[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for spne4:ACF55442.1

[Show Plain Result]


## Summary of Sequence Search
    1::160
    1::160     6e-75 100%  160 aa  GREA_STRZT RecName: Full=Transcription elongation factor
    1::160     6e-75 100%  160 aa  GREA_STRZP RecName: Full=Transcription elongation factor
    1::160     6e-75 100%  160 aa  GREA_STRZJ RecName: Full=Transcription elongation factor
    1::160     6e-75 100%  160 aa  GREA_STRR6 RecName: Full=Transcription elongation factor
    1::160     6e-75 100%  160 aa  GREA_STRPJ RecName: Full=Transcription elongation factor
    1::160     6e-75 100%  160 aa  GREA_STRP7 RecName: Full=Transcription elongation factor
    1::160     6e-75 100%  160 aa  GREA_STRP4 RecName: Full=Transcription elongation factor
    1::160     6e-75 100%  160 aa  GREA_STRP2 RecName: Full=Transcription elongation factor
    1::160     2e-74  99%  160 aa  GREA_STRPN RecName: Full=Transcription elongation factor
    1::160     3e-74  99%  160 aa  GREA_STRPI RecName: Full=Transcription elongation factor
    1::159     5e-73  97%  160 aa  GREA_STRSV RecName: Full=Transcription elongation factor
    1::159     7e-64  87%  160 aa  GREA_STRGC RecName: Full=Transcription elongation factor
    1::159     3e-61  81%  160 aa  GREA_STRMU RecName: Full=Transcription elongation factor
    1::159     1e-59  80%  160 aa  GREA_STRPG RecName: Full=Transcription elongation factor
    1::159     1e-59  80%  160 aa  GREA_STRP8 RecName: Full=Transcription elongation factor
    1::159     1e-59  80%  160 aa  GREA_STRP6 RecName: Full=Transcription elongation factor
    1::159     1e-59  80%  160 aa  GREA_STRP3 RecName: Full=Transcription elongation factor
    1::159     1e-59  80%  160 aa  GREA_STRP1 RecName: Full=Transcription elongation factor
    1::160     2e-59  81%  160 aa  GREA_STRTD RecName: Full=Transcription elongation factor
    1::159     2e-59  84%  160 aa  GREA_STRSY RecName: Full=Transcription elongation factor
    1::159     2e-59  84%  160 aa  GREA_STRS2 RecName: Full=Transcription elongation factor
    1::160     2e-59  81%  160 aa  GREA_STRT2 RecName: Full=Transcription elongation factor
    1::160     2e-59  81%  160 aa  GREA_STRT1 RecName: Full=Transcription elongation factor
    1::159     1e-54  75%  160 aa  GREA_STRA5 RecName: Full=Transcription elongation factor
    1::159     1e-54  75%  160 aa  GREA_STRA3 RecName: Full=Transcription elongation factor
    1::159     1e-54  75%  160 aa  GREA_STRA1 RecName: Full=Transcription elongation factor
    1::159     6e-52  72%  160 aa  GREA_STRU0 RecName: Full=Transcription elongation factor
    2::156     8e-51  61%  156 aa  GREA_LACLS RecName: Full=Transcription elongation factor
    2::156     2e-50  70%  156 aa  GREA_LACLA RecName: Full=Transcription elongation factor
    2::156     4e-50  61%  156 aa  GREA_LACLM RecName: Full=Transcription elongation factor
    4::158     5e-45  55%  158 aa  GREA_LACF3 RecName: Full=Transcription elongation factor
    4::160     1e-43  56%  160 aa  GREA_LEUMM RecName: Full=Transcription elongation factor
    4::158     4e-42  54%  158 aa  GREA_BACCR RecName: Full=Transcription elongation factor
    4::158     9e-42  63%  158 aa  GREA_BACCN RecName: Full=Transcription elongation factor
    4::158     1e-41  53%  158 aa  GREA_BACCQ RecName: Full=Transcription elongation factor
    4::158     1e-41  53%  158 aa  GREA_BACC7 RecName: Full=Transcription elongation factor
    4::158     1e-41  53%  158 aa  GREA_BACC1 RecName: Full=Transcription elongation factor
    4::158     2e-41  65%  158 aa  GREA_GEOTN RecName: Full=Transcription elongation factor
    4::158     2e-41  53%  158 aa  GREA_BACHK RecName: Full=Transcription elongation factor
    4::158     2e-41  53%  158 aa  GREA_BACCZ RecName: Full=Transcription elongation factor
    4::158     2e-41  53%  158 aa  GREA_BACAN RecName: Full=Transcription elongation factor
    4::158     2e-41  53%  158 aa  GREA_BACAC RecName: Full=Transcription elongation factor
    4::158     2e-41  53%  158 aa  GREA_BACAA RecName: Full=Transcription elongation factor
    4::158     5e-41  63%  158 aa  GREA_GEOKA RecName: Full=Transcription elongation factor
    4::157     6e-41  53%  160 aa  GREA_LISW6 RecName: Full=Transcription elongation factor
    4::157     8e-41  53%  160 aa  GREA_LISMO RecName: Full=Transcription elongation factor
    4::157     8e-41  53%  160 aa  GREA_LISMH RecName: Full=Transcription elongation factor
    4::157     8e-41  53%  160 aa  GREA_LISMF RecName: Full=Transcription elongation factor
    4::157     8e-41  53%  160 aa  GREA_LISMC RecName: Full=Transcription elongation factor
    4::157     8e-41  53%  160 aa  GREA_LISIN RecName: Full=Transcription elongation factor
    4::156     4e-40  52%  157 aa  GREA_BACSU RecName: Full=Transcription elongation factor
    4::160     5e-40  53%  160 aa  GREA_LEUCK RecName: Full=Transcription elongation factor
    4::158     9e-40  58%  160 aa  GREA2_LACPL RecName: Full=Transcription elongation factor greA
    4::157     1e-39  54%  158 aa  GREA_MACCJ RecName: Full=Transcription elongation factor
    4::156     1e-39  60%  157 aa  GREA_BACA2 RecName: Full=Transcription elongation factor
    4::156     3e-39  61%  157 aa  GREA_BACP2 RecName: Full=Transcription elongation factor
    4::158     2e-37  50%  158 aa  GREA_OCEIH RecName: Full=Transcription elongation factor
    4::157     2e-37  48%  158 aa  GREA_BACSK RecName: Full=Transcription elongation factor
    4::158     5e-37  59%  158 aa  GREA_STAS1 RecName: Full=Transcription elongation factor
    4::158     5e-37  60%  158 aa  GREA_STAHJ RecName: Full=Transcription elongation factor
