFTATSHLSVTLALSLVVCTAITVIGFRHQGFL
ATP61_PROA2     RQPEKYLSYLATLFLFVATA------VLFTIIPG---YEPPTGSLSTTAALALSVFVAVPLYGIERVGFG
ATP6_SULNB      ELARKYLPLVAAVGLFIFVSNVIGIIPGFE---------SPTSNINVTLPLALMVFVYYNYEGIKKHGVV
ATP6_BARQU      QGMQFFPLVF-SLFTFILVANFIGLFPYFYTI---------TSQIMITFSLAMLVILTVVGYGFRKHGFL
ATPI_STIHE      EEYLKWVPFIGTIFIFVLVSNWSGALLPWRLIEIPNGLAAPTNDINTTVALALLTSISYFYAGIRKKGLG
ATP6_SYNR3      KVYRDWLPFIGTLFLFIFVSNWGGALIPWRIVHPSGELGAPTADINTTVAMALLVSLAFFYAGLSNKGL-
ATP6_RICTY      KGRKFIPLVF-SLFIFILFCNLLGM---------TPYSFTATSHIIVTFTLALLIFLTVTIV-----GFI
ATP6_CAMHC      KLARKYMPLIATIGFIVFLSNIIGLIPGFE---------APTAXXXXXXXXXXCVFFYYHFEGIREKGFI
ATPI_CHAGL      EEYRSWIPFVGTLFLFIFVSNWSGALIPWKVIELPNGLAAPTNDINTTVALALLTSVAYFYAGLNKKGLS
ATP6_TRIEI      KDYRPWVPFIGTLFLFIFVSNWSGALVPWKVIEPSGELAAPTSDINTTVALALLTSIAYFYAGISKKGL-
ATP6_THEEB      HEYRAWVPFVGTLFLFIFVCNWSGALVPWKLIEPEGELAAPTNDINTTXXXXXXXXXXXXXXGLRKRGLK
ATP6_SYNFM      EGRFVFPLI-ASLGMFILFSNYLGMIPG---------FFSPTANINTTAACALISVVFTHVIGIKFHGVK
ATP6_HAEIN      RNV--VAPLALTIFCWVFIMNAIDLLPQFAGLFGIHYLRAPTADISATLGMSICVFFLILFYTIKSKGFK
ATP6_HAEIG      RNV--VAPLALTIFCWVFIMNAIDLLPQFAGLFGIHYLRAPTADISATLGMSICVFFLILFYTIKSKGFK
ATP6_HAEIE      RNV--VAPLALTIFCWVFIMNAIDLLPQFAGLFGIHYLRAPTADISATLGMSICVFFLILFYTIKSKGFK
ATP6_HAEI8      RNV--VAPLALTIFCWVFIMNAIDLLPQFAGLFGIHYLRAPTADISATLGMSICVFFLILFYTIKSKGFK
ATP62_CHLTE     GYEK-FLPYLLTVFFFILVCNLLGLIP---------YGATATGNINVTLTLSVFTFVITQFSAFKAQGVK
ATPI_CITSI      EY-GPWVPFIGTLFLFIFVSNWSGALLPWKIIELPHGLAAPTNDINTTVALALLTSIAYFYAGLSKKGLG
ATP6_HAEDU      RHM--IAPLALTIFCWVFIMNAIDLLPQLANMFGIHYLRAPTADISATLGMSICVFGLILFYTVKSKGFN
ATP6_DESMR      KGRKVYP--FLCLFLFIITGNLIGLVPGL---------DSPTNNVNTNAAMALTVFAYYNFWGIRMWG-A
ATP6_ACTPJ      RNV--IAPLALTIFCWVFIMNAIDLLPQLANMFGIHYLRAPTADISATLGMSICVFFLILFYTVKSKGFG
ATP6_ACTP7      RNV--IAPLALTIFCWVFIMNAIDLLPQLANMFGIHYLRAPTADISATLGMSICVFFLILFYTVKSKGFG
ATP6_ACTP2      RNV--IAPLALTIFCWVFIMNAIDLLPQLANMFGIHYLRAPTADISAPLGMSICVFFLILFYTVKSKGFG
ATP6_PSEE4      RNPLIAPLA-LTIFAWVFLMNSIDLVPVAMAISGDEFRAVPTTDPNATLAMSLSVFALIIIYSIKVKGLG
ATP6_EHRCR      KGLQYIPLVFT-IFTFIATCNLLGVLPLGFTV---------TSHIAVTFAISMVVFI-----SVTAIGFK
ATP6_DESPS      EMADKFFPMIATFALYIAVANLIGLIPGFM---------SPTASINTTLALTLIVWATHHVIGFKEHGLG
ATPI_PHYPA      EEYRPWVPFIGTMFLFIFVSNWSGALLPWRVLELPHGLAAPTNDINTTVALALLTSVAYFYAGLHKRGLN
ATPI_CRYJA      EEYGPWVPFIGTMFLFIFVSNWAGALFPWGIIKLPHGLAAPTNDINTTVALALLTSVAYFYAGFTKRGLG
ATPI_BIGNA      EDYLNWVPFLGAVFLFIFVSNWGGALLPWKLLELPNGLAAPTNDINTTVALALLTSFSYFYAGISKKGIS
ATP6_CHLPB      GYEK-HMPYLLTVFVFILVLNLLGLIP---------YGASATGNINVTLTLSVFTFFITQVSAIKSNGIK
ATPI_MANES      EY-GPWVPFIGTMFLFIFVSNWAGALLPWKIIQLPHGLAAPTNDINTTVALALLTSIAYFYAGLSKKGLG
ATPI_JASNU      EY-GPWVPFIGTMFLFIFVSNWSGALLPWKIIQLPHGLAAPTNDINTTVALALLTSVAYFYAGLTKRGLS
ATPI_DIOEL      EY-GPWVPFIGTMFLFIFVSNWSGALLPWKIIQLPHGLAAPTNDINTTVALALPTSVAYFYAGLTKKGLG
ATPI_CYCTA      EEYGPWVPFIGTMFLFILVSNWSGALLPWKIIQLPHGLAAPTNDINTTVALALLTSVAYFYAGLAKKGLG
ATP6_RUBXD      EGRKWFP-YSLTLFIFLLVLNIIGLFPNSYPV---------TSNISXXXXXXXXXXXXXQYEGVRRNGLV
ATP6_RHOFD      RDPKKYLGFLGTLFLFVATAS---LCT---VIPG---YEPPTGSLSTTAALAFCVFVAVPFFGIKDQGLG
ATP6_ANAVT      KEYRPWVPFVGTLFLFIFVSNWSGALVPFKLIHPEGELAAPTSDINXXXXXXXXXXXXYFYAGFSKKGL-
ATP6_ANASP      KEYRPWVPFVGTLFLFIFVSNWSGALVPFKLIHPEGELTAPTSDINXXXXXXXXXXXXYFYAGFSKKGL-
ATPI_CHLVU      EDYLKWVPFLGTIFLFIFVSNWSGALIPWRILELPNGLAAPTNDINTTVALALLTSIAYFYAGISKKGLG
ATPI_ADICA      EGYRPWVPFIGTMFLFIFASNWSGALLPWRVIQLPHGLAAPTNDINTTVALALLTSVAYFYAGLYKRGFS
ATPI_PEA        EY-GPWVPFIGTLFLFIFVSNWSGALLPWKIIKLPHGLAAPTNDINTTVALALLTSVAYFYAGISKKGLA
ATPI_OSTTA      DYL-EWTPFIGTLFLFIFVSNWSGALIPWKLIELPHGLGAPTNDINXXXXXXXXXXXXYFYAGLKKKGLE
ATPI_CICAR      EY-GPWVPFIGTLFLFIFVSNWSGALLPWKIIKLPHGLAAPTNDINTTVALALLTSVAYFYAGISKKGLA
ATP6_HALHL      K-SKVIAPLALTIFCWVFLSNLMDLVPSIMMAVGVDYWKIPSVDLNFTFGLSLSVLALIIIYGVMGQGVG
ATP6_GLOVI      KQYRSWVPLIGTIFLFVLFANWLGQLPLRLFHIPEGELASPTNDINTTVALSLIALVSYIYAGLRKSGFG
ATP6_CAMJR      KGARKY---------LPLVATLXXXXXXXXXXXXXPGFHSPTASLNLTLSLAIIVFVYYHFEGIRAQGFV
ATP6_CAMJJ      KGARKY---------LPLVATLXXXXXXXXXXXXXPGFHSPTASLNLTLSLAIIVFVYYHFEGIRAQGFV
ATP6_ACTSZ      RNV--VAPLALTIFCWVFIMNAIDLLPQLAGLFGIHYLRAPTADISATLGMSLCVFALILFYTVKSKGFG
ATPI_EUGGR      KEYSKWVPYIGTMFLFIFVSNWSGALIPWKIIELPNGLGAPTNDINTTAGLAILTSLAYFYAGLNKKGLT
ATP6_WOLSU      EKARKYLPLTGTIAILVFFSNAIGIIPGFE---------SPTSSLNYTLTLALIVFVYYNFEGIRTHGFI
ATP6_RICCN      KGRKFIPLVF-SLFIFILFCNLLGM---------TPYSFTTTSHIIVTFTLAILVFLMVTIVGFVKHGLR
ATP6_PSEMY      KNPLVAPLA-LTIFVWVFLMNSLDYIPGLAHAMGLPYFKIPTADPNGTFGISLGVFLLIIFYSIKVKGVG
ATP6_PROMM      KAYRDWMPFIGTLFLFIFVSNWGGSLVPWKLIHPSGELGAPTADINTTVALALLVSLSYFYAGLSRKGL-
ATP6_PROM3      KAYRDWMPFIGTLFLFIFVSNWGGSLVPWKLIHPSGELGAPTADINTTVALALLVSLSYFYAGLSRKGL-
ATPI_PHAAO      EY-GPWVPFIGTMFLFIFVSNWSGALLPWKIIKLPHGLAAPTNDINTTVALALPTSVAYFYAGLRKKGLG
ATPI_HELAN      EY-GPWVPFIGTMFLFIFVSNWSGALLPWKIIQLPHGLAAPTNDINTTVALALLTSVAYFYAGLTKKGLS
ATPI_CHLRE      EDYLKWVPFLGTIFLFIFVSNWSGALLPYRLIEIPNGLAAPTNDINTTVALALLTSISYFYAGISKKGLG
ATP6_RICPU      KGRKFIPLVF-SLFIFILFCNLLGM---------TPYSFTATSHIIVTFTLAILVFLIVTIVGFVKHGLR
ATP6_NITMU      -------------------------------------YEPPTGSLSTTVALAICVFVAVPFYGIREQGLR
ATP6_CAMFF      DELRKYLPLVATIGLIVLTSNVIGIIPGFE---------APSSSLNLTLCLALSVFLYYNFEGIRTQGII
ATPI_LEMMI      EY-GPWVPFIGTMFLFIFVSNWSGALLPWKIIQLPHGLAAPTNDINTTVALALLTSVAYFYAGLSKKGLS
ATPI_GOSBA      EY-GPWVPFIGTMFLFIFVSNWSGALLPWKIIQLPHGLAAPTNDINTTVALALLTSVAYFYAGLSKKGLG
ATPI_EUCGG      EY-GPWVPFIGTMFLFIFVSNWSGALLPWKIIELPHGLAAPTNDINTTVALALLTSVAYFYAGLTKKGLS
ATPI_ANTFO      EEYRPWVPFIGTMFLFIFVSNWSGALLPWRIFELPHGLAAPTNDINTTVALALPTSVAYFYAGLRKKGLS
ATP6_RICM5      KGRKFIPLVF-SLFIFILFCNLLGM---------TPYSFTTTSHIIVTFTLAILVFLTVTIVGFVKHGLR
ATP6_RICFE      KGRKFIPLVF-SLFIFILFCNLLGM---------TPYSFTATSHIIVTFTLAILVFLTVTIVGFVKHGLR
ATP6_COXBU      RSL--VAPLALTIFIWVFLMNFMDLVPRLFQMGGVEHFKAPTADPTLTFAMSITVFVLVIFYNFKMKGAI
ATP6_COXBR      RSL--VAPLALTIFIWVFLMNFMDLVPRLFQMGGVEHFKAPTADPTLTFAMSITVFVLVIFYNFKMKGAI
ATP6_COXB1      RSL--VAPLALTIFIWVFLMNFMDLVPRLFQMGGVEHFKAPTADPTLTFAMSITVFVLVIFYNFKMKGAI
ATP6_CAMJE      KGARKY---------LPLVATLXXXXXXXXXXXXXPGFHAPTASLNLTLSLAIIVFVYYHFEGIRAQGFV
ATP6_CAMJ8      KGARKY---------LPLVATLXXXXXXXXXXXXXPGFHAPTASLNLTLSLAIIVFVYYHFEGIRAQGFV
ATP6_BUCAP      MYQGKNPLIALTVFVWVFLMNLMDLIP----IDFFPFISEPSADINITLSMSLGVFILILFYSVKMKGLE
ATP62_PELLD     GY-EAHLPYLLTVFMFILLCNILGLIP---------YGATATGNINVTLTLAVFTFFITQAASLKAHGLK
ATPI_COFAR      EY-GPWVPFIGTLFLFIFVSNWSGALLPWKIIQLPHGLAAPTNDINTTVALALLTSVAYFYAGITKKGLS
ATPI_CARPA      EY-GPWVPFIGTMFLFIFVSNWSGALLPWKIIQLPHGLAAPTNDINTTVALALLTSVAYFYAGLTKKGLG
ATP6_PSEAE      LALTVFVWIFLLNLIDLVPVDYLPMLAAKITGDEHLFFRAATTDPNATLGLSISVFALIVFYSIKVKGIG
ATP6_PSEAB      LALTVFVWIFLLNLIDLVPVDYLPMLAAKITGDEHLFFRAATTDPNATLGLSISVFALIVFYSIKVKGIG
ATP6_PSEA8      LALTVFVWIFLLNLIDLVPVDYLPMLAAKITGDEHLFFRAATTDPNATLGLSISVFALIVFYSIKVKGIG
ATP6_PSEA7      LALTVFVWIFLLNLIDLVPVDYLPMLAAKITGDEHLFFRAATTDPNATLGLSISVFALIVFYSIKVKGIG
ATP6_COXB2      RSL--VAPLALTIFIWVFLMNFMDLVPRLFQMGGVEHFKAPTADPTLTFAMSITVFVLVVFYNFKMKGAI
ATP62_PELCD     KGMVYFPLI-ATLALFLLVSNLIGLIPG---------FAPPTASLNTNAALAVGVFLVTHIVGVREHGIR
ATPI_SPIOL      EY-RPWVPFIGTMFLFIFVSNWSGALLPWKIIQLPHGLAAPTNDINTTVALALLTSVAYFYAGLTKKGLG
ATPI_CALFG      EY-GPWVPFIGTMFLFIFVSNWSGALLPRKIIQLPHGLAAPTNDINTTVALALLTSVAYFYAGLTKKGLG
ATPI_PORYE      HEYRPWVPYIATLFLFILGCNWAGALIPWKLIHPEGELAAPTNDINXXXXXXXXXXXXYFYAGLSKKGLG
ATP6_PSYA2      SYSGTSKLIALTIFVWIFLMNLMGLAGQIGAMMGHDFKIVPTTDPNITLGMSFSVFILILFYSIKEKGLG
ATP6_PROMT      KVYRDWMPFIGTLFLFIFVSNWGGALVPWKLIKPSGELGAPTADINTTVALALLVSLSYFYAGLSNKGL-
ATP6_PROM1      KVYRDWMPFIGTLFLFIFVSNWGGALVPWKLIKPSGELGAPTADINTTVALALLVSLSYFYAGLSNKGL-
ATPI_PORPU      HEYRPWVPYIATLFLFILGCNWAGALIPWKLIHPEGELAAPTNDINXXXXXXXXXXXXYFYAGLSKKGLG
ATPI_OENPA      EY-GPWVPFIGTMFLFIFVSNWSGALLPWKLVELPHGLAAPTNDINTTVALALLTSVAYFYAGLSKKGLG
ATPI_OENGL      EY-GPWVPFIGTMFLFIFVSNWSGALLPWKLVELPHGLAAPTNDINTTVALALLTSVAYFYAGLSKKGLG
ATPI_OENEH      EY-GPWVPFIGTMFLFIFVSNWSGALLPWKLVELPHGLAAPTNDINTTVALALLTSVAYFYAGLSKKGLG
ATPI_OENBI      EY-GPWVPFIGTMFLFIFVSNWSGALLPWKLVELPHGLAAPTNDINTTVALALLTSVAYFYAGLSKKGLG
ATPI_OENAR      EY-GPWVPFIGTMFLFIFVSNWSGALLPWKLVELPHGLAAPTNDINTTVALALLTSVAYFYAGLSKKGLG
ATPI_NUPAD      EEYGPWVPFIGTLFLFIFVSNWSGALLPWRIIQLPHGLAAPTNDINTTVALALLTSVAYFYAGLTKKGLG
ATPI_LEPVR      EY-GPWVPFIGTLFLFIFVSNWSGALLPWKIIQPQGELAAPTNDINTTVALALLTSVAYFYAGLSKKGLG
ATPI_LACSA      EY-GPWVPFIGTMFLFIFVSNWSGALLPWKIIQLPHGLAAPTNDINTTVALALLTSVAYFYAGLSKKGLG
ATPI_DRANE      EY-GPWVPFIGTLFLFIFVSNWSGALLPWKIIQPQGELAAPTNDINTTVALALLTSVAYFYAGLSKKGLG
ATPI_CUCSA      EY-GPWVPFIGTMFLFIFVSNWSGALLPWKIIQLPHGLAAPTNDINTTVALALLTSVAYFYAGLSKKGLS
ATP6_SHEFN      LALTIFVWIFMMNFMDMIPVDWLPSLALLAGVPYLKVVPTTDVNITFSLALGVFVLIIYY--SIKVKGVS
ATP6_RICRS      KGRKFIPLVF-SLFIFILFCNLLGM---------TPYSFTATSHIIVTFTLAILVFLIVTIVGFVKHGLR
ATP6_RICRO      KGRKFIPLVF-SLFIFILFCNLLGM---------TPYSFTATSHIIVTFTLAILVFLIVTIVGFVKHGLR
ATP6_ELUMP      -HGKKLTPYFCTLFIFLLFSNSLGMIPQMRTITG-----SISVTIGMALTSLSLIIFL----GVKQNGLL
ATP6_COXBN      RSL--VAPLALTIFIWVFLMNFMDLVPRLFQMGGVEHFKAPTADPTLTFAMSITVFVLVIFYNFKMKGAI
ATP6_CLOAB      KFMN-----------FVPIIGTMAVFILFLNLTGLVGIEPATKDISVTAGFALVSAFLINATAIKRIGVG
ATPI_VITVI      EY-GSWVPFIGTMFLFIFVSNWSGALLPWKIIQLPHGLAAPTNDINTTVALALLTSVAYFYAGLTKKGLG
ATPI_PELHO      EY-GPWVPFIGTLFLFIFVSNWSGALFPWKIIQPQGELAAPTNDINTTVALALLTSVAYFYAGLTKKGLA
ATPI_NASOF      EY-GPWVPFIGTLFLFIFVSNWSGALLPWKIIQPQGELAAPTNDINTTVALALLTSVAYFYAGLSKKGLG
ATPI_LOBMA      EY-GPWVPFIGTLFLFIFVSNWSGALLPWKLIQPQGELAAPTNDINTTVALALLTSVAYFYAGLSKKGLG
ATPI_GOSHI      EY-GPWVPFIGTMFLFIFVSNWSGALLPWKIIQLPHGLAAPTNDINTTVALALLTSVAYFYAGLSKKGLG
ATPI_DAUCA      EY-GPWVPFIGTMFLFIFVSNWSGALLPWKIIQLPHGLAAPTNDINTTVALALLTSVAYFYAGISKKGLG
ATPI_CRUWA      EY-GPWVPFIGTLFLFIFVSNWSGALLPWKIIQPQGELAAPTNDINTTVALALLTSVAYFYAGLSKKGLG
ATPI_BARVE      EY-GPWVPFIGTLFLFIFVSNWSGALLPWKIIQPQGELAAPTNDINTTVALALLTSVAYFYAGLSKKGLG
ATPI_ARATH      EY-GPWVPFIGTLFLFIFVSNWSGALLPWKIIQPQGELAAPTNDINTTVALALLTSVAYFYAGLSKKGLG
ATPI_OLIPU      EY-GPWVPFIGTLFLFIFVSNWSGALLPWKIIQPQGELAAPTNDINTTVALALLTSVAYFYAGLSKKGLG
ATPI_BUXMI      EY-GPWVPFIGTMFLFIFVSNWSGALLPWKIIQLPHGLAAPTNDINTTVALALLTSVAYFYAGLTKKGLG
ATPI_ACOCL      EY-GPWVPFIGTMFLFIFVSNWSGALLPWKLIELPHGLAAPTNDINTTVALALPTSVAYFYAGLTKKGLG
ATPI_ACOAM      EY-GPWVPFIGTMFLFIFVSNWSGALLPWKLIELPHGLAAPTNDINTTVALALPTSVAYFYAGLTKKGLG
ATP6_YERE8      MYSKVIAPLALTVFVWVLLMNMMDLLPDLLPYIGEHVFGLPTADVSITLSMALGVFILILFYSIKMKGVG
ATP6_THIDA      SFSHQNALLALTVFMWVFLMNLMDLLPVVATMAGIPYLKSTDPNVTFGLSLSFFLVLYYSVKMKGAGGFF
ATP6_ANAPZ      GGLR-YIPFVLSIFLFVLACNIIGILPLGFTA---------TSHVSVTLALSVVVCASVTVLGFNHQGFL
ATPI_SOYBN      EY-GPWVPFIGTLFLFIFVSNWSGALLPWKIIQLPHGLAAPTNDINTTVALALLTSIAYFYAGLSKKGLA
ATPI_POPTR      EY-GPWVPFIGTLFLFIFVSNWSGALLPWKIIELPHGLAAPTNDINTTVALALLTSIAYFYAGLSKKGLG