    4::158     1e-36  60%  160 aa  GREA_STACT RecName: Full=Transcription elongation factor
    4::158     3e-36  60%  158 aa  GREA_STAES RecName: Full=Transcription elongation factor
    4::158     3e-36  60%  158 aa  GREA_STAEQ RecName: Full=Transcription elongation factor
    4::160     4e-36  45%  162 aa  GREA_OENOB RecName: Full=Transcription elongation factor
   39::157     6e-36  57%  158 aa  GREA_BACLD RecName: Full=Transcription elongation factor
   25::157     1e-35  50%  157 aa  GREA_THEPX RecName: Full=Transcription elongation factor
   25::157     1e-35  50%  157 aa  GREA_THEP3 RecName: Full=Transcription elongation factor
    4::158     1e-35  58%  158 aa  GREA_STAAW RecName: Full=Transcription elongation factor
    4::158     1e-35  58%  158 aa  GREA_STAAT RecName: Full=Transcription elongation factor
    4::158     1e-35  58%  158 aa  GREA_STAAS RecName: Full=Transcription elongation factor
    4::158     1e-35  58%  158 aa  GREA_STAAR RecName: Full=Transcription elongation factor
    4::158     1e-35  58%  158 aa  GREA_STAAN RecName: Full=Transcription elongation factor
    4::158     1e-35  58%  158 aa  GREA_STAAM RecName: Full=Transcription elongation factor
    4::158     1e-35  58%  158 aa  GREA_STAAE RecName: Full=Transcription elongation factor
    4::158     1e-35  58%  158 aa  GREA_STAAC RecName: Full=Transcription elongation factor
    4::158     1e-35  58%  158 aa  GREA_STAAB RecName: Full=Transcription elongation factor
    4::158     1e-35  58%  158 aa  GREA_STAA9 RecName: Full=Transcription elongation factor
    4::158     1e-35  58%  158 aa  GREA_STAA8 RecName: Full=Transcription elongation factor
    4::158     1e-35  58%  158 aa  GREA_STAA3 RecName: Full=Transcription elongation factor
    4::158     1e-35  58%  158 aa  GREA_STAA2 RecName: Full=Transcription elongation factor
    4::158     1e-35  58%  158 aa  GREA_STAA1 RecName: Full=Transcription elongation factor
   32::157     1e-35  56%  158 aa  GREA_BACHD RecName: Full=Transcription elongation factor
   25::157     3e-35  50%  157 aa  GREA_THETN RecName: Full=Transcription elongation factor
    1::158     2e-34  43%  159 aa  GREA_FINM2 RecName: Full=Transcription elongation factor
    5::159     2e-34  54%  160 aa  GREA_CLOBH RecName: Full=Transcription elongation factor
    5::159     2e-34  54%  160 aa  GREA_CLOB1 RecName: Full=Transcription elongation factor
    5::159     3e-34  54%  160 aa  GREA_CLOBM RecName: Full=Transcription elongation factor
    5::159     3e-34  54%  160 aa  GREA_CLOBL RecName: Full=Transcription elongation factor
    5::159     3e-34  54%  160 aa  GREA_CLOBK RecName: Full=Transcription elongation factor
    5::159     3e-34  54%  160 aa  GREA_CLOBJ RecName: Full=Transcription elongation factor
    5::159     3e-34  54%  160 aa  GREA_CLOB6 RecName: Full=Transcription elongation factor
    1::158     2e-33  43%  158 aa  GREA_CLOPS RecName: Full=Transcription elongation factor
    1::158     2e-33  43%  158 aa  GREA_CLOPE RecName: Full=Transcription elongation factor
    1::158     2e-33  43%  158 aa  GREA_CLOP1 RecName: Full=Transcription elongation factor
    5::157     1e-32  52%  159 aa  GREA_CLONN RecName: Full=Transcription elongation factor
    5::160     5e-32  43%  160 aa  GREA_CLOB8 RecName: Full=Transcription elongation factor
   27::159     1e-31  48%  159 aa  GREA_CLOTH RecName: Full=Transcription elongation factor
   27::159     2e-30  47%  159 aa  GREA_ALKOO RecName: Full=Transcription elongation factor
    4::155     2e-29  40%  158 aa  GREA_XYLFT RecName: Full=Transcription elongation factor
    4::155     2e-29  40%  158 aa  GREA_XYLFM RecName: Full=Transcription elongation factor
    4::155     2e-29  40%  158 aa  GREA_XYLF2 RecName: Full=Transcription elongation factor
   28::157     9e-29  45%  157 aa  GREA_ROSCS RecName: Full=Transcription elongation factor
   25::156     9e-29  43%  158 aa  GREA_PELPD RecName: Full=Transcription elongation factor
   26::155     9e-29  43%  157 aa  GREA_BARQU RecName: Full=Transcription elongation factor
    1::156     1e-28  43%  158 aa  GREA_RHOPT RecName: Full=Transcription elongation factor
    1::156     1e-28  43%  158 aa  GREA_RHOPA RecName: Full=Transcription elongation factor
    5::155     2e-28  42%  157 aa  GREA_PHEZH RecName: Full=Transcription elongation factor
    1::156     2e-28  42%  158 aa  GREA_NITWN RecName: Full=Transcription elongation factor
    4::155     3e-28  40%  158 aa  GREA_XYLFA RecName: Full=Transcription elongation factor
    1::156     3e-28  42%  158 aa  GREA_NITHX RecName: Full=Transcription elongation factor
    5::159     3e-28  42%  159 aa  GREA_CLOK5 RecName: Full=Transcription elongation factor
    5::159     3e-28  42%  159 aa  GREA_CLOK1 RecName: Full=Transcription elongation factor
   38::158     3e-28  46%  158 aa  GREA_CLOAB RecName: Full=Transcription elongation factor
   27::159     3e-28  42%  159 aa  GREA_SYNWW RecName: Full=Transcription elongation factor
    5::156     5e-28  47%  158 aa  GREA_RUTMC RecName: Full=Transcription elongation factor
    1::156     6e-28  41%  158 aa  GREA_BRASB RecName: Full=Transcription elongation factor
    4::154     8e-28  39%  158 aa  GREA_XANAC RecName: Full=Transcription elongation factor
   28::157     8e-28  44%  157 aa  GREA_ROSS1 RecName: Full=Transcription elongation factor
   26::155     8e-28  45%  157 aa  GREA_BRAJA RecName: Full=Transcription elongation factor
    5::156     8e-28  40%  158 aa  GREA_BAUCH RecName: Full=Transcription elongation factor
    6::155     1e-27  36%  158 aa  GREA_THEYD RecName: Full=Transcription elongation factor
   26::156     1e-27  45%  157 aa  GREA_CHLAD RecName: Full=Transcription elongation factor
    5::155     1e-27  41%  157 aa  GREA_RHORT RecName: Full=Transcription elongation factor
    3::156     1e-27  42%  158 aa  GREA_PELCD RecName: Full=Transcription elongation factor
    5::132     1e-27  45%  160 aa  GREA_CLOBA RecName: Full=Transcription elongation factor
   26::155     1e-27  42%  157 aa  GREA_BART1 RecName: Full=Transcription elongation factor
    5::132     2e-27  45%  160 aa  GREA_CLOBB RecName: Full=Transcription elongation factor
   25::156     2e-27  45%  162 aa  GREA_RICFE RecName: Full=Transcription elongation factor
    4::156     2e-27  40%  160 aa  GREA_LEGPL RecName: Full=Transcription elongation factor
    4::156     2e-27  40%  160 aa  GREA_LEGPH RecName: Full=Transcription elongation factor
    4::156     2e-27  40%  160 aa  GREA_LEGPC RecName: Full=Transcription elongation factor
    4::156     2e-27  40%  160 aa  GREA_LEGPA RecName: Full=Transcription elongation factor
   27::147     2e-27  45%  158 aa  GREA_GEOLS RecName: Full=Transcription elongation factor
   26::155     2e-27  42%  157 aa  GREA_BARBK RecName: Full=Transcription elongation factor
    1::156     3e-27  41%  158 aa  GREA_RHOPB RecName: Full=Transcription elongation factor
   26::156     3e-27  43%  157 aa  GREA_CHLSY RecName: Full=Transcription elongation factor
   26::156     3e-27  43%  157 aa  GREA_CHLAA RecName: Full=Transcription elongation factor
   24::154     4e-27  42%  164 aa  GREA_HELPY RecName: Full=Transcription elongation factor
   24::154     4e-27  42%  164 aa  GREA_HELPJ RecName: Full=Transcription elongation factor
   34::159     4e-27  44%  159 aa  GREA_CLOD6 RecName: Full=Transcription elongation factor
   24::154     5e-27  43%  164 aa  GREA_HELAH RecName: Full=Transcription elongation factor
   26::155     5e-27  42%  157 aa  GREA_BARHE RecName: Full=Transcription elongation factor
    4::154     6e-27  39%  158 aa  GREA_XANCP RecName: Full=Transcription elongation factor
    5::155     6e-27  40%  160 aa  GREA_RHOP5 RecName: Full=Transcription elongation factor
   28::156     8e-27  40%  159 aa  GREA_RHOBA RecName: Full=Transcription elongation factor
   24::154     8e-27  42%  164 aa  GREA_HELPS RecName: Full=Transcription elongation factor
   25::156     1e-26  45%  162 aa  GREA_RICCN RecName: Full=Transcription elongation factor
    4::155     1e-26  40%  158 aa  GREA_PSYCK RecName: Full=Transcription elongation factor
    4::155     1e-26  40%  158 aa  GREA_PSYA2 RecName: Full=Transcription elongation factor
   24::154     1e-26  41%  164 aa  GREA_HELPH RecName: Full=Transcription elongation factor
   24::154     1e-26  41%  164 aa  GREA_HELPG RecName: Full=Transcription elongation factor
   24::154     1e-26  41%  164 aa  GREA_HELP2 RecName: Full=Transcription elongation factor
   24::156     1e-26  43%  159 aa  GREA_VESOH RecName: Full=Transcription elongation factor
   24::158     1e-26  40%  161 aa  GREA_CAMLR RecName: Full=Transcription elongation factor
    6::157     1e-26  40%  159 aa  GREA_BUCBP RecName: Full=Transcription elongation factor
   26::155     2e-26  42%  157 aa  GREA_RHILO RecName: Full=Transcription elongation factor
   24::155     2e-26  46%  158 aa  GREA_NEIMB RecName: Full=Transcription elongation factor
    5::154     2e-26  39%  166 aa  GREA_ANASK RecName: Full=Transcription elongation factor
   30::159     3e-26  44%  162 aa  GREA_RICCK RecName: Full=Transcription elongation factor
   24::155     4e-26  44%  158 aa  GREA_ALHEH RecName: Full=Transcription elongation factor
   24::155     6e-26  46%  158 aa  GREA_NEIMA RecName: Full=Transcription elongation factor
    3::154     6e-26  38%  163 aa  GREA_HELHP RecName: Full=Transcription elongation factor
    5::155     6e-26  35%  162 aa  GREA_CAMHC RecName: Full=Transcription elongation factor
    5::154     7e-26  36%  157 aa  GREA_MARMM RecName: Full=Transcription elongation factor
    5::155     9e-26  38%  158 aa  GREA_METCA RecName: Full=Transcription elongation factor
   28::156     1e-25  45%  158 aa  GREA_SPHAL RecName: Full=Transcription elongation factor
    5::153     1e-25  40%  156 aa  GREA_RHOSK RecName: Full=Transcription elongation factor
    5::153     1e-25  40%  156 aa  GREA_RHOS4 RecName: Full=Transcription elongation factor
    5::153     1e-25  40%  156 aa  GREA_RHOS1 RecName: Full=Transcription elongation factor
   27::156     1e-25  45%  159 aa  GREA_CHLP8 RecName: Full=Transcription elongation factor
   25::159     2e-25  47%  162 aa  GREA_RICBR RecName: Full=Transcription elongation factor
   24::158     2e-25  47%  161 aa  GREA_RICB8 RecName: Full=Transcription elongation factor
   30::156     2e-25  45%  162 aa  GREA_RICPR RecName: Full=Transcription elongation factor
    2::156     2e-25  38%  158 aa  GREA_PASMU RecName: Full=Transcription elongation factor
    5::132     2e-25  42%  157 aa  GREA_HYPNA RecName: Full=Transcription elongation factor
   26::155     3e-25  43%  157 aa  GREA_VIBPA RecName: Full=Transcription elongation factor
   24::154     3e-25  42%  158 aa  GREA_METS4 RecName: Full=Transcription elongation factor
    5::155     3e-25  39%  158 aa  GREA_HAEIN RecName: Full=Transcription elongation factor
   24::154     4e-25  41%  158 aa  GREA_METNO RecName: Full=Transcription elongation factor
   26::156     5e-25  42%  158 aa  GREA_THISH RecName: Full=Transcription elongation factor
   28::153     5e-25  46%  156 aa  GREA_THENN RecName: Full=Transcription elongation factor
   30::156     5e-25  44%  162 aa  GREA_RICTY RecName: Full=Transcription elongation factor
    5::153     5e-25  39%  156 aa  GREA_RHOS5 RecName: Full=Transcription elongation factor
   28::156     6e-25  41%  158 aa  GREA_SPHWW RecName: Full=Transcription elongation factor