ATPI_POPAL      EY-GPWVPFIGTLFLFIFVSNWSGALLPWKIIELPHGLAAPTNDINTTVALALLTSIAYFYAGLSKKGLG
ATPI_PANGI      EY-GPWVPFIGTMFLFIFVSNWSGALLPWKIIQLPHGLAAPTNDINTTVALALLTSVAYFYAGLTKKGLG
ATPI_LOTJA      EY-GPWVPFIGTLFLFIFVSNWSGALLPWKIIQLPHGLAAPTNDINTTVALALLTSVAYFYAGISKKGLA
ATPI_GUIAB      EY-GPWVPFIGTMFLFIFVSNWSGALLPWKIIQLPHGLAAPTNDINTTVALALLTSVAYFYAGLTKKGLG
ATPI_AMBTC      EEYGPWVPFIGTMFLFIFVSNWSGALLPRKIIEPQGELAAPTNDINTTVALALPTSVAYFYAGISKKGLG
ATP6_PASMU      RHA--VGPLALTIFCWVFIMNAIDLLPQLAHLFGIEYLRAPTADISGTLGLSIGVFFLIIFYTIKSKGMS
ATP6_MARAV      KNPLIAPLA-LTIFVWILLMNILKLIPSIAHALGLEYFKIPTTDPNATFGMSIGVFLLILFYSFKVKGVS
ATP6_MANSM      RNV--VAPLALTIFCWVFIMNAIDLLPQLAGLFGIHYLRAPTADISATLGMSLCVFALILFYTVKSKGFG
ATP6_DICNV      LALTLFCWIFFWNVMDLIPVDLLPSMAKLIGIPYLKIVPSTDPNATFALSISVVLITLVYLRAMGTHPFE
ATP62_OCHA4     KGMAFFPLVF-SLFLFILFANLIGMFPYAFTV---------TSHIIVTFALAMLVFLTVTIYGLVRHGFR
ATPI_TRACE      EY-GPWVPFIGTIFLFIFVSNWSGALLPWKIIQLPHGLAAPTNDINTTVALALLTSVAYFYAGLAKKGLG
ATPI_PINKO      EEYGPWVPFIGTMFLFIFVSNWSGALLPLKLPQGE--LAAPTNDINTTVALALLTSVAYFYAGLAKKGLG
ATPI_MORIN      EY-GPWVPFIGTMFLFIFVSNWSGALLPWKIIQLPHGLAAPTNDINTTVALALLTSVAYFYAGLTKKGLG
ATPI_FAGEA      EY-RPWVPFIGTMFLFIFVSNWSGALLPWKIIQLPHGLAAPTNDINTTVALALLTSVAYFYAGLTKKGLG
ATPI_AETCO      EY-GPWVPFIGTLFLFIFVSNWSGALLPWKIIQPQGELAAPTNDINTTVALALLTSVAYFYAGLSKKGLG
ATP6_STRLI      KEGEKYVPLVVSLFFFVWMMNLWSIIPVAQF--------PVTSIIAYPAVLAAIVYVTWITLTFKRQGFV
ATP6_SERP5      MYSKVIAPLALTVFVWVFLMNMMDLLPDLLPFIGEHVFGLPTADVSITLSMALGVFILILFYSIKMKGVG
ATP6_RICPR      KGRKFIPLVF-SLFIFILFCNLLGM---------TPYSFTATSHIIVTFTLALLIFLTVTIVGFIKHGFL
ATP6_PSYWF      SYNGTSKLIALTIFVWIFLMNLMDLMPKVGAAMGHDFKIVPTTDPNITLGMSFSVFALIIYYSIKEKGLG
ATPI_PINTH      EEYGPWVPFIGTMFLFIFVSNWSGALLPLKLPQGE--LAAPTNDINTTVALALLTSVAYFYAGLTKKGLG
ATPI_AETGR      EY-GPWVPFIGTLFLFIFVSNWSGALLPWKIIQPQGELAAPTNDINTTVALALLTSVAYFYAGLSKKGLG
ATP6_ACIBL      GY-ETYTSYIVTLGVFILSMNLIGLIPGFE---------APTAFPSVPLGCALVTWFFYHVHGLRENGVI
ATPI_SOLLC      EY-GPWVPFIGTMFLFIFVSNWSGALLPWKIIQLPHGLAAPTNDINTTVALALLTSVAYFYAGLTKRGLG
ATPI_PIPCE      DY-GPWVPFIGTMFLFIFVSNWSGALFPWKIIQLPHGLAAPTNDINTTVALALPTSVAYFYAGLTKKGLG
ATP6_SYNJA      KNFRPWVPYVGTLFLFIFVSNWMGNLFPWKLIPPEGELASPTNDINTTAGLALLTSVMYFVAGISKRGFK
ATP6_MARMS      K-SKVIAPLALTIFVWVFLMNFMDLIP-VDFLPATAQWIGPTTDINATLGMSLSVFVLIVFYSIKVKGIS
ATP6_DICDI      PGILFFP-FIMSLFLFVLTLNVMGLIPLSFTVTG---------QLLVTFTLAITIMIGITIWGFRIHGIK
ATP6_BARBK      QGMKFFPLVF-SLFVFILVANFIGLFPYFYTI---------TSQIMITFSLAMLVIL-----TVIGCGFY
ATP6_ALHEH      RLIAPLALTIFCWIFLMNLMDPIDMVPSLMYAAGVDYFKIPTVDLNVTFALSFLIIAYSXXXXXXXXXXX
ATPI_NYMAL      EEYGPWVPFIGTLFLFIFVSNWSGALLPWRIIQLPHGLAAPTNDINTTVALALPTSVAYFYAGLTKKGLG
ATPI_ILLOL      EY-GPWVPFIGTMFLFIFVSNWSGALLPWKIIQLPHGLAAPTNDINTTVALALPTSVAYFYAGLTKKGLG
ATP6_SYMTH      RYARQYMPLLCTLFLFIIVSNYLGVVPTV----GYGLFA-PTGRWGTTLGLGXXXXXXXXXXXXRTLGAG
ATP6_PSYCK      SYSGTSKLIALTIFVWIFLMNLMDLLPQIGALMGHDFKIVPTTDPNITLGMSFSVFILILFYSIKEKGLG
ATP6_PSEU5      RNPLIAPLA-LTIFVWVFLMNSLKWIP-VDYIPGIAHLLGPTADPNGTFGLSLGVFILILFYSFKVKGFG
ATP6_NOSP7      KEYRPWVPFIGTLFLFIFVSNWSGALIPWKLIKPSGELAAPTNDINXXXXXXXXXXXXYFYAGFSKRGFK
ATP6_MYXXD      EEGPRYVPFLLTVFFFILFMNMLGMVP---------WMATATGNLAVTMALALCTFVITQVAGIRAAGLG
ATP6_DICCI      PGILFFP-FIMSLFLFVLTLNVMGLIPLSFTVTG---------QLLVTFTLAITIMIGITIWGFRIHGIK
ATP61_SYNP2     KEYRPWVPFIGTLFLFIFIANWSGALVPWKIIGPEGELAAPTNDINXXXXXXXXXXXXYFYAGFKKRGI-
ATPI_PSEAK      EEYVKWIPFLGTLFLFIFVSNWSGALIPWHIFEIPNGLAAPTNDINXXXXXXXXXXXXYFYAGFSKKGLG
ATPI_LIRTU      EY-GPWVPFIGTMFLFIFVSNWSGALLPRKIIQLPHGLAAPTNDINTTVALALPTSMAYFYAGFTKKGLS
ATPI_TOBAC      EY-GPWVPFIGTMFLFIFVSNWSGALLPWKIIQLPHGLAAPTNDINTTVALALLTSVAYFYAGLTKKGLG
ATPI_SOLTU      EY-GPWVPFIGTMFLFIFVSNWSGALLPWKIIQLPHGLAAPTNDINTTVALALLTSVAYFYAGLTKKGLG
ATPI_SOLBU      EY-GPWVPFIGTMFLFIFVSNWSGALLPWKIIQLPHGLAAPTNDINTTVALALLTSVAYFYAGLTKKGLG
ATPI_RANMC      EY-GPWVPFIGTMFLFIFVSNWSGALLPWKIIQLPHGLAAPTNDINTTVALALPTSVAYFYAGLTKKGLG
ATPI_PLAOC      EY-GPWVPFIGTMFLFIFVSNWSGALLPWKIIQLPHGLAAPTNDINTTVALALPTSVAYFYAGLTKKGLG
ATPI_NICTO      EY-GPWVPFIGTMFLFIFVSNWSGALLPWKIIQLPHGLAAPTNDINTTVALALLTSVAYFYAGLTKKGLG
ATPI_NICSY      EY-GPWVPFIGTMFLFIFVSNWSGALLPWKIIQLPHGLAAPTNDINTTVALALLTSVAYFYAGLTKKGLG
ATPI_LOLPR      EY-GPWVPFIGTMFLFIFVSNWSGALLPWKIIELPHGLAAPTNDINXXXXXXXXXXXXYFYAGLSKKGLS
ATPI_CHLSC      EY-GPWVPFIGTMFLFIFVSNWSGALLPRKIIQLPHGLAAPTNDINTTVALALPTSVAYFYAGLTKKGLG
ATPI_ATRBE      EY-GPWVPFIGTMFLFIFVSNWSGALLPWKIIQLPHGLAAPTNDINTTVALALLTSVAYFYAGLTKKGLG
ATP6_PSEPW      RSPVIAPLA-LTIFVWVFLMNAVDLVPQLAILISGDFRAVSTTDPNATLAMAFCVFALIIFYSIKVKGLG
ATP6_PSEPG      RSPVIAPLA-LTIFVWVFLMNAVDLVPQLAILISGDFRAVSTTDPNATLAMAFCVFALIIFYSIKVKGLG
ATP6_WOLTR      KGLKHIPLVFT-VFTFTLSCNLVGMLPYSFTV---------TSHVIVTFALSMIVFTYTTIVGFKEKGIN
ATP6_RHORU      EGMK-YFPYILTLFVFVFLGNMLGMLPYSFTF---------TSHIAVTAALAVGIFIAVTIIGFARHGFH
ATP6_RHORT      EGMK-YFPYILTLFVFVFLGNMLGMLPYSFTF---------TSHIAVTAALAVGIFIAVTIIGFARHGFH
ATP6_RHIEC      QGLKFFPLVF-SLFMFVLTANLLGMFPYFFTI---------TSQIIVTFALAILVISTVLIYGFYKHGF-
ATP6_EDWI9      MYHGKSKLIALTIFVWVFLMNLMDLVPDFLPYIAEHWMGLPALRVDVNITLSFILILFYSIKMKGVGGFV
ATP6_BUCBP      IYHGKNKLIALTIFVWIFLMNLMDLIPDLVPFIFQNFFETPTTDVNITISMSLVVFLLIIFYSIKIKGIK
ATPI_WHEAT      EY-GPWVPFIGTMFLFIFVSNWSGALLPWKIIELPHGLAAPTNDINXXXXXXXXXXXXYFYAGLSKKGLS
ATPI_SACOF      EY-GPWVPFIGTMFLFIFVSNWSGALLPWKIIELPHGLAAPTNDINXXXXXXXXXXXXYFYAGLSKKGLS
ATPI_SACHY      EY-GPWVPFIGTMFLFIFVSNWSGALLPWKIIELPHGLAAPTNDINXXXXXXXXXXXXYFYAGLSKKGLS
ATPI_MAIZE      EY-GPWVPFIGTMFLFIFVSNWSGALLPWKIIELPHGLAAPTNDINXXXXXXXXXXXXYFYAGLSKKGLS
ATPI_HORVU      EY-GPWVPFIGTMFLFIFVSNWSGALLPWKIIELPHGLAAPTNDINXXXXXXXXXXXXYFYAGLSKKGLS
ATPI_DRIGR      DY-GPWVPFIGTMFLFIFVSNWSGALLPRKIVQLPHGLAAPTNDINTTVALALPTSVAYFYAGLTKKGLG
ATPI_AGRST      EY-GPWVPFIGTMFLFIFVSNWSGALLPWKIIELPHGLAAPTNDINXXXXXXXXXXXXYFYAGLSKKGLS
ATP6_SYNJB      KNFRPWVPYVGTLFLFIFVSNWMGNLFPWKLIPPEGELASPTNDINTTAGLALLTSIMYFVAGISKRGLS
ATP62_VIBHB     AKDKLIGPLALTIFVWVLLMNAVDLLALTSAVGVEHFRDLPSADINITMSMALGVFILVLGYTFKNKGVK
ATP61_CYAA5     QQKADQFLPFITLFLFITMANLLTIFPVYQ---------SPAGXXXXXXXXXXCVFVAVPIYGIKNVGIT
ATPI_SORBI      EY-GPWVPFIGTMFLFIFVSNWSGALLPWKIIELPHGLAAPTNDINXXXXXXXXXXXXYFYAGLSKKGLS
ATPI_CUSEX      EY-GPWVPFIGTMFLFIFVSNWSGALLPWKILQLPHGLAAPTNDINXXXXXXXXXXXXYFYAGILKKGFE
ATPI_BRADI      EY-GPWVPFIGTMFLFIFVSNWSGALLPWKIIELPHGLAAPTNDINXXXXXXXXXXXXYFYAGLSKKGLS
ATP6_SINMW      QGMKFFPMVF-SLFMFILTANLLGMVPYFFTV---------TSQIIVTFALAVFVIGTVILYGFYKHGF-
ATP6_HAEPS      REV--VAPLALTVFCWVFVMNAIDLIPQFAALLGIDYLRAPTADISATLGMAICVFCLIIFYTIKSKGFS
ATP62_CYAA5     KHYRPWLPFIGTLFLFIFVSNWSGSLIPWRLIEPEGELAAPTNDINXXXXXXXXXXXXYFYAGLSKKGL-
ATPI_ORYSJ      EY-GPWVPFIGTMFLFIFVSNWSGALLPWKIIQLPHGLAAPTNDINXXXXXXXXXXXXYFYAGLSKKGLS
ATPI_ORYSI      EY-GPWVPFIGTMFLFIFVSNWSGALLPWKIIQLPHGLAAPTNDINXXXXXXXXXXXXYFYAGLSKKGLS
ATPI_ORYSA      EY-GPWVPFIGTMFLFIFVSNWSGALLPWKIIQLPHGLAAPTNDINXXXXXXXXXXXXYFYAGLSKKGLS
ATPI_CUSRE      EY-GPWVPFIGTLFLFIFVSNWSGALLPWKILQLPHGLAAPTNDINXXXXXXXXXXXXYFYAGISKKGLG
ATP6_RHOPS      EGMKFFPLVF-SLFMFIAVSNLIGIIPYTFTV------SSHXXXXXXXXXXXXXXXXXYGLYKNGLKFFK
ATP6_HAES2      DVRHQIGSLALTIFCWVFIMNAIDLIPQFAELLGIHYLRAPTADISATLGMSVCVFALIIFYTIKSKGLG
ATP6_CHLPD      GYEK-YLPYLLTVFMFVLLCNVLGLVP---------YGATATGNINXXXXXXXXXXXXXQIAALKAHGIK
ATP6_ACIAD      K-SRLIAPLALTIFVWIFLMNLMDLIPMLAQIVGAHVFGSTDPNITLGMSLSVFVLILFY--SIREKGIE
ATP62_PHOPR     TEDKLIGPLALTIFVWVFLMNSIDLLTRLFGVEHFRDLPSADVNVPVSMALGVFILIIGY--TLKNKGIV
ATP61_ACAM1     KEYRPWVPFIGTLFLFIFVSNWSGALFPWKLISPEGELAAPTNDINTTVALALCTSFVYFYAGFRKKGFR
ATP6_PECCP      MFHGKSKLIALTIFVWVFLMNLMDLLPSLLGYDPAHAYAVPTADVNITLSMALGVFILVLFYSIKMKGLG
ATP6_HAES1      DVRHQIGSLALTIFCWVFVMNAIDLIPQFAELLGIHYLRAPTADISATLGMSVCVFALIIFYTIKSKGLG
ATP62_ACAM1     QPADPYLPFIGTLFIFIALSNLLSVIPGYQP---------PTGXXXXXXXXXXCVFFAVPLYGVQKKGVR
ATPI_ORYNI      EY-GPWVPFIGTMFLFIFVSNWSGALLPWKIIQLPHGLAAPTNDINXXXXXXXXXXXXYFYAGLSNKGLS
ATPI_NANDO      EY-GPWVPFIGTMFLFIFVSNWSGALLPWKIIQLPHGLAAPTNDINTTVALALPTSVAYFYAGLTKKGLG
ATPI_ANTSP      HEYRFWIPYISTIFLFILGSNWAGALIKLITLPEGEL-AAPTNDINXXXXXXXXXXXXYFYAGLSKNGIG
ATP6_SULSY      KGRKYFPLI-ASIGLFVFFGNLLGIIPGLE---------SPXXXXXXXXXXXXXVFFIYNFEGIRENGFK
ATP6_PSEPK      RSPVIAPLA-LTIFVWVFLMNAVDLIPQLAILISGDFRAVSTTDPNATLAMAFCVFALIIFYSIKVKGLG
ATP6_PSEP1      RSPVIAPLA-LTIFVWVFLMNAVDLVPQLAILISGDFRAVSTTDPNATLAMAFCVFALIIFYSIKVKGLG
ATP6_ERWCT      MFHGKSKLIALTIFVWVFLMNMMDLLPSLLGYDPAHAYAVPTADVNITLSMALGVFILVLFYSIKMKGLG
ATP6_SYNP6      KEYRPWVPFIGTLFLFIFLSNWSGALIPWKLIKPSGELAAPTSDINXXXXXXXXXXXXYFYAGFSRKGLG
ATP6_SYNE7      KEYRPWVPFIGTLFLFIFLSNWSGALIPWKLIKPSGELAAPTSDINXXXXXXXXXXXXYFYAGFSRKGLG
ATP6_RHOPB      EGLKFFPLVF-SLFMFIMISNMVGIIPYTFTI---------TSHXXXXXXXXXXXXXXXXXYGFYRNGFK
ATP6_AZOC5      EGM-XXXXXXXXXXXXXXXXXXIGLVPYTFTI---------TAHIVVTAALALLVIGTVVIYGFYKHGFL
ATP61_HAHCH     RNARRLLPLIGTFWIFLPVANLLGVIPGMH---------SPTRDLSXXXXXXXXXXXXXHAYGVRQSGLG
ATP61_CHLP8     QKPEKYLPFIATLFLFIATAN---LCT---VIPG---YEPPTGSLSTTAALALSVFIAVPLFGIAESGLV
ATPI_WELMI      EEYISWVPFIGTLFLFIFVSNWSGALVPWGVVKLPHGLAAPTNDINTTVALALLTSVAYFYAGLAKKGLS
ATPI_IPOPU      EY-GPWVPFIGTIFLFIFVSNWSGALLPWKIIQLPHGLAAPTNDINXXXXXXXXXXXXYFYAGLSKKGLG
ATPI_ARAHI      EY-GPWVPFIGTLFLFIFVSNWSGALLPWKIIQPQGELAAPTNDINXXXXXXXXXXXXYFYAGLSKKGLG
ATP6_SHEDO      LALTIFVWVFMMNFMDMIPVDWLPSLALLAGVEYLKVVPTTDVNITFSLAIGVFVLIIYY--SIKVKGVS
ATP6_RHISN      HGMKFFPMVF-SLFMFILTANLLGMFPYFFTV---------TSQIIVTFALAVFVIGTVILYGFYKHGF-
ATP6_RHIME      HGMKFFPMVF-SLFMFILTANLLGMVPYFFTV---------TSQIIVTFALAVFVIGTVLLYGFYKHGF-
ATP6_IDILO      ----------------------------------------PTTDLNTTFALSLSVFALIIIYSIKYKGVK
ATP6_ALISL      TFHGRNPLLALTIFCWVILMNLMDLIPDFLPYSAAHWLGIPSADVNITMAMALGVFALMIYYSIKVKGLE
ATPI_CAPBU      EY-GPWVPFIGTLFLFIFVSNWSGALLPWKIIQPQGELAAPTNDINXXXXXXXXXXXXYFYAGLSKKGLG
ATP6_ERWT9      MYSKVIAPLALTIFVWVFLMNFMDLLPDLLPYIGEHFLGLPALRVDVNITLSFVLILFYSIKMKGIGGFS
ATP6_COLP3      TFHGKNALIALTIFVWILLMNSMDWVPVDLLPHLIHWVTGPTANITFGLALGVFILIIYY--SIKVKGVG
ATP6_CAMC5      EALARKYLPLVATIGFVVFFSNA-----IGIIPG---FEXXXXXXXXXXXXXXIVFFYYHFEGIKKNGFF
ATP6_CAMC1      EKLARKYLPLVATIGFIVFFSNV-----IGIIPG---FESPSSSLNLTLVLALVVFIYYNFEGIRENGFF
ATP6_ACIBY      K-SRLIAPLALTIFVWIFLMNLMDLIPQVAAFVGANVFGSTDPNITLGMSLSVFVLILFY--SIREKGVE
ATP6_ACIBT      K-SRLIAPLALTIFVWIFLMNLMDLIPQVAAFVGANVFGSTDPNITLGMSLSVFVLILFY--SIREKGVE
ATP6_ACIBS      K-SRLIAPLALTIFVWIFLMNLMDLIPQVAAFVGANAFGSTDPNITLGMSLSVFVLILFY--SIREKGVE
ATP6_ACIBC      K-SRLIAPLALTIFVWIFLMNLMDLIPQVAAFVGANVFGSTDPNITLGMSLSVFVLILFY--SIREKGVE
ATP6_ACIB5      K-SRLIAPLALTIFVWIFLMNLMDLIPQVAAFVGANVFGSTDPNITLGMSLSVFVLILFY--SIREKGVE
ATP6_ACIB3      K-SRLIAPLALTIFVWIFLMNLMDLIPQVAAFVGANVFGSTDPNITLGMSLSVFVLILFY--SIREKGVE
ATP62_HAHCH     LALTVFCWIFLMNLMDLVPVDFLPRLFQVITGDDHAYFKVPTTDVNVTLGMSLSVFFLIIYYSIKVKGVG
ATP61_PELLD     RRSMQYLPYLGTLFIFIAFSNLCTIIPG---------YEPPTGSLSTTAALAMSVFVAVPLFGIAESGLG
ATP6_SHESW      ----------------------------------------PTTDLNVTLGLSLSVFVLIVFYSIKAKGIG