   27::156     8e-25  43%  159 aa  GREA_CHLTE RecName: Full=Transcription elongation factor
    2::156     1e-24  37%  158 aa  GREA_YERPG RecName: Full=Transcription elongation factor
    2::156     1e-24  37%  158 aa  GREA_YERPE RecName: Full=Transcription elongation factor
   26::156     1e-24  42%  158 aa  GREA_RALSO RecName: Full=Transcription elongation factor
    4::155     1e-24  38%  158 aa  GREA_PSYWF RecName: Full=Transcription elongation factor
    4::155     1e-24  38%  158 aa  GREA_PSEAE RecName: Full=Transcription elongation factor
    5::153     1e-24  38%  156 aa  GREA_PARDP RecName: Full=Transcription elongation factor
   28::158     1e-24  42%  159 aa  GREA_MYCA5 RecName: Full=Transcription elongation factor
    2::156     1e-24  37%  158 aa  GREA_HAEDU RecName: Full=Transcription elongation factor
   24::146     2e-24  46%  158 aa  GREA_NITOC RecName: Full=Transcription elongation factor
    5::156     2e-24  37%  158 aa  GREA_HAMD5 RecName: Full=Transcription elongation factor
    5::153     2e-24  36%  156 aa  GREA_JANSC RecName: Full=Transcription elongation factor
   26::155     2e-24  41%  158 aa  GREA_HALHL RecName: Full=Transcription elongation factor
    5::154     2e-24  38%  157 aa  GREA_AZOC5 RecName: Full=Transcription elongation factor
   25::153     3e-24  36%  162 aa  GREA_DESDA RecName: Full=Transcription elongation factor
   26::156     3e-24  42%  159 aa  GREA_CHLPD RecName: Full=Transcription elongation factor
   27::156     3e-24  42%  160 aa  GREA_CHLCH RecName: Full=Transcription elongation factor
   29::157     4e-24  43%  160 aa  GREA_MYCHJ RecName: Full=Transcription elongation factor
   29::157     4e-24  43%  160 aa  GREA_MYCH7 RecName: Full=Transcription elongation factor
   29::157     4e-24  43%  160 aa  GREA_MYCH2 RecName: Full=Transcription elongation factor
    1::159     4e-24  38%  160 aa  GREA_CLOPH RecName: Full=Transcription elongation factor
    2::156     4e-24  37%  158 aa  GREA_BLOPB RecName: Full=Transcription elongation factor
    4::159     5e-24  37%  159 aa  GREA_PSYIN RecName: Full=Transcription elongation factor
    1::158     5e-24  35%  160 aa  GREA_PSEPK RecName: Full=Transcription elongation factor
   25::156     5e-24  41%  159 aa  GREA_PROVI RecName: Full=Transcription elongation factor
    4::146     5e-24  39%  158 aa  GREA_ACIBS RecName: Full=Transcription elongation factor
    3::155     7e-24  38%  158 aa  GREA_VEREI RecName: Full=Transcription elongation factor
   27::157     7e-24  41%  160 aa  GREA_CHLPB RecName: Full=Transcription elongation factor
    5::155     7e-24  37%  157 aa  GREA_CAUCR RecName: Full=Transcription elongation factor
    5::155     7e-24  37%  157 aa  GREA_CAUCN RecName: Full=Transcription elongation factor
    4::155     9e-24  38%  158 aa  GREA_PSESM RecName: Full=Transcription elongation factor
   27::156     1e-23  41%  159 aa  GREA_PELPB RecName: Full=Transcription elongation factor
   28::156     1e-23  42%  158 aa  GREA_NOVAD RecName: Full=Transcription elongation factor
   39::152     1e-23  46%  157 aa  GREA_OCHA4 RecName: Full=Transcription elongation factor
   25::157     1e-23  42%  157 aa  GREA_MYCCT RecName: Full=Transcription elongation factor
   25::153     1e-23  35%  163 aa  GREA_DESVV RecName: Full=Transcription elongation factor
   25::153     1e-23  35%  163 aa  GREA_DESVH RecName: Full=Transcription elongation factor
   27::156     1e-23  43%  159 aa  GREA_CHLL2 RecName: Full=Transcription elongation factor
    5::154     3e-23  35%  156 aa  GREA_SILPO RecName: Full=Transcription elongation factor
   26::153     3e-23  41%  162 aa  GREA_NAUPA RecName: Full=Transcription elongation factor
   25::155     3e-23  38%  156 aa  GREA_MESFL RecName: Full=Transcription elongation factor
   26::155     3e-23  42%  157 aa  GREA_VIBVU RecName: Full=Transcription elongation factor
   28::156     4e-23  41%  158 aa  GREA_ZYMMO RecName: Full=Transcription elongation factor
   27::154     4e-23  36%  161 aa  GREA_SYNAS RecName: Full=Transcription elongation factor
   25::155     4e-23  39%  158 aa  GREA_GRAFK RecName: Full=Transcription elongation factor
   25::153     4e-23  36%  160 aa  GREA_DESVM RecName: Full=Transcription elongation factor
   25::154     4e-23  37%  161 aa  GREA_CAMJJ RecName: Full=Transcription elongation factor
   25::154     4e-23  37%  161 aa  GREA_CAMJD RecName: Full=Transcription elongation factor
    6::157     4e-23  36%  159 aa  GREA_BUCAP RecName: Full=Transcription elongation factor
   28::155     6e-23  42%  157 aa  GREA_VIBCH RecName: Full=Transcription elongation factor
   39::155     6e-23  42%  157 aa  GREA_BRUSU RecName: Full=Transcription elongation factor
   39::155     6e-23  42%  157 aa  GREA_BRUSI RecName: Full=Transcription elongation factor
   39::155     6e-23  42%  157 aa  GREA_BRUME RecName: Full=Transcription elongation factor
   39::155     6e-23  42%  157 aa  GREA_BRUMB RecName: Full=Transcription elongation factor
   39::155     6e-23  42%  157 aa  GREA_BRUC2 RecName: Full=Transcription elongation factor
   39::155     6e-23  42%  157 aa  GREA_BRUAB RecName: Full=Transcription elongation factor
   39::155     6e-23  42%  157 aa  GREA_BRUA2 RecName: Full=Transcription elongation factor
   39::155     6e-23  42%  157 aa  GREA_BRUA1 RecName: Full=Transcription elongation factor
    3::155     7e-23  38%  158 aa  GREA_POLNA RecName: Full=Transcription elongation factor
   24::155     7e-23  40%  159 aa  GREA_ORITB RecName: Full=Transcription elongation factor
   25::154     7e-23  36%  161 aa  GREA_CAMJR RecName: Full=Transcription elongation factor
   25::154     7e-23  36%  161 aa  GREA_CAMJE RecName: Full=Transcription elongation factor
   25::154     7e-23  36%  161 aa  GREA_CAMJ8 RecName: Full=Transcription elongation factor
   30::155     1e-22  40%  158 aa  GREA_AGRRK RecName: Full=Transcription elongation factor
    5::146     1e-22  37%  158 aa  GREA_WIGBR RecName: Full=Transcription elongation factor
   26::154     1e-22  36%  163 aa  GREA_NITSB RecName: Full=Transcription elongation factor
    5::155     1e-22  35%  157 aa  GREA_CAUSK RecName: Full=Transcription elongation factor
   40::155     2e-22  43%  158 aa  GREA_RHILW RecName: Full=Transcription elongation factor
   36::154     2e-22  44%  157 aa  GREA_BEII9 RecName: Full=Transcription elongation factor
   40::156     2e-22  42%  158 aa  GREA_AGRT5 RecName: Full=Transcription elongation factor
   40::155     3e-22  43%  158 aa  GREA_RHILV RecName: Full=Transcription elongation factor
   40::155     3e-22  43%  158 aa  GREA_RHIL3 RecName: Full=Transcription elongation factor
   24::155     3e-22  40%  159 aa  GREA_ORITI RecName: Full=Transcription elongation factor
   25::153     3e-22  36%  160 aa  GREA_DESAD RecName: Full=Transcription elongation factor
    4::156     4e-22  34%  158 aa  GREA_THICR RecName: Full=Transcription elongation factor
   40::155     4e-22  41%  158 aa  GREA_AGRVS RecName: Full=Transcription elongation factor
   39::156     5e-22  41%  158 aa  GREA_SALTY RecName: Full=Transcription elongation factor
   39::156     5e-22  41%  158 aa  GREA_SALTI RecName: Full=Transcription elongation factor
   40::155     5e-22  42%  158 aa  GREA_RHIEC RecName: Full=Transcription elongation factor
   40::155     5e-22  42%  158 aa  GREA_RHIE6 RecName: Full=Transcription elongation factor
   39::156     6e-22  40%  158 aa  GREA_SHIFL RecName: Full=Transcription elongation factor
   39::156     6e-22  40%  158 aa  GREA_ECOLI RecName: Full=Transcription elongation factor
   39::156     6e-22  40%  158 aa  GREA_ECOL6 RecName: Full=Transcription elongation factor
   39::156     6e-22  40%  158 aa  GREA_ECO57 RecName: Full=Transcription elongation factor
   40::156     8e-22  42%  158 aa  GREA_SINMW RecName: Full=Transcription elongation factor
   40::156     8e-22  42%  158 aa  GREA_RHIME RecName: Full=Transcription elongation factor
   24::154     1e-21  37%  156 aa  GREA_UREPA RecName: Full=Transcription elongation factor
   24::154     1e-21  37%  156 aa  GREA_UREP2 RecName: Full=Transcription elongation factor
    1::149     1e-21  45%  159 aa  GREA_PETMO RecName: Full=Transcription elongation factor
   40::155     1e-21  37%  157 aa  GREA_MAGSM RecName: Full=Transcription elongation factor
   25::157     2e-21  40%  157 aa  GREA_MYCMS RecName: Full=Transcription elongation factor
   26::154     3e-21  34%  162 aa  GREA_WOLSU RecName: Full=Transcription elongation factor
   24::154     4e-21  36%  156 aa  GREA_UREU1 RecName: Full=Transcription elongation factor
   26::154     4e-21  38%  156 aa  GREA_SYNFM RecName: Full=Transcription elongation factor
   26::156     4e-21  40%  158 aa  GREA_PELUB RecName: Full=Transcription elongation factor
   34::156     4e-21  34%  161 aa  GREA_DESPS RecName: Full=Transcription elongation factor
    5::154     4e-21  34%  161 aa  GREA_ARCB4 RecName: Full=Transcription elongation factor
   37::155     7e-21  39%  159 aa  GREA_NEOSM RecName: Full=Transcription elongation factor
   41::158     7e-21  40%  160 aa  GREA_FRATW RecName: Full=Transcription elongation factor
   41::158     7e-21  40%  160 aa  GREA_FRATT RecName: Full=Transcription elongation factor
   41::158     7e-21  40%  160 aa  GREA_FRATO RecName: Full=Transcription elongation factor
   41::158     7e-21  40%  160 aa  GREA_FRATN RecName: Full=Transcription elongation factor
   41::158     7e-21  40%  160 aa  GREA_FRATM RecName: Full=Transcription elongation factor
   41::158     7e-21  40%  160 aa  GREA_FRATH RecName: Full=Transcription elongation factor
   41::158     7e-21  40%  160 aa  GREA_FRATF RecName: Full=Transcription elongation factor
   41::158     7e-21  40%  160 aa  GREA_FRAT1 RecName: Full=Transcription elongation factor
   28::153     9e-21  40%  156 aa  GREA_THESQ RecName: Full=Transcription elongation factor
   28::153     9e-21  41%  156 aa  GREA_THEP1 RecName: Full=Transcription elongation factor
   28::153     9e-21  41%  156 aa  GREA_THEMA RecName: Full=Transcription elongation factor
   24::158     9e-21  37%  162 aa  GREA_SULNB RecName: Full=Transcription elongation factor
    1::158     9e-21  33%  160 aa  GREA_FRAP2 RecName: Full=Transcription elongation factor
    6::156     3e-20  41%  159 aa  GREA_BUCAT RecName: Full=Transcription elongation factor
    6::156     3e-20  41%  159 aa  GREA_BUCAI RecName: Full=Transcription elongation factor
    6::156     3e-20  41%  159 aa  GREA_BUCA5 RecName: Full=Transcription elongation factor
   27::155     3e-20  36%  157 aa  GREA_AMOA5 RecName: Full=Transcription elongation factor
    1::156     5e-20  35%  156 aa  GREA_THERP RecName: Full=Transcription elongation factor
   26::158     6e-20  38%  161 aa  GREA_MYCGE RecName: Full=Transcription elongation factor
    6::147     8e-20  36%  159 aa  GREA_BUCCC RecName: Full=Transcription elongation factor
   25::157     1e-19  36%  158 aa  GREA_FLAJ1 RecName: Full=Transcription elongation factor
   27::154     1e-19  39%  157 aa  GREA_MYCPU RecName: Full=Transcription elongation factor
   39::155     2e-19  39%  157 aa  GREA_MESSB RecName: Full=Transcription elongation factor
    3::144     3e-19  36%  158 aa  GREA_ACHLI RecName: Full=Transcription elongation factor
   27::157     5e-19  34%  159 aa  GREA_MYCGA RecName: Full=Transcription elongation factor
   26::153     5e-19  32%  164 aa  GREA_DESMR RecName: Full=Transcription elongation factor