ATP6_SHEPC      ----------------------------------------PTTDLNVTLGLSLSVFVLIVFYSIKAKGIG
ATP6_SHELP      LALTIFVWVFMMNFMDMIPVDWLPWAAGLAGI--THLKVVPTTDLNITFSLALGVFVLIIYYSIKVKGVS
ATP6_PSE14      RSAVIAPLA-LTIFVWVFLMNAVDLVPVAMLISGDEFRAVPTTDPNATLGMALSVFALIIFYSIKVKGIG
ATP6_CHRSD      KLIAPLSLTIFCWIFLMNLMDPVDFLPMLAQKIGA-WFGAPTTDVNATLGMSLAVFALIIFYSIRSKGLS
ATP6_BUCAI      MYQGKNALIALTVFIWVFLMNLMDLVP----IDFFPFISEPSADINITLSMSLGVFFLILFYTVKIKGYV
ATP6_AGRVS      HGMKFFPMVF-SLFMFVLTANLLGMMPYFFTI---------TSQIVVTFALAIFVIGTVLVYGFYKHGFX
ATPI_CERDE      DY-GPWVPFIGTMFLFIFVSNWSGALLPWKIIQLPHGLAAPTNDINXXXXXXXXXXXXYFYAGLTKKGLG
ATP6_TOLAT      IFHGKNKLIALTIFVWIFLMNAMDLLPHLAQISNIPYLRVPSADVNITLSMALGVFFLILFYSIKIKGIG
ATP6_SHEAM      ----------------------------------------PTTDLNITFSLALGVFLLIIYYSIKVKGVS
ATP6_RHOP2      EGLKFFPLVF-SLFMFIAVSNLVGIIPYTFTV---------SSHLIVTVTLAMLVFVTVLVYGLAKNGLK
ATP6_RHILW      QGMKFFPLVF-SLFMFVLTANLLGMFPYFFTI---------TSQIIVTFALAILVIGTVLVYGFYKHGFP
ATP6_RHIE6      QGMKFFPLVF-SLFMFVLTANLLGMFPYFFTV---------TSQIIVTFALAILVIGTVLVYGFYKHGF-
ATP6_PSEF5      RSPVIAPLA-LTIFVWVFLMNAIDLVPVAMLISGDQHTTDPNATLGMALSVFALIIFY----SIKVKGIG
ATP6_PELUB      K-AKPYFAFIFSIFMFVLFCNMFGMIPYAFTV---------TSHIIVTFILASFIFVGVTIIGFMKHGFV
ATP6_MICAN      KEYRPWLPFIGTLFLFIFVSNWLGALIPWKLIEPEGELAAPTNDINXXXXXXXXXXXXYFYAGISKKGL-
ATP6_BRANA      LSGNVKQMFFPCIFLFLLFCNLQGMIPYSFTV---------TSHFLITLALSFSIFIGITIVGFQRHGLX
ATP6_BARHE      QGMQFFPLVF-SLFTFILVANFIGLFPYFYTI---------TSQIMITFSLAMLVIFTVISYGFYKHGFL
ATP6_SHEHH      ----------------------------------------PTTDLNVTLGLALSVFVLIVFYSIKVKGFS
ATP6_ROSDO      EGLKFFP-YIMTLFMFIVCANFLGLIPSSFT---------PTSHXXXXXXXXXXXXXXXXI-----LGFV
ATP6_LAWIP      EGRKFFPVL-IGIFLLIAVENLLGLIPLCD---------APTANINTNIGMAIFVFLYYNYEGIKKWGFH
ATP62_ARATH     LSGNVKQMFFPCIFLFLLFCNLQGMIPYSFTV---------TSHFLITLALSFSIFIGITIVGFQRHGLX
ATP61_ARATH     LSGNVKQMFFPCIFLFLLFCNLQGMIPYSFTV---------TSHFLITLALSFSIFIGITIVGFQRHGLX
ATP6_VIBFM      TFHGRNPLIALTIFCWVILMNLMDLVPDFLPYPAEHWLGIPSADVNITMAMALGVFALMIYYSIKVKGLE
ATP6_VIBF1      TFHGRNPLIALTIFCWVILMNLMDLVPDFLPYPAEHWLGIPSADVNITMAMALGVFALMIYYSIKVKGLE
ATP6_SHESH      ----------------------------------------PTTDLNITFSMAIGVFLLIIYYSIKVKGIS
ATP6_RHOP5      EGLKFFPLVF-SLFMFIMVSNMVGIIPYTFTI---------ASHIIVTAALAFLVFFTVLIYGFKKNGFK
ATP6_OLICO      EGMKFFPLVF-SIFMFVLMANLIGVIP---------YTFSVTSHLIVTVALALIVFLTVLLYGLYKNGLK
ATP6_EHRRW      EGLQYVPLVF-TIFTFILVCNLLGILPLGFTV---------TSHIAVTFAISMIVFI-----SVTFIGFK
ATP6_EHRRG      EGLQYVPLVF-TIFTFILVCNLLGILPLGFTV---------TSHIAVTFAISMIVFI-----SVTFIGFK
ATP6_WIGBR      NTNKIIPPLSLTIFVWLFLMNLMDLIP----VDFVPYIANPSSDINITLSMSLGVFLLILYFGIKNKGIV
ATP6_PSESM      RSAVIAPLA-LTIFVWVFLMNAVDLVPVAMMISGDEFRAVPTTDPNATLGMALSVFALIIFYSIKVKGIG
ATP6_ENTS8      MYHGKSKLIALTIFVWVFLMNLMDLLPDLLPYIGEHVFGLPALRVDVNITLSFILILFYSIKMKGVGGFT
ATP6_VIBCM      TFHGRNPLIALTIFCWVFLMNLMDLVPDFLPYPAQHWLGIPSADVNITMAMALGVFALMIYYSIKVKGLG
ATP6_VIBCH      TFHGRNPLIALTIFCWVFLMNLMDLVPDFLPYPAQHWLGIPSADVNITMAMALGVFALMIYYSIKVKGLG
ATP6_VIBC3      TFHGRNPLIALTIFCWVFLMNLMDLVPDFLPYPAQHWLGIPSADVNITMAMALGVFALMIYYSIKVKGLG
ATP6_SHEWM      ----------------------------------------PTTDLNITFSMAIGVFLLIIYYSIKVKGIS
ATP6_PROMH      MYSKVIAPLALTVFVWVLLMNALDLLP----IDFIPYIGEPTADVSITLSMAIGVFILILFYSIKMKGVK
ATP6_MAGSM      AEGRKY---------FPAIXXXXXXXXXXXXXXXIPGSFTPTSQLVVTATLALSVFFFATGLAIVKHGFV
ATP6_VIBVY      TFHGRNPLIALTIFCWVFLMNLMDLVPDFLPYPAEHWLGIPSADVNITMAMALGVFALMIYYSIKVKGLG
ATP6_VIBVU      TFHGRNPLIALTIFCWVFLMNLMDLVPDFLPYPAEHWLGIPSADVNITMAMALGVFALMIYYSIKVKGLG
ATP6_RUTMC      QNPMVAPLA-LTTFIWIVLMNTMDLVPVAQQIGV--WLGAPTADPNATXXXXXXXXXXXXXXXXKEKGFA
ATP6_VIBPA      TFHGRNPLIALTIFCWVFLMNVMDLVPDFLPYPAEHWLGIPSADVNITMAMALGVFALMIYYSIKVKGLE
ATP6_VIBAL      TFHGRNPLIALTIFCWVFLMNVMDLVPDFLPYPAEHWLGIPSADVNITMAMALGVFALMIYYSIKVKGLE
ATP6_SHEPW      ----------------------------------------PTTDLNITFSMAIGVFLLIIYYSIKVKGVS
ATP61_VIBHB     TFHGRNPLIALTIFCWVFLMNVMDLVPDFLPYPAEHWLGIPSADVNITMAMALGVFALMIYYSIKVKGLE
ATP6_SYNY3      KEYRPWLPFIGTLFLFIFVSNWSGALLPWKLIDGAE-LAAPTNDINXXXXXXXXXXXXYFYAGLRKKGL-
ATP6_SHESR      SFHGRNALIALTIFVWVFMMNFMDMLP----VDWLPWLASPTTDVNITFSLAIGVFVLIIYYSIKVKGVS
ATP6_SHESM      SFHGRNALIALTIFVWVFMMNFMDMLP----VDWLPWLASPTTDVNITFSLAIGVFVLIIYYSIKVKGVS
ATP6_SHESA      SFHGRNALIALTIFVWVFMMNFMDMLP----VDWLPWLASPTTDVNITFSLAIGVFVLIIYYSIKVKGVS
ATP6_SHEON      SFHGRNALIALTIFMWVFMMNFMDMIP----VDWLPWLASPTTDVNITFSLAIGVFVLIIYYSIKVKGVS
ATP6_SHEB9      ----------------------------------------PTTDVNITFSLAIGVFLLIIFYSIKVKGVS
ATP6_SHEB8      ----------------------------------------PTTDVNITFSLAIGVFLLIIFYSIKVKGVS
ATP6_SHEB5      ----------------------------------------PTTDVNITFSLAIGVFLLIIFYSIKVKGVS
ATP6_SHEB2      ----------------------------------------PTTDVNITFSLAIGVFLLIIFYSIKVKGVS
ATP6_ENT38      MYHGKSKLIALTVFVWVFLMNLMDLLPDLLPYIGEHVFGLPSADVNITLSMALGVFILILFYSIKMKGVS
ATP62_CHLP8     GYEKHLP-YLISVFFFILVCNLLGLIP---------YGATATGNINVTLALSXXXXXXXXXXXXKELGVG
ATP61_PHOPR     ----------------------------------------PTADVNITMAMALGVFALMLYYSVKVKGLE
ATP6_RICBR      KGRKFVPVIFT-LFVFILFCNLFGMIPYGFTV---------TSHIIITFALAILVFLMVTIVGFVKHGFL
ATP6_RICB8      KGRKFVPVIFT-LFVFILFCNLFGMIPYGFTV---------TSHIIITFALAILVFLMVTIVGFVKHGFL
ATP6_KLEP7      MYSKVIAPLALTVFVWVFLMNLMDLLPDLLPYIGEHIFGLPSADVNITLSMALGVFILIIFYSIKMKGVG
ATP6_KLEP3      MYSKVIAPLALTVFVWVFLMNLMDLLPDLLPYIGEHIFGLPSADVNITLSMALGVFILIIFYSIKMKGVG
ATP6_BACAO      ----------------------------------------------------------------------
ATP6_SODGM      ----------------------------------------PSADVNITLSMALGVFILILYYSVMMKGIG
ATP6_RHOPT      EGLKFFPLVF-SLFMFIAVSNLIGIVPYTFTVSSHXXXXXXXXXXXXXXXXXY--------------GFS
ATP6_RHOPA      EGLKFFPLVF-SLFMFIAVSNLIGIVPYTFTVSSHXXXXXXXXXXXXXXXXXY--------------GFS
ATP6_PSEU2      RSAVIAPLA-LTIFVWVFLMNAVDLVPVAMMISGDSHTTDPNATLGMALSVFALIIFY----SIKVKGIG
ATP6_PSEPF      RSPVIAPLA-LTIFVWVFLMNAVDLVPVAILISGDHFRAVSTTDPNATLGMAFSVFALIIFYSIKVKGLG
ATP6_EHRCJ      EGLQYIPLVF-TIFMFIATCNLLGILPLGFT---------ATSHIAVTFAISMVVFVSVTIIGFKHQGFL
ATP6_BART1      QGMQFFPLVF-SLFTFILVANFIGLFPYFYTV---------TSQIMITFSLAMVVIL-----TVIGYGFY
ATP6_SHEPA      ----------------------------------------PTTDLNVTLGLALSVFALIVFYSIKVKGIG
ATP6_PSEFS      RSPVIAPLA-LTIFVWVFLMNAVDLLAILITGDAIPFRAVSTTDPNATLGMALSVFALIIFYSIKVKGIG
ATP6_GEOUR      HHGKPFFPLIATLAIFILVSNLIGLVPG---------FFPPTANINTTAACAVIVFVTTHVVGIKEHGF-
ATP6_BORPE      AKSRLFAPLALTVFLWIILMNALDLMTGLGAEHGDPLYYHPTADLNVPMGMSLGVLLLMFYYGIKIKGFV
ATP6_BORPA      AKSRLFAPLALTVFLWIILMNALDLMTGLGAEHGDPLYYHPTADLNVPMGMSLGVLLLMFYYGIKIKGFV
ATP6_BORBR      AKSRLFAPLALTVFLWIILMNALDLMTGLGAEHGDPLYYHPTADLNVPMGMSLGVLLLMFYYGIKIKGFV
ATP6_BORA1      AKSREFAPLALTVFLWIILMNALDLLTGLGAEHGDPLYYHPTADLNVPMGMSLGVLLLMFYYGIKI----
ATP6_PSEA6      TYHGKSALIALTIFVWVLLMNLMDLITAAALIAGTYMKVVPTTDVNMTFALSLGVFALMIFYSVKIKGFG
ATP6_SPHWW      EGKK-FTPYVFSLFMFILIANIMGMMPT--GVVGVHPFTV-TSHLTVTGVLAVISFSIVLVVGFWRHGFH
ATP6_BRAJA      EGMKFFPLIF-SLFMFICVSNLIGIIPYTFTISSXXXXXXXXXXXXYGVALKFFSIFVPH----------
ATP6_ACICJ      EG-KRFFPFVFTLFAFILIGNILGLFP---------YFFAFTSHIAITGALALFVFALSTLVGFWYHGFL
ATP6_SYNAS      EGKKFFPLI-ATIGLFILVSNLLGLVPGFE---------SPTANLNTNAAMAVVVFILTHYVGIKVHG-G
ATP6_SALTY      MYHGKSKLIALTIFVWVFLMNLMDLLPDLLPYIAEHWLGLPSADVNITLSMALGVFILILFYSIKMKGIG
ATP6_SALTI      MYHGKSKLIALTIFVWVFLMNLMDLLPDLLPYIAEHWLGLPSADVNITLSMALGVFILILFYSIKMKGIG
ATP6_SALSV      MYHGKSKLIALTIFVWVFLMNLMDLLPDLLPYIAEHWLGLPSADVNITLSMALGVFILILFYSIKMKGIG
ATP6_SALPK      MYHGKSKLIALTIFVWVFLMNLMDLLPDLLPYIAEHWLGLPSADVNITLSMALGVFILILFYSIKMKGIG
ATP6_SALPC      MYHGKSKLIALTIFVWVFLMNLMDLLPDLLPYIAEHWLGLPSADVNITLSMALGVFILILFYSIKMKGIG
ATP6_SALPB      MYHGKSKLIALTIFVWVFLMNLMDLLPDLLPYIAEHWLGLPSADVNITLSMALGVFILILFYSIKMKGIG
ATP6_SALPA      MYHGKSKLIALTIFVWVFLMNLMDLLPDLLPYIAEHWLGLPSADVNITLSMALGVFILILFYSIKMKGIG
ATP6_SALNS      MYHGKSKLIALTIFVWVFLMNLMDLLPDLLPYIAEHWLGLPSADVNITLSMALGVFILILFYSIKMKGIG
ATP6_SALHS      MYHGKSKLIALTIFVWVFLMNLMDLLPDLLPYIAEHWLGLPSADVNITLSMALGVFILILFYSIKMKGIG
ATP6_SALG2      MYHGKSKLIALTIFVWVFLMNLMDLLPDLLPYIAEHWLGLPSADVNITLSMALGVFILILFYSIKMKGIG
ATP6_SALEP      MYHGKSKLIALTIFVWVFLMNLMDLLPDLLPYIAEHWLGLPSADVNITLSMALGVFILILFYSIKMKGIG
ATP6_SALDC      MYHGKSKLIALTIFVWVFLMNLMDLLPDLLPYIAEHWLGLPSADVNITLSMALGVFILILFYSIKMKGIG
ATP6_SALCH      MYHGKSKLIALTIFVWVFLMNLMDLLPDLLPYIAEHWLGLPSADVNITLSMALGVFILILFYSIKMKGIG
ATP6_SALAR      MYHGKSKLIALTIFVWVFLMNLMDLLPDLLPYIAEHWLGLPSADVNITLSMALGVFILILFYSIKMKGIG
ATP6_SALA4      MYHGKSKLIALTIFVWVFLMNLMDLLPDLLPYIAEHWLGLPSADVNITLSMALGVFILILFYSIKMKGIG
ATP6_AZOSB      ----------------------------------------PTADLSATLGMSCGVLLLCLYYNVKIKGVS
ATP6_LEGPH      --------FVATLWIFILVSNLIGVIPGFY---------SPTADLSVTASLAIMTFLSVHWFGIRAEGWR
ATP6_LEGPC      --------FVATLWIFILVSNLIGVIPGFY---------SPTADLSVTASLAMMTFLSVHWFGIRAEGWR
ATP6_LEGPA      --------FVATLWIFILVSNLIGVIPGFY---------SPTADLSVTASLAIMTFLSVHWFGIRAEGWR
ATP6_PSYIN      ----------------------------------------PTTDMNITFGLSLSVFALIVFYSIKIKGIT
ATP6_PHOLL      MYSKVIAPLALTVFVWVLLMNVMDLLPDFLPYIGEHFFGLPTADVSVTLSMAIGVFVLILYYSIKMKGIE
ATP6_BAUCH      ----------------------------------------PSADINITLSLALGVFILIIYYNLKIKGIT
ATP6_ANADF      ---KDADRFVPYL------VSAXXXXXXXXXXXXVPFAATATANISVTVMMAVFTFLITQYAQIRAVGMT
ATP6_AERS4      GKSKLIAPLALTVFIWVFLMNLMDLIPTAQVLGIPYLRVVPSADVNITMSMALGVFALIIIYSIKMKGVS
ATP61_BRASB     HGMTFFPLVF-SLFMFIFVSNIVGIIPYTFTV---------SSHIIVTFSLALLVFLTVIIYGFYKNGLK
ATP6_RHOCA      DGLV-YFPYIFTLFLFILFSNFLGLIPMAFT---------PTSHIAVTGVMAMGVFI-----GVTALGFM
ATP62_PELPD     RADTVFP-FVATLWLFIGIANLSSLIPRVH---------SPXXXXXXXXXXXXXVFFSVHWFGIRIQGLR
ATP6_SHISS      ----------------------------------------PSADVNVTLSMALGVFILILFYSIKMKGIG
ATP6_SHIDS      ----------------------------------------PSADVNVTLSMALGVFILILFYSIKMKGIG
ATP6_SHIB3      ----------------------------------------PSADVNVTLSMALGVFILILFYSIKMKGIG
ATP6_SACD2      MGLTIFSWVFMMNLMDLIPVDWLPMLAQVVTGDSHTFFKVPTTDPNATLGMAFTVFALMIMFSIKEKGAL
ATP6_PARUW      EG-KAYIPFLGTLFIYIFTMNIFGMVPLMK---------APSSSLNITAALAICVFCLVQFLNIRNMGIP
ATP6_FRASC      KGTR-YTPYLLVLFSFVLICNVLAVVPGAQ--------FPATSRIAVPMVLALVTYVLFNYAGIKANGAG
ATP6_ESCF3      ----------------------------------------PSADVNVTLSMALGVFILILFYSIKMKGIG
ATP6_ECOUT      ----------------------------------------PSADVNVTLSMALGVFILILFYSIKMKGIG
ATP6_ECOSM      ----------------------------------------PSADVNVTLSMALGVFILILFYSIKMKGIG
ATP6_ECOSE      ----------------------------------------PSADVNVTLSMALGVFILILFYSIKMKGIG
ATP6_ECOLU      ----------------------------------------PSADVNVTLSMALGVFILILFYSIKMKGIG
ATP6_ECOLI      ----------------------------------------PSADVNVTLSMALGVFILILFYSIKMKGIG
ATP6_ECOLC      ----------------------------------------PSADVNVTLSMALGVFILILFYSIKMKGIG
ATP6_ECOL6      ----------------------------------------PSADVNVTLSMALGVFILILFYSIKMKGIG
ATP6_ECOL5      ----------------------------------------PSADVNVTLSMALGVFILILFYSIKMKGIG
ATP6_ECOK1      ----------------------------------------PSADVNVTLSMALGVFILILFYSIKMKGIG
ATP6_ECOHS      ----------------------------------------PSADVNVTLSMALGVFILILFYSIKMKGIG
ATP6_ECODH      ----------------------------------------PSADVNVTLSMALGVFILILFYSIKMKGIG
ATP6_ECOBW      ----------------------------------------PSADVNVTLSMALGVFILILFYSIKMKGIG
ATP6_ECO8A      ----------------------------------------PSADVNVTLSMALGVFILILFYSIKMKGIG
ATP6_ECO81      ----------------------------------------PSADVNVTLSMALGVFILILFYSIKMKGIG
ATP6_ECO7I      ----------------------------------------PSADVNVTLSMALGVFILILFYSIKMKGIG
ATP6_ECO5E      ----------------------------------------PSADVNVTLSMALGVFILILFYSIKMKGIG
ATP6_ECO57      ----------------------------------------PSADVNVTLSMALGVFILILFYSIKMKGIG
ATP6_ECO55      ----------------------------------------PSADVNVTLSMALGVFILILFYSIKMKGIG
ATP6_ECO45      ----------------------------------------PSADVNVTLSMALGVFILILFYSIKMKGIG
ATP6_ECO27      ----------------------------------------PSADVNVTLSMALGVFILILFYSIKMKGIG
ATP6_ECO24      ----------------------------------------PSADVNVTLSMALGVFILILFYSIKMKGIG
ATP6_DIAST      AQSRKFAPLALTVFVWIFLMN---AMXXXXXXXXXXXWQGPTADLSTTLGLSSAVLILCFVYSIKIKGMK
ATP6_YERPG      MYSKVIAPLALTVFVWVLLMNMMDLLPDLLPYIGEHVFGLPTADVSITLSMALGVFILIIFYSIKMKGFT
ATP6_OENBE      LSGNVKQKFFPCIFTFLLFCNLQGMIPYSFTV---------TSHFLITLGLSFSIFIGITIVGFQRNGLH
ATP6_NITEU      -----------------------------------NWRSVPTADVNTTFALALSIWILTIYFAIKVKGFG
ATP6_DESDA      NGRKFVPL-LAGIFIYIFGMNLMGLVP---------GFDAPTANLNTTVCMALFVLVFYNAVGLIRHHFT
ATP6_BEII9      DGMRXXXXXXXXXXXXX-LANLIGLVPYTFTV---------TSQIAVTFGLAMIVIGTVVIYGLIKHGFA
ATP6_YERPY      MYSKVIAPLALTVFVWVLLMNMMDLLPDLLPYIGEHVFGLPTADVSITLSMALGVFILIIFYSIKMKGFT
ATP6_YERPS      MYSKVIAPLALTVFVWVLLMNMMDLLPDLLPYIGEHVFGLPTADVSITLSMALGVFILIIFYSIKMKGFT
ATP6_YERPP      MYSKVIAPLALTVFVWVLLMNMMDLLPDLLPYIGEHVFGLPTADVSITLSMALGVFILIIFYSIKMKGFT
ATP6_YERPN      MYSKVIAPLALTVFVWVLLMNMMDLLPDLLPYIGEHVFGLPTADVSITLSMALGVFILIIFYSIKMKGFT
ATP6_YERPE      MYSKVIAPLALTVFVWVLLMNMMDLLPDLLPYIGEHVFGLPTADVSITLSMALGVFILIIFYSIKMKGFT
ATP6_YERPB      MYSKVIAPLALTVFVWVLLMNMMDLLPDLLPYIGEHVFGLPTADVSITLSMALGVFILIIFYSIKMKGFT
ATP6_YERPA      MYSKVIAPLALTVFVWVLLMNMMDLLPDLLPYIGEHVFGLPTADVSITLSMALGVFILIIFYSIKMKGFT
ATP6_YERP3      MYSKVIAPLALTVFVWVLLMNMMDLLPDLLPYIGEHVFGLPTADVSITLSMALGVFILIIFYSIKMKGFT
ATP6_SHIFL      ----------------------------------------PSADVNVTLSMAFILILFYNIKMKGIGGFT
ATP6_SHIF8      ----------------------------------------PSADVNVTLSMAFILILFYNIKMKGIGGFT
ATP6_PELPB      GYEK-YLNYLLTVFFFVLLCNLLGLVP---------YGATATGNINVXXXXXXXXXXXXQVAALKAHGIK
ATP6_AERHH      RN-KVIAPLGLTVFVWIFLMNLMDLIPAAQLMGVPYLRVVPSADVNITMSMALGVFFLILYYSIKVKGIG
ATP6_GEOLS      HGRSFFPLI-ATLAIFILVSNLVGLIPGFYP---------PTANVNTTAACAIVVFLATHVVGIKHHGF-
ATP6_BRASO      HGMTFFPLVF-SLFMFIFVSNIVGIIPYTFTV---------SSHIIVTFSLALLVFLTVIIYGFYKNGLK
ATP6_BDEBA      -HGKHYIPFFASVFFFILFNNLLGMIPGM---------TPATENMNTTFGFGVLMFLFYNFQGVKENGPV
ATP6_ALLAR      DAKNSLIYFPLIFFSFVFISNILGMIPYSFT---------PTSHISVTLGLSIAIMI-----GVTLIGFS
ATP6_RHOS5      EGVK-YFPYVMTLFLFVLCGNVLGLLPLSFTT---------TSHMAVTVPLALMVFVVTALGFMRNGGFL
ATP6_RHOS4      EGVK-YFPYVMTLFLFVLCGNVLGLLPLSFTT---------TSHMAVTVPLALMVFV-----GVTALGFM
ATP6_RHOS1      EGVK-YFPYVMTLFLFVLCGNVLGLLPLSFTT---------TSHMAVTVPLALMVFV-----GVTALGFM
ATP6_DINSH      DGIK-YFPYIFTLFMFILVANFLGLIPMSFTT---------TSHIAVTAVLALAVFI-----TVTVIGFV
ATP6_CITK8      MYHGKSKLIALTIFVWVFLMNLMDLLPDLLPYIGEHIFGLPSADVNITLSMALGVFILILFYSIKMKGIG
ATP6_ACISJ      AQSRKFAPLALTVFVWIFLMNAMXXXXQVATGDSHAYLRVPTADLSTTLGLSSAVLILCFVYSIKIKGLK
ATP6_RICAE      KGRKXXXXXXXXXXXXXXXXXX-GM---------TPYSFTTTSHIIVTFTLAILVFLMVTIVGFVKHGLR
ATP6_CHLCH      GYEK-YLPYLLTVFFFILVCNLLGLVP---------YGATATGNINVXXXXXXXXXXXXXXXXXKAHGIK
ATP6_ALLMA      DAKNSLIYFPLIFFSFVFISNILGMIPYSFT---------PTSHISVTLGLSIAIMI-----GVTLIGFS
ATP61_METCA     ----------------------------------------PSTDLNATFGMSISVFFLIIFYSLKVKGPG
ATP61_CHLTE     -------------------------------------YEPPTGSLSTTAALALSVFIAVPLFGIAESSLV
ATP6_SOLUE      EG-HHYLAFFGTIFIFILFANLIGVVPGFE---------APTMVPSVPAGCAIAAFFYYNIVGVQANGLG
ATP6_RICAH      KGHKXXXXXXXXXXXXXXXXXX-GM---------TPYSFTATSHIIVTFTLAIIVFLTVTIVGFVKHGFL
ATP6_GEOSF      -HGKPFFPLIATLALFILVSNLIGLIPG---------FFPPTANINTTAACAVIVFVTTHIVGIKEHGV-
ATP6_RICCK      KGHKXXXXXXXXXXXXXXXXXX-GMTPYSFTV---------TSHIIVTFALAILVFLTITIV-----GFV
ATP6_ORITI      QGKKXXXXXXXXXXXXXX-GNILGMVPHAFTF---------TSHIIVTFSLAMIVFTTTLVYGIYRHGFF
ATP6_GLUOX      NGATXXXXXXXXXXXILA-GNYLGLLPFSFTY---------TSHIAVTFGLAIMVFIISILASIRFQGFL
ATP62_METCA     AY-REVTPFIMSLWLFLATANLISLVPG---------FDSPTRDLSVTSALAVLVFFSVHWFGIRQQGLS
ATP6_ORITB      QG-KVXXXXXXXXXXXXXXGNIIGMVPHAFTF---------TSHIIVTFSLAMIVFTTTLVYGIYRHGFF
ATP6_DESOH      EGRWFFPLAGT-IAIFIAVSNLIGLVPG---------FFPPTASINTPLACAIVVFVFTHFIGIKYHG-P
ATPI_ODOSI      SFYREWVPFIGTLFLFIFGCNWAGAIIPWKLIEPEGELAAPTNDINXXXXXXXXXXXXYFYAGLSKKGFG
ATP6_YEAST      KNWGLYFPMIFTLFMFIFIANLISMIP---------YSFALSAHLVFIISLSIVIWLGNTILGLYKHGFS
ATP6_JANMA      ------SLDFLPVDMFSAFFHAVGLDSLI-----THHRVVPTADLNGTMGIAFALMIFYNIKIKGAGGFV
ATP6_ALCBS      KLIAPLSLVIFCWVFLM----NLMDLIPVDFIPKTFEWTDPNITLGMSFSVMFLIIFLT-IKTKGVGGFT
ATP6_NOVAD      AGRK-YLPYVFSLFAFILFANMLGLLPL--ALVGVHPF---TATSHFTVTGVLAIMSFAIVLGV---GFA
ATP6_PHOVI      RKGQTWALMLISLILFIGSTNLLGLLPHSFT---------PTTQLSMNLGMAIPLWAGTVITGFRHKT-K
ATP6_HIPAM      HKGQTWTLMLMSLILFIGSTNLLGLLPHSFT---------PTTQLSMNLGMAIPLWAGTVIMGFRNKT-K
ATP6_GRABC      EGKKXXXXXXXXXXX-VLMGNLLGLFPYFFTY---------TSHXXXXXXXXXXXXXXXXXXXXRYHGFP
ATP6_APILI      KYQSNI-IIFISLMLYIMITNIFSLIPYVFTLT-----SHLLLNMILSLTLSFLIYLIYNNYIM----FL
ATP6_BORPD      AKSRLFAPLALTVFLWIILMNALDLIPV--DLMPTVWWTGPTADLNVPMGMSLGVLLLMFYYGIKIKGFV
ATP62_PROA2     GYEKHLPYXXXXXXXXXXXXXXXXVP----------YGATATGNINVTLTLAVFTFFITQVASLKAHGIK
ATP6_CHRVO      ----------------------------------------PSADVNATFAMSLSVLILIVGFSIKAKGLG
ATP6_FELCA      HKGQTWALMLMSLILFIGSTNLLGLLPHSFT---------PTTQLSMNLGMAIPLWAGTVITGFRHKT-K
ATP6_CHOCR      K-GEFYFPFIFTLHLLLLYCNLIGMIPYSFTV---------TSHIVFTFGLALSIFIGINLIGIQTHGF-
ATP6_SPHAL      EGRK-YTPYVFSLFMFILFCNXXXXXXXXXXXXHPFTVTSHIAITGVLALISFAIVLVV--------GFW
ATP6_PARL1      DAMRXXXXXXXXXXXXXX-ANMIGMFPYAFTV---------TSHIVVTFALAIVVFLGVTLTGFVLHG-P
ATP6_GEOSM      -HGKPFFPLVATLALFILVSNLIGLIPG---------FFPPTANINXXXXXXXXXXXXXXXXXXKHHG-A
ATP6_ACACA      IVALKYFPLVLFVFSFILFANLIGLLPYGFTITGHIIF---TFQIAFSL---FFGITLINFFNNKTEFFN
ATP6_RHIUN      THNQTWTLMLMSLILFIGSTNLLGLLPHSFT---------PTTQLSMNLGMAIPLWAGTVLTGFRHKT-K
ATP6_NEOSM      KAGSDYFPLILSVFLYVLFANLVGMLPLPMSF-------TVTSHIVVTLALAMVVFIFVTLIGLKKQGFF
ATP6_HALGR      HKGQTWALMLISLILFIGSTNLLGLLPHSFT---------PTTQLSMNLGMAIPLWAGTVITGFRHKT-K
ATP6_GEOBB      -HGKPFFPLVATLALFILVSNLIGLVPG---------FFPPTANINXXXXXXXXXXXXXXXXXXKHHG-A
ATP6_AGRRK      KGMKFFPLVF-SLFMFVLTANLLGMVPYFYTVTSQXXXXXXXXXXXXXXXXXYGFI-------KHGFGFL
ATP6_ZYMMO      KGRPFTPLIFT-LFMFILFANXXXXXXXXXXXXXAEPFTS-TSHVTVTATLAAIAFGTVLVVGFTRHGFK
ATP6_TERTT      ----------------------------------------PTTDPNATLGMAVTVFILMLFFSVQQKGLW
ATP6_MYCGA      ----------------------------------------------------------------------
ATP6_EQUAS      NKGQTWTLMLMSLILFIGSTNLLGLLPHSFT---------PTTQLSMNLGMAIPLWAGTVFMGFRHKT-K
ATP6_CERSI      NKGQTWALMLMSLILFIGSTNLLGLLPHSFT---------PTTQLSMNLGMAIPLWAGTVFLGFRHKT-K
ATP61_PELCD     KGRRYFPLI-ATLALFILFSNLIALIPG---------FXXXXXXXXXXXXXXXXVFGMTHVVGVREHGLK
ATP6_VANPO      KLWGLYFPLIYTLFMFILIANLISLIP---------YSFALTAQIVFVISLSFIIWLGSTITGFNKHGFF
ATP6_BLOPB      MFHGKNKLIAMTVFVWIFLMNTMDLIAKLLGLPALRVVPSADVNITSSLALNVFVLVMYY--NIYVNGVH
ATP61_OCHA4     KGMKXXXXXXXXXXXXXX-ANFLGLFPYFYTV---------TSQIIVTFALAVLVIVIVYXXXXXXXXXX
ATP6_HYDS0      QGLR-YLPLIASIGLFVFFGN---VMELLPFVD------APTGNINTTLALTLIVFFLYHFEGFRVNGL-
ATP6_ANAD2      R---DADRFVP----YLVTAXXXXXXXXXXXXXXXS--ATATANLSVTVALALFTFLITQYAAIRAMGLT
ATP6_LEMCA      ---RTWSLMLISLILFIGSTNLLGLLPHSFT---------PTTQLSMNLGMAIPLWAATVIKGFRHKT-K
ATP6_RHIL3      QGMQFFPLVF-SLFMFVLTANLLGMFPYFFTV---------TSQXXXXXXXXXXXXGTVVVYGFYKHGF-
ATP6_MARPO      ASSVKQRFFPLIYFTFLLFCNLIGMIPYSFTV---------TSHFIITLGLSFSLFI-----GITIVGFQ
ATP6_HORSE      SKGQTWTLMLMSLILFIGSTNLLGLLPHSFT---------PTTQLSMNLGMAIPLWAGTVFMGFRHKT-K
ATP6_GEOSL      KG-KPYFPLIATLALFVLVSNLIGLIPG---------FFPPTANLNTTAACAVIVFLSTHIVGIKKHGF-
ATP6_METS4      GSERXXXXXXXXXXXXXXXXXX-GMIPYAFTV---------TSHIIVTFMLALVVILTVVIYGFMAHGVH
ATP6_BLOFL      ----------------------------------------PSADINITCAMALNIFALMIFYYIKTNGII
ATP6_AGRT5      KGXXXXXXXXXXXXXXXT-ANLLGMFPYFFTV---------TSQIIVTFALACLVIGTVIVYGFYKHGFF
ATP61_PELPD     -HGRPYFPLVATVGLFVLVSNLIGLIPG---------FFPPXXXXXXXXXXXXVVFIATHVVGIKRHGIG
ATP6_MACRO      KQGRSWALMLMSLILFIASTNLLGLLPYSFT---------PTTQLSMNIGMAIPLWLATVLMGFRNKP-K
ATP6_HYPNA      ----------------------------------------------------------------------
ATP6_GEOMG      KG-RPYFPLIATLALFVLVSNLIGLIPG---------FFPPTANLNTTAACAIIVFLSTHVVGIKKHGF-
ATP6_BALPH      PKGQTWSLMLISLFLFIASTNLLGMLPHSFT---------PTTQLSMNVGMAIPLWAGTVTTGFRNKT-K
ATP6_MOUSE      ---RTWTLMIVSLIMFIGSTNLLGLLPHTFT---------PTTQLSMNLSMAIPLWAGAVITGFRHK-LK
ATP6_BALMU      -----WSLMLISLFLFIASTNLLGMLPHSFT---------PTTQLSMNVGMAIPLWAGTVATGFRNKT-K
ATP6_ANADE      --------------------------------------ATATANLSVTVAMALFTFVITQYAAIRAMGMT
ATP6_ALTMD      TFHGKSALIALTIFVWVLLMNLMDLVP----VDLIPWVSGPTTDLNLTFALAFILILFYSIKMKGIGGFA
ATP6_LUMTE      -HLKGLSTPLSTIFFMLVMINLMGLIP---------YMFSTSSHLVFTLSLGFPIWLSLMISTFAHSP-K
ATP6_ARTAT      KDFIKYVPLLFSLFFFILVNNIYGAIPVIQLPSFSHVGGA--------YVMAGIVYFTWIIIGIKKNGFK
ATP6_ANASK      --------------------------------------ATATANLSVTVAMALFTFFITQYAAIRAMGMT
ATP6_CANLU      QKGRTWALMLMSLILFIGSTNLLGLLPHSFT---------PTTQLSMNLGMAIPLWAGTVITGFRYKT-K
ATP6_CANFA      QKGRTWALMLMSLILFIGSTNLLGLLPHSFT---------PTTQLSMNLGMAIPLWAGTVITGFRYKT-K
ATP6_STRPU      --------LIAGVFVLILLVNVLGLFPPYA-------FQSPTSNISLTYSLGFPLWMAINI-----LGFY
ATP6_PARDP      DGLK-YFPYVMTLFCFILFANFLGLLPKS---------FSPTSHIXXXXXXXXXXXXXXXXXXXXKNGWV
ATP6_RHILO      QGMKFFPLVF-SLFMFVLVANLLGLFPYFFTV---------TSHIIVTFGLAILVIGTVIVYGFMKHGLG
ATP6_PSEHT      ----------------------------------------------------------------------
ATP6_ACIAC      ----------------------------------------PTADLSTTLGLSTAVLVLCLYYSVKIKGLK
ATP6_DUGDU      SKGRTWALMLISLILFIGSTNLLGLVPYTFT---------PTTQLSMNLGMAIPLWAGAVITGFRHKA-K
ATP6_USTMA      AN-EMYLPFIYSLFFFILIANLSGNVPYGFTV---------ATSIMVSIGLSMTIFIGVTILGLRLHKFX
ATP6_NOCSJ      ----------------------------------------------------------------------