   26::157     9e-19  34%  160 aa  GREA_MYCPN RecName: Full=Transcription elongation factor
   26::155     1e-18  35%  156 aa  GREA1_LACPL RecName: Full=Transcription elongation factor greA
   38::154     2e-18  38%  157 aa  GREA_ACICJ RecName: Full=Transcription elongation factor
   30::155     7e-18  38%  156 aa  GREA_THEM4 RecName: Full=Transcription elongation factor
   25::157     2e-17  33%  158 aa  GREA_FLAPJ RecName: Full=Transcription elongation factor
   24::146     6e-17  31%  156 aa  GREA_DEHE1 RecName: Full=Transcription elongation factor
   27::156     6e-17  34%  158 aa  GREA_CHLT3 RecName: Full=Transcription elongation factor
   30::155     8e-17  37%  156 aa  GREA_THEAB RecName: Full=Transcription elongation factor
   25::157     1e-16  35%  160 aa  GREA_PROA2 RecName: Full=Transcription elongation factor
   29::159     5e-16  33%  163 aa  GREA_MYCAP RecName: Full=Transcription elongation factor
   27::139     1e-14  33%  162 aa  GREA_TREPS RecName: Full=Transcription elongation factor
   27::139     1e-14  33%  162 aa  GREA_TREPA RecName: Full=Transcription elongation factor
   28::158     2e-14  37%  162 aa  GREA_SACEN RecName: Full=Transcription elongation factor
  765::896     3e-14  30%  901 aa  GREA_BORBU RecName: Full=Transcription elongation factor
   31::161     6e-14  37%  165 aa  GREA_STRCO RecName: Full=Transcription elongation factor
   27::154     8e-14  30%  171 aa  GREB_YERPE RecName: Full=Transcription elongation factor
   33::163     5e-13  30%  168 aa  GREB_PSEAE RecName: Full=Transcription elongation factor
  595::704     5e-13  38%  722 aa  GREA_CHLPN RecName: Full=Transcription elongation factor
  589::701     1e-12  34%  715 aa  GREA_CHLTR RecName: Full=Transcription elongation factor
   29::158     2e-12  33%  163 aa  GREB_NEIMA RecName: Full=Transcription elongation factor
  591::700     2e-12  33%  714 aa  GREA_CHLMU RecName: Full=Transcription elongation factor
   27::145     3e-12  33%  158 aa  GREB_PASMU RecName: Full=Transcription elongation factor
   45::161     5e-12  37%  165 aa  GREA_STRAW RecName: Full=Transcription elongation factor
   27::154     8e-12  30%  158 aa  GREB_HAEIN RecName: Full=Transcription elongation factor
   29::158     1e-11  32%  163 aa  GREB_NEIMB RecName: Full=Transcription elongation factor
   26::154     2e-11  31%  157 aa  GREB_SALTY RecName: Full=Transcription elongation factor
   26::154     2e-11  31%  157 aa  GREB_SALTI RecName: Full=Transcription elongation factor
   28::150     3e-11  38%  164 aa  GREA_RHOE4 RecName: Full=Transcription elongation factor
   28::150     7e-11  34%  164 aa  GREA_MYCTU RecName: Full=Transcription elongation factor
   28::150     7e-11  34%  164 aa  GREA_MYCTA RecName: Full=Transcription elongation factor
   28::150     7e-11  34%  164 aa  GREA_MYCBT RecName: Full=Transcription elongation factor
   28::150     7e-11  34%  164 aa  GREA_MYCBP RecName: Full=Transcription elongation factor
   28::150     7e-11  34%  164 aa  GREA_MYCBO RecName: Full=Transcription elongation factor
   24::144     2e-10  30%  162 aa  GREB_PSEPK RecName: Full=Transcription elongation factor
   26::144     2e-10  32%  158 aa  GREB_ECOLI RecName: Full=Transcription elongation factor
   49::167     2e-10  28%  168 aa  GREB_XANCP RecName: Full=Transcription elongation factor
   26::144     2e-10  32%  158 aa  GREB_ECOL6 RecName: Full=Transcription elongation factor
   26::144     2e-10  32%  158 aa  GREB_ECO57 RecName: Full=Transcription elongation factor
   28::150     2e-10  33%  164 aa  GREA_MYCA9 RecName: Full=Transcription elongation factor
   27::154     3e-10  29%  162 aa  GREB_HAEDU RecName: Full=Transcription elongation factor
   28::150     7e-10  31%  164 aa  GREA_MYCS2 RecName: Full=Transcription elongation factor
   28::150     7e-10  32%  164 aa  GREA_MYCLE RecName: Full=Transcription elongation factor
   28::150     7e-10  32%  164 aa  GREA_MYCLB RecName: Full=Transcription elongation factor
   26::144     9e-10  28%  157 aa  GREB_PSESM RecName: Full=Transcription elongation factor
   28::150     2e-08  29%  164 aa  GREA_MYCVP RecName: Full=Transcription elongation factor
   26::155     3e-08  33%  160 aa  GREB_VIBVY RecName: Full=Transcription elongation factor
   26::155     3e-08  33%  160 aa  GREB_VIBVU RecName: Full=Transcription elongation factor
   56::164     7e-08  25%  168 aa  GREB_XANAC RecName: Full=Transcription elongation factor
   25::155     1e-07  29%  161 aa  GREB_VIBCH RecName: Full=Transcription elongation factor
   25::155     2e-07  24%  163 aa  GREB_VIBPA RecName: Full=Transcription elongation factor
   44::158     4e-06  29%  161 aa  Y3817_MYCBO RecName: Full=Uncharacterized protein Mb3817;
   44::158     4e-06  29%  161 aa  Y3788_MYCTU RecName: Full=Uncharacterized protein Rv3788/MT3896;
  188::306     2e-05  32%  370 aa  CATB_ACIAD RecName: Full=Muconate cycloisomerase 1;       
   33::125     3e-04  24%  136 aa  RNK_SHIFL RecName: Full=Regulator of nucleoside diphosphate kinase;
   33::125     3e-04  24%  136 aa  RNK_ECOLI RecName: Full=Regulator of nucleoside diphosphate kinase;
   33::125     3e-04  24%  136 aa  RNK_ECOL6 RecName: Full=Regulator of nucleoside diphosphate kinase;
   33::125     3e-04  24%  136 aa  RNK_ECO57 RecName: Full=Regulator of nucleoside diphosphate kinase;
    1::160

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MAEKTYPMTXXXXXXXXXXXXXXXXVRRPEVVERIKIARSYGDLSENSEYEAAKDEQAFVEGQISSLETK
GREA_STRZT      MAEKTYPMTXXXXXXXXXXXXXXXXVRRPEVVERIKIARSYGDLSENSEYEAAKDEQAFVEGQISSLETK
GREA_STRZP      MAEKTYPMTXXXXXXXXXXXXXXXXVRRPEVVERIKIARSYGDLSENSEYEAAKDEQAFVEGQISSLETK
GREA_STRZJ      MAEKTYPMTXXXXXXXXXXXXXXXXVRRPEVVERIKIARSYGDLSENSEYEAAKDEQAFVEGQISSLETK