ATP6_DESDG      DGRKVYPVLIV-FFLFILCMNLTGLVPG---------FDAPTANINTTASLALFCFIYYNYIGIQRWG-A
ATP6_TETNG      --------YILLVMVFLISINMLGLLPYTFT---------PTTQLSVNMALAVPVWLMTVIIGLRKNPTA
ATP6_RAT        ---RTWALMIVSLIMFIGSTNLLGLLPHTFT---------PTTQLSMDLSMAIPLWAGAVILGFRHK-LK
ATP6_PIG        -----WSLMLMSLIMFIGSTNILGLLPHSFT---------PTTQLSMNLGMAIPLWSATVFTGFRYKT-K
ATP6_CRIGR      ---RTWSLMLASLIIFIGSTNLLGLLPHTFT---------PTTQLSMNLGMAIPPWAGAVILGFRHK-MK
ATP6_GLUDA      ----------------------------------------------------------------------
ATP6_BOVIN      SKGQTWTLMLMSLILFIGSTNLLGLLPHSFT---------PTTQLSMNLGMAIPLWAGAVITGFRNKT-K
ATP6_AQUAE      RGLK-YVPLIAAIGLFVFFGNILGMVPGFEXXXXXXXXXXXXXXX---------VFFYYHFEGFRENGLA
ATP6_VEREI      ----------------------------------------PTADLSTTMGLALAVLGLRFWYSLKIKGAG
ATP6_PARLI      --------LITTVFIVILSANVLGLFPYAFTA---------TSHISLTYSLGFPIWMAVNI-----LGFY
ATP6_GORGO      ---RTWSLMLMWLIIFIATTNLLGLLPHSFT---------PTTQLSMNLAMAIPLWA-----GAVTTGFR
ATP6_BOSMU      -----WTLMLMSLILFIGSTNLLGLLPHSFT---------PTTQLSMNLGMAISLWAGAVITGFRNKT-K
ATP6_BOSIN      SKGQTWALMLMSLILFIGSTNLLGLLPHSFT---------PTTQLSMNLGMAIPLWAGAVITGFRNKT-K
ATP6_RABIT      ---RTWSLMLISLIMFIGSTNLLGLLPHSFT---------PTTQLSMNLGMAIPLWAGAVITGFRYKT-K
ATP6_CANGA      KDWGYYFPFIYTLFMFILISNLISMIPYSYAL---------TAQFVFIISLSMIIWLGITILSLFKHGFV
ATP6_VICFA      LSGNVKQQFFPCIFVFLLFCNLQGMIPYSFTV---------TSHFLITLGLSFSIFIGITIVGFQRNGLX
ATP6_SHEEP      TKGQTWALMLMSLILFIGSTNLLGLLPHSFT---------PTTQLSMNLGMAIPLWGGAVITGFRNKT-K
ATP6_HUMAN      ---RTWSLMLVSLIIFIATTNLLGLLPHSFT---------PTTQLSMNLAMAIPLWAGTVIMGFRSK-IK
ATP6_ARTS2      DFMKYVPLLF-SLFFFILVNNIYGAIPLIQLPSFSHVGGA--------YVLAAIVYLTWIAIGVKKNGIK
ATP63_PELPD     -HGRPYFPLVATIGIFVLVSNLIGLIPG---------FFPPXXXXXXXXXXXXVVFLSTHVVGIKRHGIG
ATP6_MESSB      HGMRXXXXXXXXXXXXXX-ANLLGLFPYFFTV---------TSHIVVTFALALLVIGTVLVYGFWKHGFG
ATP6_PYLLI      ----------------------------------------------------------------------
ATP6_NITHX      DGMKFFPFVFT-IFMLVTVSNLVGIVPYTFTI---------SSHIIVTAALAFLVFFTVLIYGFYKNGFF
ATP6_WHEAT      LSGNVKQKFFSVTFTFSLFRNPQGMIPFSFTV---------TSHFLITLALSFSIFIGITIVGFQRHGLX
ATP6_TRITI      LSGNVKQKFFSVTFTFSLFRNPQGMIPFSFTV---------TSHFLITLALSFSIFIGITIVGFQRHGLX
ATP6_PANTR      ---RTWSLMLVSLIIFITTTNLLGLLPHSFT---------PTTQLSMNLAMAIPLWAGAVVMGFRFKT-K
ATP6_MARMM      EGLRXXXXXXXXXXXXXX-ANMLGMFPYFPAPGAHSF--TITSHLIVTVALAMLVWLTVIIYGVFKNGFG
ATP6_ANAPL      ---------------------------------------TPTTQLSMNMALAFPLWLATLLTGLRNKP-S
ATP6_NITWN      EGMKFFPFVF-SIFMLVTVSNLVGIIPYTFTI---------SSHIIVTAALAFLVFFTVLIYGFYKNGFF
ATP6_MAIZE      LSGNVKHKFFPCIFTFSLFRNPQGMIPFSFTV---------TSHFLITLALSFSIFIGITIVGFQRHGLH
ATP6_ERYLH      AGRKYVPYVFSXXXXXXXXXXXXXXXXXXXXIHPFTFTSHFTITGVLAI-ISFSIVLIVGFWKHGFHFFS
ATP6_DESVV      DGRK----------VFPXXXXXXXXXXXXXXXXXVPGCDAPTANVNTNAAMALFVFGYYNYQGLKRWG-P
ATP6_DESVH      DGRK----------VFPXXXXXXXXXXXXXXXXXVPGCDAPTANVNTNAAMALFVFGYYNYQGLKRWG-P
ATP6_TOBAC      NVKQKFSPRISVTFTFSLFCNPQGMIPYSFTV---------TSHFLITLGLSFSIFI-----GITIVGFQ
ATP6_PENCH      MF---FPLMYV-LFIFILVNNLIGLVP---------YSFASTSHFILTFSISFTVVLGATILGFQRHGLK
ATP6_ASHGO      ---KVWGYYFPLVYTFFITIFTMNLISMIP------YSFAMTSHVVFVVSMSMIIWLGTTIIGFYTHGLK
ATP6_DIDMA      ---RTWTLMLMSLILFIASTNLLGLLPYSFT---------PTTQLSMNIGMAIPLWAGTVIMGFRNKP-K
ATP6_MYCPN      ----------------------------------------------------------------------
ATP6_MYCGE      ----------------------------------------------------------------------
ATP6_ASTPE      ---------FTAIFILIFSINVLGLLPYAFT-------STSHISLTYSIGVPLWM-------SVNILGFY
ATP6_TROMO      -----WAAMLITLMIFLLSMNMLGLLPYTFT---------PTTQLSMNMALAAPLWLATVLTGLRNQPTA
ATP6_TRIRU      KEGQNYFPFIYGLFIFILMNNLLGLIP---------YSFSSTSHFILTFFISFTVVLGATI-----LGFQ
ATP6_SPETR      ---RTWSLMLISLIMFIGSTNLLGLLPHSFT---------PTTQLSMNLGMAIPLWAGAVITGFRHKT-K
ATP6_PISOC      --------------------------------------------------------------SVNILGFY
ATP6_CAEBR      --------------------------------------------------VAWLSTLLTFISSEKFSVYS
ATP6_METSE      ----------------------------------------------------------------------
ATP6_CAPHI      -----WTLMLMSLILFIGSTNLLGLLPHSFT---------PTTQLSMNLGMAIPLWAGAVITGFRNKT-K
ATP6_SCHPO      SKTQSYFPFIWSLFVLILFSNLLRLIP---------YGYATTAQLIFTLGLSISILIGATILGLQQH--K
ATP6_TROHI      ----------------------------------------------------------------------
ATP6_PODAN      ----------------------------------------------------------------------
ATP6_NEUCR      ----------------------------------------------------------------------
ATP6_MYXGL      ----------------------------------------------------------------------
ATP6_DINSE      ----------------------------------------------------------------------
ATP6_ASCSU      --------------------------------------------------VAWLSTLLTFITSEKFSIYS


                         +         .         .         .         .         *         .:210
query           KSIKSFMSPVFVIPMNILEEFTNFLSLALRIFGNIFAGEVMTSLLLLLSHQAIYWYPVAFGANLAWTAFS
ATP6_STRP4      KSIKSFMSPVFVIPMNILEEFTNFLSLALRIFGNIFAGEVMTSLLLLLSHQAIYWYPVAFGANLAWTAFS
ATP6_STRZT      KSIKSFMSPVFVIPMNILEEFTNFLSLALRIFGNIFAGEVMTSLLLLLSHQAIYWYPVAFGANLAWTAFS
ATP6_STRZP      KSIKSFMSPVFVIPMNILEEFTNFLSLALRIFGNIFAGEVMTSLLLLLSHQAIYWYPVAFGANLAWTAFS
ATP6_STRZJ      KSIKSFMSPVFVIPMNILEEFTNFLSLALRIFGNIFAGEVMTSLLLLLSHQAIYWYPVAFGANLAWTAFS
ATP6_STRR6      KSIKSFMSPVFVIPMNILEEFTNFLSLALRIFGNIFAGEVMTSLLLLLSHQAIYWYPVAFGANLAWTAFS
ATP6_STRPS      KSIKSFMSPVFVIPMNILEEFTNFLSLALRIFGNIFAGEVMTSLLLLLSHQAIYWYPVAFGANLAWTAFS
ATP6_STRPN      KSIKSFMSPVFVIPMNILEEFTNFLSLALRIFGNIFAGEVMTSLLLLLSHQAIYWYPVAFGANLAWTAFS
ATP6_STRPJ      KSIKSFMSPVFVIPMNILEEFTNFLSLALRIFGNIFAGEVMTSLLLLLSHQAIYWYPVAFGANLAWTAFS
ATP6_STRPI      KSIKSFMSPVFVIPMNILEEFTNFLSLALRIFGNIFAGEVMTSLLLLLSHQAIYWYPVAFGANLAWTAFS
ATP6_STRP2      KSIKSFMSPVFVIPMNILEEFTNFLSLALRIFGNIFAGEVMTSLLLLLSHQAIYWYPVAFGANLAWTAFS
ATP6_STRP7      KSIKSFMSPVFVIPMNILEEFTNFLSLALRIFGNIFAGEVMTSLLLLLSHQAIYWYPVAFGANLAWTAFS
ATP6_STRSV      GYLKGFVTPGIMTPMNILEEFTNFASLALRIYGNIFAGEVLAGLLLTWAHQAAYWYPIAFIMNMVWTGFS
ATP6_STRGC      KYLKAFVTPGFMTPMNILEEFTNFASLALRIYGNIFAGEVLSGLLVTLSHQAVFYYPLAFGLNLVWTAFS
ATP6_STRS7      AYLKRFATPWPMTPMNLLEEFTNFLSLAIRLFGNIFAGEVVTGLIVQLANYRLYWWPIAFLVNIAWTAFS
ATP6_STREM      AYLKRFATPWPMTPMNLLEEFTNFLSLAIRLFGNIFAGEVVTGLIVQLANYRLYWWPIAFLVNIAWTAFS
ATP6_STRE4      AYLKRFATPWPMTPMNLLEEFTNFLSLAIRLFGNIFAGEVVTGLIVQLANYRLYWWPIAFLVNIAWTAFS
ATP6_STRPZ      AHLKRLATPWPMTPMNLLEEFTNFLSLAIRLFGNIFAGEVVTGLIVQLANYRVYWWPIAFLVNMAWTAFS
ATP6_STRPM      AHLKRLATPWPMTPMNLLEEFTNFLSLAIRLFGNIFAGEVVTGLIVQLANYRVYWWPIAFLVNMAWTAFS
ATP6_STRPG      AHLKRLATPWPMTPMNLLEEFTNFLSLAIRLFGNIFAGEVVTGLIVQLANYRVYWWPIAFLVNMAWTAFS
ATP6_STRPF      AHLKRLATPWPMTPMNLLEEFTNFLSLAIRLFGNIFAGEVVTGLIVQLANYRVYWWPIAFLVNMAWTAFS
ATP6_STRPD      AHLKRLATPWPMTPMNLLEEFTNFLSLAIRLFGNIFAGEVVTGLIVQLANYRVYWWPIAFLVNMAWTAFS
ATP6_STRPC      AHLKRLATPWPMTPMNLLEEFTNFLSLAIRLFGNIFAGEVVTGLIVQLANYRVYWWPIAFLVNMAWTAFS
ATP6_STRPB      AHLKRLATPWPMTPMNLLEEFTNFLSLAIRLFGNIFAGEVVTGLIVQLANYRVYWWPIAFLVNMAWTAFS
ATP6_STRP8      AHLKRLATPWPMTPMNLLEEFTNFLSLAIRLFGNIFAGEVVTGLIVQLANYRVYWWPIAFLVNMAWTAFS
ATP6_STRP6      AHLKRLATPWPMTPMNLLEEFTNFLSLAIRLFGNIFAGEVVTGLIVQLANYRVYWWPIAFLVNMAWTAFS
ATP6_STRP3      AHLKRLATPWPMTPMNLLEEFTNFLSLAIRLFGNIFAGEVVTGLIVQLANYRVYWWPIAFLVNMAWTAFS
ATP6_STRP1      AHLKRLATPWPMTPMNLLEEFTNFLSLAIRLFGNIFAGEVVTGLIVQLANYRVYWWPIAFLVNMAWTAFS
ATP6_STRA5      GYLKGFLSPTAMLPMNLLEEVTNVASLALRLFGNIFSGEVVTGLLLQLAVLSPFTGPLAFALNIVWTAFS
ATP6_STRA1      GYLKGFLSPTAMLPMNLLEEVTNVASLALRLFGNIFSGEVVTGLLLQLAVLSPFTGPLAFALNIVWTAFS
ATP6_STRA3      GYLKGFLSPTAMLPMNLLEEVTNVASLALRLFGNIFSGEVVTGLLLQLAVLSPFTGPLAFALNIVWTAFS
ATP6_STRMU      TYLKDYLEPTAMLPMNLLEELTNIISLSLRLYGNIYAGEVVMALLVQFADFSPYATPIAFLLNMAWIGFS
ATP6_ENTFA      YLVNSYLRPVFLLPVKLMEEFTNLLTLGLRLYGNIFAGEVLLGLIATVASVGLWVIPLAIPLEMIWVAFS
ATP6_ENTHR      YFVNSFLKPYFMFPMKLIEEFTNLLTLALRLYGNIYAGEVLLTLIAMMNNLGWFSLPLAIPLEMVWIAFS
ATP6_OCEIH      AYLKTYVSPVLMLPFKIVEEFTNTLTLGLRLFGNIYAGEILLSLLVGLATTSIFGFFGAALPMLAWQTFS
ATP6_LISMF      HFVGTYFSPMFLFPLKLVEEFANTLTLGLRLYGNIFAGEVLLTIIATLAHMNIFVGVLAIIPALLWQGFS
ATP6_LISMC      HFVGTYFSPMFLFPLKLVEEFANTLTLGLRLYGNIFAGEVLLTIIATLAHMNIFVGVLAIIPALLWQGFS
ATP6_LISIN      HFVGTYFSPMFLFPLKLVEEFANTLTLGLRLYGNIFAGEVLLTIIATLAHMNIFVGVLAIIPALLWQGFS
ATP6_LISMO      HFVGTYLSPMFLFPLKLVEEFANTLTLGLRLYGNIFAGEVLLTIIATLAHINIFVGVLAIIPAIIWQAFS
ATP6_LISW6      HFVGTYFSPMFLFPLKLVEEFANTLTLGLRLYGNIFAGEVLLTIIATLAHMNIFVGVLAIIPALLWQGFS
ATP6_STAAW      QYLKGYVQPFWPLAINVFEEFTSTLTLGLRLYGNIFAGEILLTLLALFFNEPAWGWIISIPGLIVWQAFS
ATP6_STAAT      QYLKGYVQPFWPLAINVFEEFTSTLTLGLRLYGNIFAGEILLTLLALFFNEPAWGWIISIPGLIVWQAFS
ATP6_STAAS      QYLKGYVQPFWPLAINVFEEFTSTLTLGLRLYGNIFAGEILLTLLALFFNEPAWGWIISIPGLIVWQAFS
ATP6_STAAR      QYLKGYVQPFWPLAINVFEEFTSTLTLGLRLYGNIFAGEILLTLLALFFNEPAWGWIISIPGLIVWQAFS
ATP6_STAAN      QYLKGYVQPFWPLAINVFEEFTSTLTLGLRLYGNIFAGEILLTLLALFFNEPAWGWIISIPGLIVWQAFS
ATP6_STAAM      QYLKGYVQPFWPLAINVFEEFTSTLTLGLRLYGNIFAGEILLTLLALFFNEPAWGWIISIPGLIVWQAFS
ATP6_STAAE      QYLKGYVQPFWPLAINVFEEFTSTLTLGLRLYGNIFAGEILLTLLALFFNEPAWGWIISIPGLIVWQAFS
ATP6_STAAC      QYLKGYVQPFWPLAINVFEEFTSTLTLGLRLYGNIFAGEILLTLLALFFNEPAWGWIISIPGLIVWQAFS
ATP6_STAAB      QYLKGYVQPFWPLAINVFEEFTSTLTLGLRLYGNIFAGEILLTLLALFFNEPAWGWIISIPGLIVWQAFS
ATP6_STAA9      QYLKGYVQPFWPLAINVFEEFTSTLTLGLRLYGNIFAGEILLTLLALFFNEPAWGWIISIPGLIVWQAFS
ATP6_STAA8      QYLKGYVQPFWPLAINVFEEFTSTLTLGLRLYGNIFAGEILLTLLALFFNEPAWGWIISIPGLIVWQAFS
ATP6_STAA3      QYLKGYVQPFWPLAINVFEEFTSTLTLGLRLYGNIFAGEILLTLLALFFNEPAWGWIISIPGLIVWQAFS
ATP6_STAA2      QYLKGYVQPFWPLAINVFEEFTSTLTLGLRLYGNIFAGEILLTLLALFFNEPAWGWIISIPGLIVWQAFS
ATP6_STAA1      QYLKGYVQPFWPLAINVFEEFTSTLTLGLRLYGNIFAGEILLTLLALFFNEPAWGWIISIPGLIVWQAFS
ATP6_GEOSW      EYAKGFVSPMWILPLKIIEEFANTLTLGLRLYGNIYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWQAFS
ATP6_PEDPA      KYFKTYLSPFKVLPIGVFTEFIDFLTLGLRIYGVIFAGEMLLKMIGGIAFSGIVNMIVAIPLALIWQGFS
ATP6_BACPF      KYLKGYITPVFLLPFKIIEEFANTLTLGMRLFGNVYAKEILMILLVTAGTSGLIGMFGAFLPLIVWQAFG
ATP6_BACA2      EYSKDYLRPVLMFPMKIIEEFANTLTLGLRLYGNIFAGEI---LLGLLANLATNFYSNSFGAMLAWQAFS
ATP6_BACSU      EYSKDYLRPVFMLPMKIIEEFANTLTLGLRLYGNIFAGEIXXXXXXXTSH---YSQSVALGPMLAWQAFS
ATP6_BACME      AYTKDYFKPMFLFPLKIIEEFANTLTLGLRLYGNIYXXXXXXXXXXXXXXXXXXXXXXXXXPMLLWQGFS
ATP6_MACCJ      NYLKSFAQPVFMVPFKIIEEFSSTLTLGLRLYGNIFAGEVXXXXXXXXXXXXXXXXXXXXIPTLIWQGFS
ATP6_BACSK      TYGKSWFTPKFLFPFKVIEEGSNALTLGMRLFGNIYAKEILMLLLVSLGTTAVYWGIFAFVPLIVWQAFS
ATP6_STAES      AYAAGYFKPFWPLAINVFEEFTSTLTLGLRLYGNIFXXXXXXXXXXXXXXXQPAWWIISIPGLIVWQAFS
ATP6_STAEQ      AYAAGYFKPFWPLAINVFEEFTSTLTLGLRLYGNIFXXXXXXXXXXXXXXXQPAWWIISIPGLIVWQAFS
ATP6_LYSSC      HYAGTFFKPMFMFPLKLVEEFANTLTLGLRLYGNIYAGEIXXXXXXXXXXXXXVGFIGAIVPMMAWQGFS
ATP6_GEOKA      DYLRDYTRPVWLFPLKIIEEFANTLTLGLRLFGNIYAGEILLGLLASLTHYGVLGAVGAAIPMMVWQAFS
ATP6_BACST      DYLRDYTRPVWLFPLKIIEEFANTLTLGLRLFGNIYAGEILLGLLASLGTHYGVLGAVGEHSMMVWQAFS
ATP6_BACP3      DYLRDYTRPVWLFPLKIIEEFANTLTLGLRLFGNIYAGEILLGLLASLGTH--YGVLGAVGASMVWQAFS
ATP6_ANOFW      EYAKGFVSPMILFPLKIIEEFANTLTLGLRLYGNIFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWQGFS
ATP6_STACT      NYFKNYGQPFLALPVNIFEEFTNTLTLGLRLYGNIYAGEXXXXXXXXXXXXXXXXXXXXXVPGLAWQAFS
ATP6_LACF3      GYFADYFKPFLMFPIKLVEEFSNFLTLGLRIFGNIYAGELLLKLLMAFSH-GIPTMIVSLPLEIIWQGFS
ATP6_STAS1      GYFQNYTKPIFLLPINIFEEFTSTLTLGLRLYGNIFXXXXXXXXXXXXSTRAWGWI-IGLPGLVVWQGFS
ATP6_LACRJ      GYLKGYTKPTLMLPVNIIEDFANFLTLGLRIFGNIFAGELLMSLIMAFSHGILTIIPGLF-LELAWQGFS
ATP6_LACRD      GYLKGYTKPTLMLPVNIIEDFANFLTLGLRIFGNIFAGELLMSLIMAFSHGILTIIPGLF-LELAWQGFS
ATP6_STAHJ      AYIGNYFKPFWPLAINVFEEFSSTLTLGLRLYGNIFXXXXXXXXXXXXXXXXXWGWIIGIPGLIVWQGFS
ATP6_BACCA      DYLRDYTRPVWLFPLKIIEEFANTLTLGLRLFGNIYAGEILLGLLASLTHYGVLGCSIPMMVIMVWQAFS
ATP6_BACP2      EYTKDYFRPILLVPLKIIEEFANTLTLGLRLYGNIFAGEIXTNFYSQNXXXXXXXXXXXXVPMIVWQAFS
ATP6_DESRM      GHIGHYFQPFFVV-IHLIEEIARPVTLAFRLYGNIFAGEVLIAVLLGLININAYVFG-GFIPSVIWLAFS
ATP6_SULDN      KYFKHFLGPVWMFPIEIVSHFSRLVSLSFRLFGNVKGDDMFLMVILMLAPWVLPMIPY---------ALL
ATP6_MYCLE      GHPVAVLKGAFLAPINLVEEITKPISLSLRLFGNIFAGGILVTLIALFP-PYIMWAP-----NAIWKSFD
ATP6_ACIC1      RYIRHYFEPYKIFPINVVEELAKPITLALRLFGNIFSGAIMVSLLALMP-PYVLWLP-----QWLWKLID
ATP6_MOOTA      GYIRHFFQPAFLFPLNVIEELVKPVSLSLRLFGNLFGEEMVVTILFLM---------IPFLLPTPIMLLG
ATP6_HELPY      KYFAHFAGPVFMFPIEIISHFSRIVSLSFRLFGNIKGDDMFLLIMLLLVPWAV---PVA--------PFM
ATP6_HELPS      KYFAHFAGPVFMFPIEIISHFSRIVSLSFRLFGNIKGDDMFLLIMLLLVPWAV---PVA--------PFM
ATP6_HELPH      KYFAHFAGPVFMFPIEIISHFSRIVSLSFRLFGNIKGDDMFLLIMLLLVPWAV---PVA--------PFM
ATP6_HELPG      KYFAHFAGPVFMFPIEIISHFSRIVSLSFRLFGNIKGDDMFLLIMLLLVPWAV---PVA--------PFM
ATP6_HELHP      KYFKHFMGPVWMFPVEIISHFSRIISLSFRLFGNIKGDDMFLLVMLML---APWIVPVAPFAIL------
ATP62_BRASB     GYLASFAEPLIMLPLNILSEITRTFSLMVRLFGNIMSGEFIIGLVVAL---AGLFVPIPL------MALE
ATP6_HELPJ      KYFAHFAGPVFMFPIEIISHFSRIVSLSFRLFGNIKGDDMFLLIMLLLVPWAV---PVA--------PFM
ATP6_HELP2      KYFAHFAGPVFMFPIEIISHFSRIVSLSFRLFGNIKGDDMFLLIMLLLVPWAV---PVA--------PFM
ATP6_HELAH      KYFAHFAGPVFMFPIEIISHFSRIVSLSFRLFGNIKGDDMFLLIMLLLVPWVI---PVA--------PFM
ATPI_OEDCA      YFKRYIQPVVFLLPLNVLEDFSKPLSLSFRLFGNILADELIVGVLVAL---------VPLFVPIPLMLLG
ATP6_SYNS9      RFFELYVEPTIMLPFKIIEEFTKPLSLSFRLFGNILADELA---------XXXXXXXXXXXXXXXXXXXX
ATPI_PAUCH      RYFEYYVEPTIMLPFKIIEDFTKPLSLSFRLFGNILADELVVGVLAFL---------VPILVPLPAMFLG
ATP6_SYNS3      RFFELYVEPTIMLPFKIIEEFTKPLSLSFRLFGNILADELA---------XXXXXXXXXXXXXXXXXXXX
ATP6_PROMS      RYFEYYVHPTIMLPFKILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXXXXG---------
ATP6_PROMP      RYFEYYVHPTIMLPFKILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATP6_MYCUA      HPIKLLKGHVAILPINLVEEIAKPISLSLRLFGNIFAGSILVALIALFP-PYIMWAP-----NAIWKSFD
ATP6_MYCTU      KLLKGHVT--LLAPINLVEEVAKPISLSLRLFGNIFAGGILVALIALFPPY-IMWAP-----NAIWKAFD
ATP6_MYCBO      KLLKGHVT--LLAPINLVEEVAKPISLSLRLFGNIFAGGILVALIALFPPY-IMWAP-----NAIWKAFD
ATP6_PROM9      RYFEYYVHPTIMLPFKILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXXXXG---------
ATP6_PROM5      RYFEYYVHPTIMLPFKILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATP6_PROM2      RYFEYYVHPTIMLPFKILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXXXXG---------
ATP6_PROM0      RYFEYYVHPTIMLPFKILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXXXXG---------
ATP6_MYCMM      HPIKLLKGHVAILPINLVEEIAKPISLSLRLFGNIFAGGILVALIALFP-PYIMWAP-----NAIWKSFD
ATPI_CHAVU      YFGKYIKPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXP-IPMMF--------LG
ATP6_XANP2      HLFVPSGVPAFLLPFLVVIEVVSFLSLSLRLFANMLAGHIALKVFALASAGVVGWFTLPFFMIVALYALE
ATP6_ARCB4      AYFKHFMGPMPVLPIEIISHLSRIVSLSFRLFGSI-RGDDMFXXXXXXXXPWILPLPGFF----LLTAFG
ATPI_CHLAT      YFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXXXXG---------
ATP6_SYNPX      RFFELYVEPTIMLPFKIIEEFTKPLSLSFRLFGNILADE---------XXXXXXXXXXXXXXXXXXXXXX
ATPI_RHDSA      YFARYVQPTPILLPINILEDFTKPLSLSFRLFGNVLADELVVSVFAXXXXXXXXXXXMTLG---------
ATP6_WOLPP      KGTPSWLAPIIII-IKLFAYLVRPISLSIRLAANMIAGHTIIKVIAFVINMNIFFTPAPFLFIIALIGFE
ATPI_GUITH      YFSRYVQPTPILLPINILEDFTKPLSLSFRLFGNVLADELVVSVFAXXXXXXXXXXXMTLG---------
ATP6_WOLPM      KGTPSWLAPIIII-IKLFAYLVRPVSLSIRLAANMIAGHTIIKVIAFIVNMNIFFTPAPFLFIIALIGFE
ATPI_NEPOL      YFSKYLKPTPILLPINILEDFTKPLSLSFRLFGNVLADEXXXXXXXXXXXXXXXXXXXXXG---------
ATPI_OCHNE      FFARYISPTPIFLPINILEDFTKPLSLSFRLFGNILADEIXXXXXXXXXXXXXXXXXXXXG---------
ATPI_ANGEV      YFGKYIQPTPVLLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXMMFLG---------
ATP6_SYNPW      RYFEYYVEPTIMLPFKIIEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXXXXG---------
ATP6_SYNP1      YFTKYIEPTPVLLPIAILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMALG---------
ATPI_SCEOB      YFNRYVQPAAFLLPINVLEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXXXXGC--------
ATP6_CHLT3      AHLTGGTHPIIMVPVEFIGLFTKPFALTVRLFANMTAGHVIISLLGLIFVFKTYMIPVSVAFALFIYLLE
ATPI_OLTVI      Y-FKRYVEPAFLLPINVLEDFTKPLSLSFRLFGNILADELVT---------XXXXXXXXXXXXXXXXXXX
ATP6_WOLWR      KGTPSWLAPIIII-IKLFAYLVRPVSLSIRLAANMIAGHTIIKVIAFIVNMNIFFTPAPFLFIIALIGFE
ATP6_SYNSC      RFFELYVEPTIMLPFKIIEEFTKPLSLSFRLFGNILADELA---------XXXXXXXXXXXXXXXXXXXX
ATP6_NITSB      HYFAHFAGPVLMFPIEIVSHISRIISLSFRLFGNIKGDDLFVWVLLML---APWIVPLPGFALMTFSAF-
ATP6_CAMJD      KYFAHFMGPILMFPIEIVSHLSRVVSLSFRLFGNIKGDDLFLMVILAL---------VPYIAPLPAYVLL
ATPI_CYACA      YFLKYISPTPILLPINILEDFTKPLSLSFRLFGNIVADE-------------------------------
ATP6_PROMO      GFFKGLFEPMLMFPINLAGEFAKPTNISIRLFGNMFAGMVILGLLYKAA-------PVLIPAPL-HLYFD
ATP6_FRASN      TYFKDMLAPLFVKVILAPIEFVSTMTLAIRLFANMFAGHM---LLLVFALGADYLLPFVFGMAIALTLFE
ATPI_STAPU      YFGKYLQPTPVLLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXP-IPMMF--------LG
ATP6_RHOE4      KYVKSIVVPGVPLPLHFLLVPIEFISLMVRLMANMLAGHILLVLFFSATNQAIFGVPSII-AGIAFTFFE
ATP62_SYNP2     GYLKSYLQPTIMLPFQIIGEFSRTLALAVRLFGNIMSGN-----XXXXXXXXXXXXXXXXXMNLLGLVFG
ATP6_PROMA      RYFEYYVHPTIMLPFKIVEDFTKPLSLSFRLFGNILADE-------------------------------
ATPI_PSINU      YFGRYIKPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXMMFLG---------
ATPI_PHAVU      YFSKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_MARPO      YFGKYIQPTPVLLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXMMFLG---------
ATPI_MESVI      RYFKRYISPTVLLPINLLEDFTKPLSLSFRLFGNILADE---------XXXXXXXXXXXXXXXXXXXXXX
ATPI_GALSU      YFSRYIKPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMMLG---------
ATP6_PROM4      RYFEYYVHPTIMLPFKIVEDFTKPLSLSFRLFGNILADE-------------------------------
ATP6_MAGSA      PHGAPIATAVILIPIELISYFSRPFSLAVRLFANMTVGHIILKVMFVVSLGAFYLIPVPFAFLSAITVLE
ATP6_ANAMM      RIFLPEGTPLWLAPMMVFIKLFAYVSLAIRLAANMIAGHTIIAVIVLKMHLVLAPLPFAFIMGLI--AFE
ATP61_PROA2     AYLKSYMKPTFILPFNIISEFSRTLALAVRLFGNMMSGVMIIGILLGI---APLFFPVLM------SVLG
ATP6_SULNB      HYFAHFAGPVLMFPIEIVSHLSRIISLSFRLFGNIKGDDLFLWVLLML---------VPFVAPLPAYLLL
ATP6_BARQU      KLFVPSGVPVVILPLVTMIEVISFISLSLRLFANMLAGHITLKVFSGFIVSMIELGIMGVGGSIAITALE
ATPI_STIHE      YFKRYVQPAVFLLPINVLEDFSKPLSLSFRLFGNILADE---------XXXXXXXXXXXXXXXXXXXXXX
ATP6_SYNR3      KFFEYYVEPTIMLPFKIIEEFTKPLSLSFRLFGNILADE---------XXXXXXXXXXXXXXXXXXXXXX
ATP6_RICTY      KHGMSFLTPVWLAPLMIVIELFTYLSLSLRLAANMMAGHVLVSLMIYLKFLPIPLIVILIG-------FE
ATP6_CAMHC      KYFAGFCGPVFMFVIEVISHLSRIISLSFRLFGNIKGDDLFLLVMLTLAPVLVPMIPYALLS--------
ATPI_CHAGL      YFGKYIQPTPVLLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXMMFLG---------
ATP6_TRIEI      GYFAGYAEPVFMVPFKIIEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXXXXG---------
ATP6_THEEB      YFTKYIEPTPVLLPIAILEDFTKPLSLSFRLFGNILADE---------XXXXXXXXXXXXXXXXXXXXXX
ATP6_SYNFM      Y-IKHFMGPVWIMPIEIIGHIARVLSLSIRLFGNVFGEELVLGILFFLAGFYLAPLPMMF--------LG
ATP6_HAEIN      GLVKEYTLHPFFIPVNFILETVTLLSLAFRLFGNMYAGELIFILIAVMYSANMAIAALGIPLHLAWAIFH
ATP6_HAEIG      GLVKEYTLHPFFIPVNFILETVTLLSLAFRLFGNMYAGELIFILIAVMYSANMAIAALGIPLHLAWAIFH
ATP6_HAEIE      GLVKEYTLHPFFIPVNFILETVTLLSLAFRLFGNMYAGELIFILIAVMYSANMAIAALGIPLHLAWAIFH
ATP6_HAEI8      GLVKEYTLHPFFIPVNFILETVTLLSLAFRLFGNMYAGELIFILIAVMYSANMAIAALGIPLHLAWAIFH
ATP62_CHLTE     GYLQHLTAGIIMVPIEILGQFTKPFALTIRLFANMTAGH-XXXXXXXXXXXXXXXXXVAVAVSIPFAIFE
ATPI_CITSI      YFSKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATP6_HAEDU      GLAKEYTLHPFFIPVNFILETVTLLSLAFRLFGNMYAGELIF-ILIAVMYMADNFALQALGIHLVWAIFH
ATP6_DESMR      GYIKHFMGPFWMLPIEIISHLARPLSLTLRLFGNI-RGEEIXXXXXXXXXXXXGTFPMYFLFSLA-----
ATP6_ACTPJ      GLVKEYTLHPFFIPVNFILETVTLLSLAFRLFGNMYAGELIF-ILIAVMYMADNFALQALGIHLVWAIFH
ATP6_ACTP7      GLVKEYTLHPFFIPVNFILETVTLLSLAFRLFGNMYAGELIF-ILIAVMYMADNFALQALGIHLVWAIFH
ATP6_ACTP2      GLVKEYTLHPFFIPVNFILETVTLLSLAFRLFGNMYAGELIF-ILIAVMYMADNFALQALGIHLVWAIFH
ATP6_PSEE4      GSSKNIVLQIILIPVNFLLEFVTLISLALRLFGNMYAGELVFILIAVMFGAGLLWLSIAVVLQWAWALIH
ATP6_EHRCR      HQGIHFLTPGWLAPMMVFIELFAYVSLSIRLAANMIAGHTIIKVIAFVIKMNIFLTPLPMAFIIILIGFE
ATP6_DESPS      Y-YKHFIGPMLMLPIELISNFARLLSLSIRLFGNIMAKEVLLGILFGLAGM--------FFAPLPIMVLG
ATPI_PHYPA      YFGKYIQPTPVLLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXMMFLG---------
ATPI_CRYJA      YFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_BIGNA      YFGRYVQPTPFLLPINVLEDFTKPLSLSFRLFGNLLADELVI---------AXXXXXXXXXXXXXXXXXX
ATP6_CHLPB      GYLAHLTAGIIMIPIEVIGLFTKPFALTIRLFANMTAGHXXXXXXXXXXXXXKS-YIVAIFVSVPFSIFE
ATPI_MANES      YFSKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_JASNU      YFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_DIOEL      YFRKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_CYCTA      YFGKYIQPTPVLLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATP6_RUBXD      TYLKSWMYPIMWF-LHLIQEFTKPLTLALRLYANILAGHLI--IFVFLSLILYFGLPTAFVSAVVFYAFE
ATP6_RHOFD      GYLKSYVEPVIMLPFNIISEISRTLALAVRLFGNMMSGAMIIGILLTITP---FIFPIVM------TALG
ATP6_ANAVT      GYFGNYVQPVFMLPFKIIEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMALG---------
ATP6_ANASP      GYFGNYVQPVFMLPFKIIEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMALG---------
ATPI_CHLVU      Y-FKRYISPAFLLPINILEDLTKPLSLSFRLFGNILADE---------XXXXXXXXXXXXXXXXXXXXXX
ATPI_ADICA      YFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADE---------XXXXXXXXXXXXXXXXXXXXXX
ATPI_PEA        YFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_OSTTA      YFGKYVQPTPILLPINVLEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXXXXG---------
ATPI_CICAR      YFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATP6_HALHL      GWLKSWLAPANLI-LNIVEFIAKPVSLSLRLFGNLYAAELVFILISLLP----WWIQWALGT--PWAIFH
ATP6_GLOVI      YFKHYFESPI-LAAVWVLEFFTRPLSLSIRLFGNILAEE---------XXXXXXXXXXXXXXXXXXXXXX
ATP6_CAMJR      KYFAHFMGPILMFPIEIVSHLSRVVSLSFRLFGNIKGDDLFLMVILAL---------VPYIAPLPAYVLL