GREA_STRR6      MAEKTYPMTXXXXXXXXXXXXXXXXVRRPEVVERIKIARSYGDLSENSEYEAAKDEQAFVEGQISSLETK
GREA_STRPJ      MAEKTYPMTXXXXXXXXXXXXXXXXVRRPEVVERIKIARSYGDLSENSEYEAAKDEQAFVEGQISSLETK
GREA_STRP7      MAEKTYPMTXXXXXXXXXXXXXXXXVRRPEVVERIKIARSYGDLSENSEYEAAKDEQAFVEGQISSLETK
GREA_STRP4      MAEKTYPMTXXXXXXXXXXXXXXXXVRRPEVVERIKIARSYGDLSENSEYEAAKDEQAFVEGQISSLETK
GREA_STRP2      MAEKTYPMTXXXXXXXXXXXXXXXXVRRPEVVERIKIARSYGDLSENSEYEAAKDEQAFVEGQISSLETK
GREA_STRPN      MAEKTYPMTXXXXXXXXXXXXXXXXVRRPEVVERIKIARSYGDLSENSEYEAAKDEQAFVEGQISSLETK
GREA_STRPI      MAEKTYPMTXXXXXXXXXXXXXXXXVRRPEVVERIKIARSYGDLSENSEYEAAKDEQAFVEGQISSLETK
GREA_STRSV      MAEKTYPMTXXXXXXXXXXXXXXXXVRRPEVVERIKIARSYGDLSENSEYEAAKDEQAFVEGQISSLETK
GREA_STRGC      MAEKTYPMTLAXXXXXXXXXXXXXXXXXXXXXXXIKIARSYGDLSENSEYEAAKDEQAFVEGQISSLETK
GREA_STRMU      MSEKTYPMTLAXXXXXXXXXXXXXXVRRPEVIERIKIARSYGDLSENSEYEAAKDEQAFVEGQISSIETK
GREA_STRPG      MAEKTYPMXXXXXXXXXXXXXXXXXVRRPEIVERIKIARSYGDLSENSEYDAAKDEQAFVEGQISTLETK
GREA_STRP8      MAEKTYPMXXXXXXXXXXXXXXXXXVRRPEIVERIKIARSYGDLSENSEYDAAKDEQAFVEGQISTLETK
GREA_STRP6      MAEKTYPMXXXXXXXXXXXXXXXXXVRRPEIVERIKIARSYGDLSENSEYDAAKDEQAFVEGQISTLETK
GREA_STRP3      MAEKTYPMXXXXXXXXXXXXXXXXXVRRPEIVERIKIARSYGDLSENSEYDAAKDEQAFVEGQISTLETK
GREA_STRP1      MAEKTYPMXXXXXXXXXXXXXXXXXVRRPEIVERIKIARSYGDLSENSEYDAAKDEQAFVEGQISTLETK
GREA_STRTD      MAEKTYVMTXXXXXXXXXXXXXXXXVRRPEVVERIKIARSYGDLSENSEYEAAKDEQAFVEGQIQILETK
GREA_STRSY      MAEKTYPMTXXXXXXXXXXXXXXXXVRRPEIVERIKIARSYGDLSENSEYEAAKDEQAFVEGQISTIETK
GREA_STRS2      MAEKTYPMTXXXXXXXXXXXXXXXXVRRPEIVERIKIARSYGDLSENSEYEAAKDEQAFVEGQISTIETK
GREA_STRT2      MAEKTYVMTXXXXXXXXXXXXXXXXVRRPEVVERIKIARSYGDLSENSEYEAAKDEQAFIEGQIQILETK
GREA_STRT1      MAEKTYVMTXXXXXXXXXXXXXXXXVRRPEVVERIKIARSYGDLSENSEYEAAKDEQAFIEGQIQILETK
GREA_STRA5      MAEKTYPMTQXXXXXXXXXXXXXXXXXXXXXXXXIKIARSYGDLSENSEYDAAKDEQAFVEGQIQILETK
GREA_STRA3      MAEKTYPMTQXXXXXXXXXXXXXXXXXXXXXXXXIKIARSYGDLSENSEYDAAKDEQAFVEGQIQILETK
GREA_STRA1      MAEKTYPMTQXXXXXXXXXXXXXXXXXXXXXXXXIKIARSYGDLSENSEYDAAKDEQAFVEGQIQILETK
GREA_STRU0      MAEKTYPMTKAXXXXXXXXXXXXXXXXXXXXXXXIKIARSYGDLSENSEYDAAKDEQAFVEGQISTLETQ
GREA_LACLS      --EKTFPMTKEGLDKLKAELENLKLVKRPEVIDRIKVARSYGDLSENSEYEAAKDEQAFIEGRISTVETM
GREA_LACLA      --EKTFPMTQXXXXXXXXXXXXXXXVKRPEVIDRIKVARSYGDLSENSEYEAAKDEQAFIEGRISTVETM
GREA_LACLM      --EKTFPMTKEGLDKLKAELENLKLVKRPEVIDRIKVARSYGDLSENSEYEAAKDEQAFIEGRISTVETM
GREA_LACF3      --EKSFPMTADGKAKLEQELEDLRLVRRPEVINRIKIARSYGDLSENSEYESAKDEQAFVEGRISQIETM
GREA_LEUMM      --EKTYPMTAEGRDKLQLELEDLIANQRPEITKRIQIARSYGDLSENSEYQSAKDEQAFVEGRIQTLKNM
GREA_BACCR      --EKTYPMTQEGKQKLENELEQLKTVRRKEVVERIKIARSFGDLSENSEYDAAKDEQAFVEGRITQLENM
GREA_BACCN      --EKTYPMTQXXXXXXXXXXXXXXTVRRKEVVERIKIARSFGDLSENSEYDAAKDEQAFVEGRITQLENM
GREA_BACCQ      --EKTYPMTQEGKQKLENELEDLKTVKRKEVVERIKIARSFGDLSENSEYDAAKDEQAFVEGRITQLENM
GREA_BACC7      --EKTYPMTQEGKQKLENELEDLKTVKRKEVVERIKIARSFGDLSENSEYDAAKDEQAFVEGRITQLENM
GREA_BACC1      --EKTYPMTQEGKQKLENELEDLKTVKRKEVVERIKIARSFGDLSENSEYDAAKDEQAFVEGRITQLENM
GREA_GEOTN      --EKQYPMTXXXXXXXXXXXXXXXTVKRKEVVERIKIARGFGDLSENSEYDAAKDEQAFVESRIQMLETM
GREA_BACHK      --EKTYPMTQEGKQKLENELEDLKTVKRKEVVERIKIARSFGDLSENSEYDAAKDEQAFVEGRITQLENM
GREA_BACCZ      --EKTYPMTQEGKQKLENELEDLKTVKRKEVVERIKIARSFGDLSENSEYDAAKDEQAFVEGRITQLENM
GREA_BACAN      --EKTYPMTQEGKQKLENELEDLKTVKRKEVVERIKIARSFGDLSENSEYDAAKDEQAFVEGRITQLENM
GREA_BACAC      --EKTYPMTQEGKQKLENELEDLKTVKRKEVVERIKIARSFGDLSENSEYDAAKDEQAFVEGRITQLENM
GREA_BACAA      --EKTYPMTQEGKQKLENELEDLKTVKRKEVVERIKIARSFGDLSENSEYDAAKDEQAFVEGRITQLENM
GREA_GEOKA      --EKQYPMTXXXXXXXXXXXXXXXTVKRKEVVERIKIARGFGDLSENSEYDAAKDEQAFVESRIQMLENM
GREA_LISW6      --EKVFPMTLEGKAKLENELQELKTVKRKEVVERIKIARSFGDLSENSEYDSAKDEQAFVEGRITTIENM
GREA_LISMO      --EKVFPMTLDGKAKLENELQELKTVKRKEVVERIKIARSFGDLSENSEYDSAKDEQAFVEGRITTIENM
GREA_LISMH      --EKVFPMTLDGKAKLENELQELKTVKRKEVVERIKIARSFGDLSENSEYDSAKDEQAFVEGRITTIENM
GREA_LISMF      --EKVFPMTLDGKAKLENELQELKTVKRKEVVERIKIARSFGDLSENSEYDSAKDEQAFVEGRITTIENM
GREA_LISMC      --EKVFPMTLDGKAKLENELQELKTVKRKEVVERIKIARSFGDLSENSEYDSAKDEQAFVEGRITTIENM
GREA_LISIN      --EKVFPMTLDGKAKLENELQELKTVKRKEVVERIKIARSFGDLSENSEYDSAKDEQAFVEGRITTIENM
GREA_BACSU      --EKVFPMTAEGKQKLEQELEYLKTVKRKEVVERIKIARSFGDLSENSEYDSAKEEQAFVEGRVTTLENM
GREA_LEUCK      --EKVFPMTAEGRDKLQAELEDLITRQRPEITNRIQIARSYGDLSENSEYQSAKDEQAFVEGRILTLKKM
GREA2_LACPL     --DKTYPMTXXXXXXXXXXXXXXRINQRPEIINRIKIARSYGDLSENSEYESAKNEQSLLENRIKTVEHM
GREA_MACCJ      --QKEYPMTQEGFDKLEVELEHLKTVRRPEVVEKIKVARSFGDLSENSEYDAAKDEQGFVEQEITKIEMM
GREA_BACA2      --EKVFPMTHEGXXXXXXXXXXXXTVKRKEVVERIKIARSFGDLSENSEYDSAKEEQAFVEGRITTLENM
GREA_BACP2      --EKVFPMTXXXXXXXXXXXXXXXTVKRKEVVERIKIARSFGDLSENSEYDSAKEEQAFVEGRITTLDNM
GREA_OCEIH      --EKSYYMTQEGKDKLEEELHYLKTDRRQEVVERIKVARDFGDLSENSEYDAAKDEQAFVEQRITQVEKM
GREA_BACSK      --EKKHYMTAEGKKKLEEELHYLITTRRKEVVERIKVARSFGDLSENSEYDSAKEDQAFVEGRIAQLEKM
GREA_STAS1      --QKQYPMTQEGFXXXXXXXXXXXTVKRPEVVEKIKIARSFGDLSENSEYDAAKDEQGFIEQDIQRVENM
GREA_STAHJ      --QKQYPMTQEGYXXXXXXXXXXXTVKRPEVVEKIKVARSFGDLSENSEYDAAKDEQGFIEQDIQRIEHM
GREA_STACT      --QKQYPMTQEGFXXXXXXXXXXXTVKRPEVVEKIKVARSFGDLSENSEYDAAKDEQGFIEQDIQRIEHM
GREA_STAES      --QKQYPMTQEGYXXXXXXXXXXXTVKRPEVVEKIKVARSFGDLSENSEYDAAKDEQGFIEQDIQRIEHM
GREA_STAEQ      --QKQYPMTQEGYXXXXXXXXXXXTVKRPEVVEKIKVARSFGDLSENSEYDAAKDEQGFIEQDIQRIEHM
GREA_OENOB      --EKTYPMTAEGLAKLQAELDDLITNKRPAITSRIQEARSFGDLSENSEYQSAKDEQAFVEGRVKQLQQM
GREA_BACLD      -------------------------------------ARSFGDLSENSEYDSAKEEQAFVEGRITTLDNM
GREA_THEPX      -------------------------VKRAEVAEKIKQARAFGDLSENSEYDEAKNEQAFIEGRIATLEAM
GREA_THEP3      -------------------------VKRAEVAEKIKQARAFGDLSENSEYDEAKNEQAFIEGRIATLEAM
GREA_STAAW      --QKQYPMTQEGFXXXXXXXXXXXTVKRPEVVEKIKVARSFGDLSENSEYDAAKDEQGFIEQDIQRIEHM