ATP6_CAMJJ      KYFAHFMGPILMFPIEIVSHLSRVVSLSFRLFGNIKGDDLFLMVILAL---------VPYIAPLPAYVLL
ATP6_ACTSZ      GLVKEYTLHPFLVPVNFILETVTLLSLAFRLFGNMYAGELIFILIAVMYSANAAIAALGIPLHLAWAIFH
ATPI_EUGGR      YFKKYVQPTPILLPINILEDFTKPLSLSFRLFGNILADE---------XXXXXXXXXXXXXXXXXXXXXX
ATP6_WOLSU      KYFAHFAGPVLLFPIEIISHCSRVISLSFRLFGNIKGDDMFLLVMLMLAP----WI-----APLPAFVIL
ATP6_RICCN      -FLTLFLTPLWLAPLMIVIELFTYLSLSLRLAANMMAGHVLLKVIAGFTVSLIYLKFLPIPIMVILIGFE
ATP6_PSEMY      GFTKELSFTPFLIPFNLFLEITKPLSLALRLFGNMYAGEVVFILIALLP------FYVQWGLNVPWAIFH
ATP6_PROMM      RYFEYYVHPTIMIPFKIVEDFTKPLSLSFRLFGNILADE-------------------------------
ATP6_PROM3      RYFEYYVHPTIMIPFKIVEDFTKPLSLSFRLFGNILADE-------------------------------
ATPI_PHAAO      YFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_HELAN      YFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_CHLRE      YFSRYVEPAAFLLPINVLEDFTKPLSLSFRLFGNILADE---------XXXXXXXXXXXXXXXXXXXXXX
ATP6_RICPU      -FLTLFLTPLWLAPLIIVIELFTYLSLSLRLAANMMAGHVLLKVIAGFTVSLIYLKFLPIPIMVILIGFE
ATP6_NITMU      RYLQSYLKPVLLLPFNILGEFTRTLALAVRLFGNMMSGTMILAIMLIITP---FIFPVVMG------VLH
ATP6_CAMFF      KYFAHFMGPNKILPIEIVSHLSRIVSLSFRLFGNIKGDDLFLMVVLSLAP----WV-----APLPAFALL
ATPI_LEMMI      YFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_GOSBA      YFSKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_EUCGG      YFSKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_ANTFO      YSGKYIQPTPILLPINILEDFTKPLPLSFRLFGNILADEXXXXXXXXXXXXXXXXXMMFLG---------
ATP6_RICM5      -FLTLFLTPLWLAPLMIVIELFTYLSLSLRLAANMMAGHVLLKVIAGFTVSLIYLKFLPIPLMMILIGFE
ATP6_RICFE      -FLTLFLTPLWLAPLMIVIELFTYLSLSLRLAANMMAGHVLVSLMIYLKFLPIPLMVILIG-------FE
ATP6_COXBU      GLGKEVLSRPFLMPINVIDEGVKPISLALRLFGNLFAGELIFILIALLP----WWSQFTLG--MVWTLFH
ATP6_COXBR      GLGKEVLSRPFLMPINVIDEGVKPISLALRLFGNLFAGELIFILIALLP----WWSQFTLG--MVWTLFH
ATP6_COXB1      GLGKEVLSRPFLMPINVIDEGVKPISLALRLFGNLFAGELIFILIALLP----WWSQFTLG--MVWTLFH
ATP6_CAMJE      KYFAHFMGPILMFPIEIVSHLSRVVSLSFRLFGNIKGDDLFLMVILAL---------VPYIAPLPAYVLL
ATP6_CAMJ8      KYFAHFMGPILMFPIEIVSHLSRVVSLSFRLFGNIKGDDLFLMVILAL---------VPYIAPLPAYVLL
ATP6_BUCAP      LTLQPFNHPVFFI-FNFLLELVSLLSLGLRLFGNMYSGEM---IFILIAGLLPWWSQ--FFLNVPWAIFH
ATP62_PELLD     GYLTHLTAGIIMIPIEVIGLFTKPFALTVRLFANMTAGHIV-XXXXXXXXXXXKSYVVAAAVSVPFSIFE
ATPI_COFAR      YFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_CARPA      YFSKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATP6_PSEAE      GSSKNIVVQILLIPVNFLLEFVTLISLALRLFGNMYAGELIFILIAVMFGSGMFLLSLGVALNWAWAVFH
ATP6_PSEAB      GSSKNIVVQILLIPVNFLLEFVTLISLALRLFGNMYAGELIFILIAVMFGSGMFLLSLGVALNWAWAVFH
ATP6_PSEA8      GSSKNIVVQILLIPVNFLLEFVTLISLALRLFGNMYAGELIFILIAVMFGSGMFLLSLGVALNWAWAVFH
ATP6_PSEA7      GSSKNIVVQILLIPVNFLLEFVTLISLALRLFGNMYAGELIFILIAVMFGSGMFLLSLGVALNWAWAVFH
ATP6_COXB2      GLGKEVLSRPFLMPINVIDEGVKPISLALRLFGNLFAGELIFILIALLP----WWSQFTLG--MVWTLFH
ATP62_PELCD     Y-FKHFMGPVWILPIELIGHLARPLSLSLRLFGNMYGHEI---VLMIFFSXXXXXXXXXXXXXXXXXAF-
ATPI_SPIOL      YFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_CALFG      YFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_PORYE      YFARYIQPTPVLLPINILEDFTKPLSLSFRLFGNVLADELVVSVFTXXXXXXXXXXVMILG---------
ATP6_PSYA2      GSAKNPIVQIILIPINFILEFVTLISLGLRLFGNMYAGELIFILIALMP----FW--IQWALSVPWAIFH
ATP6_PROMT      RYFEYYVHPTIMLPFKIVEDFTKPLSLSFRLFGNILADE-------------------------------
ATP6_PROM1      RYFEYYVHPTIMLPFKIVEDFTKPLSLSFRLFGNILADE-------------------------------
ATPI_PORPU      YFARYVQPTPVLLPINILEDFTKPLSLSFRLFGNVLADELVVSVFTXXXXXXXXXXVMILG---------
ATPI_OENPA      YFSKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_OENGL      YFSKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_OENEH      YFSKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_OENBI      YFSKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_OENAR      YFSKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_NUPAD      YFGKYIQPTPILLPINVLEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_LEPVR      YFSKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_LACSA      YFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_DRANE      YFSKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_CUCSA      YFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATP6_SHEFN      GFVKELTFQPFMIPVNLLLETVTLISLALRLFGNLYAGELIFILIALMYGSNVALSALGVGLQLGWLIFH
ATP6_RICRS      -FLTLFLTPLWLAPLMIVIELFTYLSLSLRLAANMMAGHVLLKVIAGFTVSLIYLKFLPIPIMVILIGFE
ATP6_RICRO      -FLTLFLTPLWLAPLMIVIELFTYLSLSLRLAANMMAGHVLLKVIAGFTVSLIYLKFLPIPIMVILIGFE
ATP6_ELUMP      GYLKHFVTPWFLAPLEILGLFTKTAALALRLFANMIAGHIICFICLIFIMTAINKYAGIFGLSLFVNLLE
ATP6_COXBN      GLGKEVLSRPFLMPINVIDEGVKPISLALRLFGNLFAGELIFILIALLP----WWSQFTLG--MVWTLFH
ATP6_CLOAB      GYIKSIFSQPIMVPMNLLEKVTIPVSLCLRLFINMLVGAIVMS--LIYSTPAKILLPVPLHG-----FFD
ATPI_VITVI      YFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_PELHO      YFNKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_NASOF      YFSKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_LOBMA      YFSKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_GOSHI      YFSKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_DAUCA      YFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_CRUWA      YFSKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_BARVE      YFSKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_ARATH      YFSKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_OLIPU      YFSKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_BUXMI      YFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_ACOCL      YFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_ACOAM      YFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATP6_YERE8      GFVKEFNHPIF-IPVNLILEGVSLLSLGLRLFGNMYAGE----LIFILIAGLLPWWS-QWMLSLPWAIFH
ATP6_THIDA      SELAFQPFPKFLFPVNLLLEGVGLISLALRLFGNMYAGEMIFILIALMFGGG--WVLALFGGALAWAVFH
ATP6_ANAPZ      RIFLPEGTPLWLAPMMVFIKLFAYLSLAIRLAANMIAGHTIIAVIVLKMHPVLAPLPFAF--IMVLIAFE
ATPI_SOYBN      YFNKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_POPTR      YFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_POPAL      YFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_PANGI      YFGKYIQPTPILLPINILEDFTKPLSLSFRLFGDILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_LOTJA      YFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_GUIAB      YFGKYIQPTPILLPINILEDFTKPLSLSFRLFGKILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_AMBTC      YFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATP6_PASMU      GFVKEYTLHPFLIPVNLALESVTLLSLAFRLFGNMYAGELIF-ILIAVMYMANNFALNSMGIHLAWAIFH
ATP6_MARAV      GFSKELAFNPFMIPFNLLLEILALISLALRLFGNMYAGEVVFILIALLP----LW--IQWTLNVPWAIFH
ATP6_MANSM      GLVKEYTLHPFLIPVNFVLESVTLLSLAFRLFGNMYAGELIFILIAVMYSANAAIAALGIPLHLAWAIFH
ATP6_DICNV      SS--GLIGKILLFPANIVEDMAKIVSLSLRLFGNLFAGEIVFILITFLPFWS-QWVPGG-----AWAIFH
ATP62_OCHA4     -FFRLFMXXXXXXXXXXMSYISRPVSHSVRLFAKVFAGFVIXXXXXXXXXXXXAVLPLAM--TVALTALE
ATPI_TRACE      YFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_PINKO      YFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_MORIN      YFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_FAGEA      YFSKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_AETCO      YFSKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATP6_STRLI      GFFKNVLGPVLPLAM-LIEFFSNILTHAVRLFANMFAGHTLLLLFTLLNGVGIAYAGVSFIMTVVMTAFE
ATP6_SERP5      GFVKEFNHPLF-IPINLILEGVSLLSLGLRLFGNMYAGELIFILIAGLLPWWSQWL-----LNVPWAIFH
ATP6_RICPR      TLFLPHGTPVWLAPLMIVIELFTYLSLSLRLAANMMAGHVLLKVIASFTVSLIYLKFLPIPLMVILIGFE
ATP6_PSYWF      GSAKNPIAKIILIPINFILEFVTLISLGLRLFGNMYAGELIFVLIALMP----FW--IQWALSVPWAIFH
ATPI_PINTH      YFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_AETGR      YFSKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATP6_ACIBL      GYLKHFLGPVWWISIEICSHFARIMSLTIRLYANMFAGDMVTLAFFSL---------VPLGFPVVFMGLH
ATPI_SOLLC      YFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADE---------XXXXXXXXXXXXXXXXXXXXXX
ATPI_PIPCE      YFSKYIQPTPILLPINVLEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATP6_SYNJA      KYIEP--TPV-LLPINVLEDFTKPLSLSFRLFGNXXXXXXXXXXXXXXXXXXXXXXXM---------ILF
ATP6_MARMS      GFVGELTLQPFMIPFNLLLEGVGLLSLALRLFGNLYAGELIFILIAILP------WGVQWALSVPWAIFH
ATP6_DICDI      SGIEPWLLPLLVF-IEIMSYVLRPISLAVRLFANMLAGHL---LIHIIGVAAIYLMQFYFIGILPWICVI
ATP6_BARBK      KHGIGFLKPVMILPLEVISFFSRPISLSLRLFANMLAGHITLKVFSGFIVSMVGLGFIGVGGSIAITALE
ATP6_ALHEH      ELLFHPFGPPFNLILNIIELIAKPISLSLRLFGNMYAAELIFILISLLP----WWIQWALGT--PWAIFH
ATPI_NYMAL      YFGKYIQPTPILLPINVLEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_ILLOL      YFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATP6_SYMTH      GWLKHILH---LGPLSLLEEIVHPFSLSLRLFGNIFGEETLLAVIIFLAPMI---------APIPIMVLS
ATP6_PSYCK      GSAKNPIVQIILIPINFILEFVTLISLGLRLFGNMYAGELIFILIALMP----FW--IQWALSVPWAIFH
ATP6_PSEU5      GFTKELAFTPFLVPFNLFLEITKPLSLALRLFGNMYAGEVVFILIALLP------FYVQWTLNVPWAIFH
ATP6_NOSP7      KYIEP--TPV-LLPIAILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXXXXG---------
ATP6_MYXXD      GYLKHLTGGVIMVPVEVLGLFTKPFALTMRLFANMLAGHIVYXXXXXXXXXXXHXXXXXXXXXXXXXIFE
ATP6_DICCI      SGIEPWLLPLLVF-IEIMSYVLRPISLAVRLFANMLAGHL---LIHIIGVAAIYLMQFYFIGILPWICVI
ATP61_SYNP2     GYLKKYLEPTILLPINILEDFTKPLSLSFRLFGNILADE-------------------------------
ATPI_PSEAK      Y-FKRYVSPAFLLPINVLEDFTKPLSLSFRLFGNILADE---------XXXXXXXXXXXXXXXXXXXXXX
ATPI_LIRTU      YFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_TOBAC      YFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADE---------XXXXXXXXXXXXXXXXXXXXXX
ATPI_SOLTU      YFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADE---------XXXXXXXXXXXXXXXXXXXXXX
ATPI_SOLBU      YFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADE---------XXXXXXXXXXXXXXXXXXXXXX
ATPI_RANMC      YFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_PLAOC      YFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_NICTO      YFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADE---------XXXXXXXXXXXXXXXXXXXXXX
ATPI_NICSY      YFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADE---------XXXXXXXXXXXXXXXXXXXXXX
ATPI_LOLPR      YFEKYIKPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_CHLSC      YFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_ATRBE      YFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADE---------XXXXXXXXXXXXXXXXXXXXXX
ATP6_PSEPW      GFIKNIFVQILLIPVNFLLEFVTLISLALRLFGNMYAGELVFILIVMFXXXXXXXXXXXXXXQWAWAVFH
ATP6_PSEPG      GFIKNIFVQILLIPVNFLLEFVTLISLALRLFGNMYAGELVFILIVMFXXXXXXXXXXXXXXQWAWAVFH
ATP6_WOLTR      EGIPSWLAPMMVF-IKLFAYLARPISLSIRLAANMIAGHTIIKVVAFIMNMHXXXXXXXXXXXXXXXGFE
ATP6_RHORU      YFRMFFXXXXXXXXXXXXSYLSRPFSLSVRLFANMTVGHIMLKVLAFVIMXXXXXXXXXXXXXXXXXXXE
ATP6_RHORT      YFRMFFXXXXXXXXXXXXSYLSRPFSLSVRLFANMTVGHIMLKVLAFVIMXXXXXXXXXXXXXXXXXXXE
ATP6_RHIEC      HFLNVFVPPGILLPLVVAIEIISFLSLSVRLFANMLAGHITLKVFXXXXXXXXXXXXXXXXMTVALTGLE
ATP6_EDWI9      KTLQPFNHPVF-IPVNLILEGVSLLSLGLRLFGNMYAGELIFILIAGLLPWWSQWL-----LNVPWAIFH
ATP6_BUCBP      GFLKDFHNPIFFVFNFILESISLLVSLGLRLFGNMYAGEM---IFILISGLLPWW--LQWILSVPWAIFH
ATPI_WHEAT      YFEKYIKPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_SACOF      YFEKYIKPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_SACHY      YFEKYIKPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_MAIZE      YFEKYIKPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_HORVU      YFEKYIKPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_DRIGR      YFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_AGRST      YFEKYIKPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATP6_SYNJB      YFKKYIEPTPILLPINVLEDFTKPLSLSFRLFGN------------------------------------
ATP62_VIBHB     GFIKELTTQPFLYPVNLVLELVTLISLGLRLFGNMYAGEMIFILIALMP-----WW-MQWALSVPWALFH
ATP61_CYAA5     NYLRHYIQPTPVLPFNLISEISRTVSLAIRLFGNIMSTSLLVAILISI-------VPLFFPA--VMTLFG
ATPI_SORBI      YFEKYIKPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_CUSEX      KYIKP--TPI-LLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXXXXG---------
ATPI_BRADI      YFEKYIKPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATP6_SINMW      GFLKLFVPPGALLPLVVAIEIISFLSLSVRLFANMLAGHITLKVFXXXXXXXXXXXXXXXXMTVALTGLE
ATP6_HAEPS      GFVKEYTLHPFFIPVNFVLEIVTLLSLAFRLFGNMYAGELIFILIAVMMADNFXXXXXXXXXXXAWAIFH
ATP62_CYAA5     GYFANYVQPIVLLPIKILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMALG---------
ATPI_ORYSJ      YFEKYIKPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_ORYSI      YFEKYIKPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_ORYSA      YFEKYIKPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_CUSRE      YFSKYIKPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATP6_RHOPS      LFVPSGV-PVYILPLVVFIEVISFVSHSVRLFANMLAGKVFASFVGMLGALGFLGWMGAIGLTVAVTALE
ATP6_HAES2      GFVKEYTLHPFFIPVNFLLEAVTLLSLAFRLFGNMYAGELIFVLIAVM-YMADNIIPQVLGIHLIWAIFH
ATP6_CHLPD      GYLAHLTGGIIMIPIEFIGLFTKPVALTIRLFANMTAGHXXXXXXXXXXXXXXXXX-VAVAMSVPFSIFE
ATP6_ACIAD      LALNPFVAKALLIPVNLILELVTFLSLALRLFGNMYAGELIFILIALLP----FW--IQWALSVPWAIFH
ATP62_PHOPR     GFIKELTTQPFLYPVNFLLELITLISLGLRLFGNMYAGEMIFILIALMP----WW--MQWALSVPWALFH
ATP61_ACAM1     KYIEP--TPV-LLPIAILEDFTKPLSLSFRLFGNILADE-------------------------------
ATP6_PECCP      GFVKEFNHPVF-IPINLILEGVSLLSLGLRLFGNMYAGELIFILIAGLLPWWSQWL-----LNVPWAIFH
ATP6_HAES1      GFVKEYTLHPFFIPVNFLLEAVTLLSLAFRLFGNMYAGELIFVLIAVM-YMADNIIPQVLGIHLIWAIFH
ATP62_ACAM1     GYLQQYLQPPIMLPFNIIGDFSRIVALAVRLFGNVMSGTMIVGILLSV---APLFFPVMM------QVLG
ATPI_ORYNI      YFEKYIKPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_NANDO      YFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATPI_ANTSP      YFSRYIEPTPVLLPINILEDFTKPLSLSFRLFGNVLADELVVS---------VFTXXXXXXXXXXXXXXX
ATP6_SULSY      HFLGPVMAPVFVI-IELLSHLSRPVTLALRLFANMTGGELISVVLIML---------VPFLIPMPVMLIH
ATP6_PSEPK      GFIKNIFVQILLIPVNFLLEFVTLISLALRLFGNMYAGELVFILIVMFXXXXXXXXXXXXXXQWAWAVFH
ATP6_PSEP1      GFIKNIFVQILLIPVNFLLEFVTLISLALRLFGNMYAGELVFILIVMFXXXXXXXXXXXXXXQWAWAVFH
ATP6_ERWCT      GFVKEFNHPVF-IPINLILEGVSLLSLGLRLFGNMYAGELIFILIAGLLPWWSQWL-----LNVPWAIFH
ATP6_SYNP6      YFGNYVHPTPVMLPFKILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMILG---------
ATP6_SYNE7      YFGNYVHPTPVMLPFKILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMILG---------
ATP6_RHOPB      IFVPSGV-PVFILPLVVFIEVFSFISHSVRLFANMLAGKVFASFIPLLAGLGIAGYVLPLGMVIALTALE
ATP6_AZOC5      HLFVPSGVPAFLLPFIVLIEVISFLSLSLRLFANMLAGHIALKVFALGSAGFLGWLTLPFFMIVALTALE
ATP61_HAHCH     Y-FKHYLSPSILLPFHIISEFTRTVALAIRLFGNIMSLEMAALLILLVA---------GFLAPVPILMLH
ATP61_CHLP8     GYLKTYAEPTIMLPFNIVGELTRTMALAVRLFGNMMSGDMILVILLTIS-------PLVF--PVLMNILG
ATPI_WELMI      FFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADE---------XXXXXXXXXXXXXXXXXXXXXX
ATPI_IPOPU      YFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXXXXG---------
ATPI_ARAHI      YFSKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATP6_SHEDO      GFVKELTLQPFMIPVNLLLESVTLISLALRLFGNLYAGELIFILIALMYSANWAMATLGVGLQLGWLIFH
ATP6_RHISN      GFLKLFVPPGALLPLVVSIEVISFLSLSVRLFANMLAGHITLKVFXXXXXXXXXXXXXXXXMTVALTGLE
ATP6_RHIME      GFLKLFVPPGALLPLVVAIEIISFLSLSVRLFANMLAGHITLKVFXXXXXXXXXXXXXXXXMTVALTGLE
ATP6_IDILO      GFAKEMTFTPFLIPVNFVLESITLLSLALRLFGNMYAGELIFILIAMIG----FWQ---LPAHFAWAVFH
ATP6_ALISL      LALHPFNHPI-MIPFNLLLEVISLLSLGMRLFGNMFAGEVVFILIAAM----LPWYLQWVGA-LPWAIFH
ATPI_CAPBU      YFSKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATP6_ERWT9      KTLQPFNHPIF-IPINLILEGVSLLSLGLRLFGNMYAGELIFILIAGLLPWWSQWI-----LSVPWAIFH
ATP6_COLP3      GFMKELTTQPFLYPVNILETVTMLLSLALRLFGNLYAGEL---IFLLIATIGVFQLPVHF----LWAAFH
ATP6_CAMC5      KYFGHFMGPSLMFPVEIISHLSRIVSLSFRLFGNIKGDDLFLLVMLTLAP----WF-----APLPAYALL
ATP6_CAMC1      KYFGHFMGPPIMFPVEVISHLSRVVSLSFRLFGNIKGDD-----LFLLAMXXXXXXXXXXXXXXXXXXMA
ATP6_ACIBY      LALNPFVAKALLIPVNLILELVTFLSLALRLFGNMYAGELIFILIALLP----FW--IQWALSVPWAIFH
ATP6_ACIBT      LALNPFVAKALLIPVNLILELVTFLSLALRLFGNMYAGELIFILIALLP----FW--IQWALSVPWAIFH
ATP6_ACIBS      LALNPFVAKALLIPVNLILELVTFLSLALRLFGNMYAGELIFILIALLP----FW--IQWALSVPWAIFH
ATP6_ACIBC      LALNPFVAKALLIPVNLILELVTFLSLALRLFGNMYAGELIFILIALLP----FW--IQWALSVPWAIFH
ATP6_ACIB5      LALNPFVAKALLIPVNLILELVTFLSLALRLFGNMYAGELIFILIALLP----FW--IQWALSVPWAIFH
ATP6_ACIB3      LALNPFVAKALLIPVNLILELVTFLSLALRLFGNMYAGELIFILIALLP----FW--IQWALSVPWAIFH
ATP62_HAHCH     GFLGELTLQPFMLPFNLLLEGVGLISLALRLFGNLYAGELLFILIALMP----FW--AQWALSVPWAIFH
ATP61_PELLD     GYLSTYVKPTIMLPFNIISELSRTLALAVRLFGNIMSGSMILAILLTVTP---FVFPVLM------SVLG
ATP6_SHESW      GFTKELTLQPFLIPVNILESVTLIISLALRLFGNLYAGELIFILIALMP----WW--AQFALSVPWAIFH
ATP6_SHEPC      GFTKELTLQPFLIPVNILESVTLIISLALRLFGNLYAGELIFILIALMP----WW--AQFALSVPWAIFH
ATP6_SHELP      GFVKELTLQPFMIPVNLLLESVTLISLALRLFGNLYAGELIFILIALMYGANLALSALGVTLQLGWLIFH
ATP6_PSE14      GFIKNLFVQALLIPVNFLLEFVTLISLALRLFGNMYAGELVFILIVMFXXXXXXXXXXXXXXQWAWAVFH
ATP6_CHRSD      GFLAELTLHPFLIPVNFLLEAVTLLSLALRLFGNLYAGELIFILIAMIG---LWQLPLHF----AWATFH
ATP6_BUCAI      GFLKEFNHPVFSI-FNFILEFVSLISLGLRLFGNMYAGEMIFILIAGL----LPWWTQCF-LNVPWAIFH
ATP6_AGRVS      XXXXXXXXXXXXXXIEVISFLSRPISLSIRLFANMLAGHITLKVFXXXXXXXXXXXXXXXXMTVALTGLE
ATPI_CERDE      YFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADEXXXXXXXXXXXXXXXXXXMFLG---------
ATP6_TOLAT      GFVKELTMTPFFVPINLLLETVTLISLGLRLFGNMYAGEMIFILIAAMLPWWSQWF-----LNVPWAIFH
ATP6_SHEAM      GFVKELTLQPFMIPVNLLLESVTLISLALRLFGNLYAGELIFILIALM--YGANWLIASLGVQLGWLIFH
ATP6_RHOP2      -FFKLFVPPIYILPLVVFIEVISFVSHSVRLFANMLAGHI--ALKVFASFIAMXXXXXXXXXTIALTALE
ATP6_RHILW      SGVPGILLPL-VVSIEIISFLSRPISLSVRLFANMLAGHITLKVFXXXXXXXXXXXXXXXXMTVALTGLE
ATP6_RHIE6      HFLNVFVPPGILLPLVVAIEIISFLSLSVRLFANMLAGHITLKVFXXXXXXXXXXXXXXXXMTVALTGLE
ATP6_PSEF5      GFIKNILVQALLIPVNFLLEFVTLISLALRLFGNMYAGELVFILIAVMFGSGLLWLSMGVVLQWAWAVFH
ATP6_PELUB      PSGXXXXXXXXXXXXXXXSYLSRPVSLSVRLFANMMAGHTMMKVFFVISLGIVGWLPLSF--SVALTGLE
ATP6_MICAN      GYFAHYLEPIVLLPIKILEDFTKPLSLSFRLFGNI-----------------------------------
ATP6_BRANA      XXXXXXXXXXXXXXXXXISYCFRALSLGIRLFANMMAGHSLVKILTMLCMNEIFYFIGALGIVLALTGLE
ATP6_BARHE      KLFVPSGVPVLILPLVTMIEVISFISLSLRLFANMLAGHITLKVXXXXXXXXXXXXXXXXXXTVAITALE
ATP6_SHEHH      GFTKELTMQPFLIPINFVLETVTLISLSLRLFGNLYAGELIFILIALMP-----WW-AQFALSVPWAIFH
ATP6_ROSDO      KNGTAFLSPVLAI-IEIISYFVRPVSHSIRLAGNVMAGHAVIKVFAGFAALTLV-SPVAILGITAMYGLE
ATP6_LAWIP      Y-IHHFMGPSIVLAMIILECISHLLSLTLRLFGNIKGEEIVLLLFFLMA---------------------
ATP62_ARATH     XXXXXXXXXXXXXXXXXISYCFRALSLGIRLFANMMAGHSLVKILTMLCMNDIFYFIGALGIVLALTGLE
ATP61_ARATH     XXXXXXXXXXXXXXXXXISYCFRALSLGIRLFANMMAGHSLVKILTMLCMNDIFYFIGALGIVLALTGLE
ATP6_VIBFM      LALHPFNHPI-MIPFNLLLEVISLLSLGMRLFGNMFAGEVVFILIAAM----LPWYLQWVGA-LPWAIFH
ATP6_VIBF1      LALHPFNHPI-MIPFNLLLEVISLLSLGMRLFGNMFAGEVVFILIAAM----LPWYLQWVGA-LPWAIFH
ATP6_SHESH      GFVKELTMQPFMIPVNFLLETVTLISLALRLFGNLYAGELIFILIALMYGANMALSALGVTLQLGWLIFH
ATP6_RHOP5      IFVPSGV-PGFILPLVVFIEVFSFISHSVRLFANMLAGKVFASFIPLLAGLGIAGYVLPLGMXXXXXXXX
ATP6_OLICO      -FFRVFVPPIYILPLIAMIEVISFLSRSVRLFANMLAGKVFASFVTSXXXXXXXXXXXXXXXXXMTTAIS
ATP6_EHRRW      HQGTHFLTPMWLAPMMVLIELFAYVSLSIRLAANMIAGHTIIKVIAFVINMNXXXXXXXXXXXXXXXXXX
ATP6_EHRRG      HQGTHFLTPMWLAPMMVLIELFAYVSLSIRLAANMIAGHTIIKVIAFVINMNXXXXXXXXXXXXXXXXXX
ATP6_WIGBR      VFLKEFFFQPFLIPVNLVLELISLLSLSLRLFGNIYSGEL---IFILISGLLPWW--LQWILSVPWAIFH
ATP6_PSESM      GFIKNIFVQALLIPVNFLLEFVTLISLALRLFGNMYAGELVFILIVMFXXXXXXXXXXXIVLQWAWAVFH
ATP6_ENTS8      KTLQPFNHPVF-IPINLILEGVSLLSLGLRLFGNMYAGELIFILIAGLLPWWSQWL-----LNVPWAIFH
ATP6_VIBCM      GFAKELALHPFMIPFNLLIEVVSLLSLGMRLFGNMFAGEV----VFILCAAMLPWY-LQWMGSLPWAIFH
ATP6_VIBCH      GFAKELALHPFMIPFNLLIEVVSLLSLGMRLFGNMFAGEV----VFILCAAMLPWY-LQWMGSLPWAIFH
ATP6_VIBC3      GFAKELALHPFMIPFNLLIEVVSLLSLGMRLFGNMFAGEV----VFILCAAMLPWY-LQWMGSLPWAIFH
ATP6_SHEWM      GFVKELTLQPFMIPVNLLLETVTLISLALRLFGNLYAGELIFILIALMYGANWALSTLGVTLQLGWLIFH
ATP6_PROMH      GTLQPFNHPVF-IPINLILEGVSLLSLGLRLFGNMYAGELIFILI-----AGXXXXXXXXXXXXXXAIFH
ATP6_MAGSM      PSGVPPMLLILMVPIEIVSYLSRPVSLSVRLFANMTAGHTVLAIMFFFAATLPLGMPAAFAT--VFTGFE
ATP6_VIBVY      GFARELALHPFMIPFNLLIEVVSLLSLGMRLFGNMFAGEV----VFILCAAMLPWY-LQWMGSLPWAIFH
ATP6_VIBVU      GFARELALHPFMIPFNLLIEVVSLLSLGMRLFGNMFAGEV----VFILCAAMLPWY-LQWMGSLPWAIFH
ATP6_RUTMC      AELTFHPFGKMMLPFNLFLEGVNLISLALRLFGNMYAGEMIFILIALLP----FW--VQWSLSLPWAIFH
ATP6_VIBPA      LALHPFNHPL-MIPFNLLIEVVSLLSLGMRLFGNMFAGEVV----FILCAAMLPWYLQWMGS-LPWAIFH
ATP6_VIBAL      LALHPFNHPL-MIPFNLLIEVVSLLSLGMRLFGNMFAGEVV----FILCAAMLPWYLQWMGS-LPWAIFH
ATP6_SHEPW      GFVKELTMQPFMIPVNFLLETVTLISLALRLFGNLYAGELIFILIALMYGANWALSTLGVTLQLGWLIFH
ATP61_VIBHB     LALHPFNHPL-MIPFNLLIEVVSLLSLGMRLFGNMFAGEVV----FILCAAMLPWYLQWMGS-LPWAIFH
ATP6_SYNY3      GYFANYVQPIVLLPIKILEDFTKPLSLSFRLFGNI---------XXXXXXXXXXXXXXXXXXXXXXXXXX
ATP6_SHESR      GFVKELTLQPFMIPVNLLLETVTLISLALRLFGNLYAGELIFILIALMYXXXXXXXXXXXXXXXXWLIFH
ATP6_SHESM      GFVKELTLQPFMIPVNLLLETVTLISLALRLFGNLYAGELIFILIALMYXXXXXXXXXXXXXXXXWLIFH
ATP6_SHESA      GFVKELTLQPFMIPVNLLLETVTLISLALRLFGNLYAGELIFILIALMYXXXXXXXXXXXXXXXXWLIFH
ATP6_SHEON      GFVKELTLQPFMIPVNLLLETVTLISLALRLFGNLYAGELIFILIALMYXXXXXXXXXXXXXXXXWLIFH
ATP6_SHEB9      GFVKELTLQPFMIPVNLLLETVTLISLALRLFGNLYAGELIFILIALMYXXXXXXXXXXXXXXXXWLIFH
ATP6_SHEB8      GFVKELTLQPFMIPVNLLLETVTLISLALRLFGNLYAGELIFILIALMYXXXXXXXXXXXXXXXXWLIFH
ATP6_SHEB5      GFVKELTLQPFMIPVNLLLETVTLISLALRLFGNLYAGELIFILIALMYXXXXXXXXXXXXXXXXWLIFH
ATP6_SHEB2      GFVKELTLQPFMIPVNLLLETVTLISLALRLFGNLYAGELIFILIALMYXXXXXXXXXXXXXXXXWLIFH
ATP6_ENT38      GFVKELTLQPFFIPVNLILEGVSLLSLGLRLFGNMYAGELIFILIAGLLPWWSQWI-----LNVPWAIFH
ATP62_CHLP8     GYVKHLTAGIIMIPIEIIGQFTKP