GREA_STAAT      --QKQYPMTQEGFXXXXXXXXXXXTVKRPEVVEKIKVARSFGDLSENSEYDAAKDEQGFIEQDIQRIEHM
GREA_STAAS      --QKQYPMTQEGFXXXXXXXXXXXTVKRPEVVEKIKVARSFGDLSENSEYDAAKDEQGFIEQDIQRIEHM
GREA_STAAR      --QKQYPMTQEGFXXXXXXXXXXXTVKRPEVVEKIKVARSFGDLSENSEYDAAKDEQGFIEQDIQRIEHM
GREA_STAAN      --QKQYPMTQEGFXXXXXXXXXXXTVKRPEVVEKIKVARSFGDLSENSEYDAAKDEQGFIEQDIQRIEHM
GREA_STAAM      --QKQYPMTQEGFXXXXXXXXXXXTVKRPEVVEKIKVARSFGDLSENSEYDAAKDEQGFIEQDIQRIEHM
GREA_STAAE      --QKQYPMTQEGFXXXXXXXXXXXTVKRPEVVEKIKVARSFGDLSENSEYDAAKDEQGFIEQDIQRIEHM
GREA_STAAC      --QKQYPMTQEGFXXXXXXXXXXXTVKRPEVVEKIKVARSFGDLSENSEYDAAKDEQGFIEQDIQRIEHM
GREA_STAAB      --QKQYPMTQEGFXXXXXXXXXXXTVKRPEVVEKIKVARSFGDLSENSEYDAAKDEQGFIEQDIQRIEHM
GREA_STAA9      --QKQYPMTQEGFXXXXXXXXXXXTVKRPEVVEKIKVARSFGDLSENSEYDAAKDEQGFIEQDIQRIEHM
GREA_STAA8      --QKQYPMTQEGFXXXXXXXXXXXTVKRPEVVEKIKVARSFGDLSENSEYDAAKDEQGFIEQDIQRIEHM
GREA_STAA3      --QKQYPMTQEGFXXXXXXXXXXXTVKRPEVVEKIKVARSFGDLSENSEYDAAKDEQGFIEQDIQRIEHM
GREA_STAA2      --QKQYPMTQEGFXXXXXXXXXXXTVKRPEVVEKIKVARSFGDLSENSEYDAAKDEQGFIEQDIQRIEHM
GREA_STAA1      --QKQYPMTQEGFXXXXXXXXXXXTVKRPEVVEKIKVARSFGDLSENSEYDAAKDEQGFIEQDIQRIEHM
GREA_BACHD      ------------------------------VVERIKIARSFGDLSENSEYDSAKEEQAFVEGRISQIEKM
GREA_THETN      -------------------------VKRAEVAEKIKQARAFGDLSENSEYDEAKNEQAFIEGRIATLEAM
GREA_FINM2      MADKEFLLTQEGLDQHKEELEFLKTTRRTEIAEKIKVARGFGDLSENAEYDEAKNEQAQVEERINYLENL
GREA_CLOBH      ---KKYVMTYEGVXXXXXXXXXXXTVKRKEITEKIKVALSFGDLSENSEYDEAKNEQAFVEGRIIQLENM
GREA_CLOB1      ---KKYVMTYEGVXXXXXXXXXXXTVKRKEITEKIKVALSFGDLSENSEYDEAKNEQAFVEGRIIQLENM
GREA_CLOBM      ---KKYVMTYEGVXXXXXXXXXXXTVKRKEITEKIKVALSFGDLSENSEYDEAKNEQAFVEGRIIQLENM
GREA_CLOBL      ---KKYVMTYEGVXXXXXXXXXXXTVKRKEITEKIKVALSFGDLSENSEYDEAKNEQAFVEGRIIQLENM
GREA_CLOBK      ---KKYVMTYEGVXXXXXXXXXXXTVKRKEITEKIKVALSFGDLSENSEYDEAKNEQAFVEGRIIQLENM
GREA_CLOBJ      ---KKYVMTYEGVXXXXXXXXXXXTVKRKEITEKIKVALSFGDLSENSEYDEAKNEQAFVEGRIIQLENM
GREA_CLOB6      ---KKYVMTYEGVXXXXXXXXXXXTVKRKEITEKIKVALSFGDLSENSEYDEAKNEQAFVEGRIIQLENM
GREA_CLOPS      MSEKKHIMTYEGVKKLEDELEYLKTVKRKEITEKIKVALGYGDLSENSEYDEAKNEQAFTEGRIIQLENM
GREA_CLOPE      MSEKKHIMTYEGVKKLEDELEYLKTVKRKEITEKIKVALGYGDLSENSEYDEAKNEQAFTEGRIIQLENM
GREA_CLOP1      MSEKKHIMTYEGVKKLEDELEYLKTVKRKEITEKIKVALGYGDLSENSEYDEAKNEQAFTEGRIIQLENM
GREA_CLONN      ---KQYIMTAEGVXXXXXXXXXXXTVKRREITEKIKVALSYGDLSENSEYDEAKNEQAFVEGRIVQLENM
GREA_CLOB8      ---KQYVMTYEGVKKLESELEYLKTVKRKEITEKIKIALGYGDLSENSEYDEAKNDQAFTEGRIIQLENM
GREA_CLOTH      -------------------------VKRREVAERIKQALSFGDISENSEYDEAKNEQAYIEGRIFQLENM
GREA_ALKOO      -------------------------VRRKEIAERIKQAIAFGDISENSEYDEAKNEQAQVEDRINKLETM
GREA_XYLFT      ------PMTLKGVRRLRDELEHLKSVKRPEIINAIAEARAHGDLKENAEYHAAREQQSFIEGRIKQLEGE
GREA_XYLFM      ------PMTLKGVRRLRDELEHLKLVKRPEIINAIAEARAHGDLKENAEYHAAREQQSFIEGRIKQLEGE
GREA_XYLF2      ------PMTLKGVRRLRDELEHLKSVKRPEIINAIAEARAHGDLKENAEYHAAREQQSFIEGRIKQLEGE
GREA_ROSCS      ---------------------------RKEIAERINAAKELGDISESGEYEDAKNQQAHLEGRIREIKSI
GREA_PELPD      -------------------------VERPKVIQDIAEARSHGDLSENAEYDAAKNRQGFIEGRIQELNSK
GREA_BARQU      ---------------------------RPRIIEAISEARAHGDLSENAEYHAAKEAQSYNEGRINELEDY
GREA_RHOPT      MVEKI-PMTASGYAALSDELKHRQSVDRPRIIEHIAEARSHGDLSENAEYHAAKEEQSHNEGRINELEDK
GREA_RHOPA      MVEKI-PMTASGYAALSDELKHRQSVDRPRIIEHIAEARSHGDLSENAEYHAAKEEQSHNEGRINELEDK
GREA_PHEZH      ------PMTAEGYKALDEELKRLKTVERPAVIAAIAEARSHGDLSENAEYHAAKERQGWIEGQIAEIEDK
GREA_NITWN      MVEKV-PMTRGGHAALADELKKRQSVDRPRIIEQIAEARAHGDLSENAEYHAAKEEQSHNEGRIAELEDK
GREA_XYLFA      ------PMTLKGVRRLRDELEHLKSVKRPEIINAIAEARAHGDLKENAEYHAAREQQSFIEGRIKQLEGE
GREA_NITHX      MIEKV-PMTRGGHAALADELKKRQSVDRPRIIEHIAEARSHGDLSENAEYHAAKEDQSHNEGRIAELEDK
GREA_CLOK5      ---KKYVMTYEGIKKLENELEYLKTVKRKEITEKIKVALSFGDLSENSEYDSAKNEQAFVEGRIVQLENM
GREA_CLOK1      ---KKYVMTYEGIKKLENELEYLKTVKRKEITEKIKVALSFGDLSENSEYDSAKNEQAFVEGRIVQLENM
GREA_CLOAB      ------------------------------------VALSFGDLSENSEYDEAKNDQAFVEGRIAQIENM
GREA_SYNWW      -------------------------VKREEVAERIKQAIAFGDITENSEYEDAKNEQAFIEGRIISLEKT
GREA_RUTMC      ------PMTVFGXXXXXXXXXXXXNVSRPRIIENIVTARAHGDLKENAEYHAAKEEQGFIEGRIKEVESK
GREA_BRASB      MVEKV-PMTSGGYAALENELKQRQSVDRPRIIEHIAEARSHGDLSENAEYHAAKEEQSHNEGRIAELEDK
GREA_XANAC      ------PMTSKGAQRLREELEHLKSVKRPEVINAIAEARAHGDLKENAEYHAAREQQSFIEGRIKQLESE
GREA_ROSS1      ---------------------------RKEIAERINAAKELGDISESGEYEDAKNQQAHLEGRIREIKSI
GREA_BRAJA      ---------------------------RPRIIEHIAEARSHGDLSENAEYHAAKEEQSHNEGRIAELEDK
GREA_BAUCH      ------PMTLRGAEQLREELNYLKNVRRPEIIRNIAEAREYGDLKENAEYHAAREQQGFCEGRIQEIESK
GREA_THEYD      ------PMTPEGYEKLKEELDRLIKIERPAIIKAIAEARAHGDLSENAEYHAAREKQSFIEGRIQELQAK
GREA_CHLAD      -------------------------VERKQIAERIAAAKELGDISESGEYEDAKKAQALLEGRIRELKHL
GREA_RHORT      ------PMTPDGLARLEAELKSLKSVDRPAVIRAISEARDHGDLSENAEYHAARERQSFIEGRIKELEDV
GREA_PELCD      ---QSVPMTEEGYRSLQDELKHLIRVERPKVVQDIAEARSHGDLSENAEYDAAKNRQGFIEGRIKELNDK
GREA_CLOBA      ---KQYVMTYEGVKKLEGELEYLKTVKRKEITEKIKVALGYGDLSENSEYDEAKNDQAFTEGKILQLENK
GREA_BART1      ---------------------------RPRIIEAISEARAHGDLSENAEYHAAKEAQSHNEGRINELEDY
GREA_CLOBB      ---KQYVMTYEGVKKLEGELEYLKTVKRKEITEKIKVALGYGDLSENSEYDEAKNDQAFTEGKILQLENK
GREA_RICFE      -------------------------VERKKISEDIAEAREHGDLSENAEYEAAREKQAFIEGRIKELEDM
GREA_LEGPL      -----HPMTVEGAEALKAELHRLKFVDRPRIVEAIATARAHGDLKENAEYHAAREQQSFNEGRIQELEAK
GREA_LEGPH      -----HPMTVEGAEALKAELHRLKFVDRPRIVEAIATARAHGDLKENAEYHAAREQQSFNEGRIQELEAK
GREA_LEGPC      -----HPMTVEGAEALKEELHRLKFVDRPRIVEAIATARAHGDLKENAEYHAAREQQSFNEGRIQELEAK
GREA_LEGPA      -----HPMTVEGAEALKAELHRLKFVDRPRIVEAIATARAHGDLKENAEYHAAREQQSFNEGRIQELEAK
GREA_GEOLS      ---------------------------RPKVIQDIAEARSHGDLSENAEYDAAKNRQGFIEGRIQELQGK
GREA_BARBK      ---------------------------RPRIIEAISEARAHGDLSENAEYHAAKEAQSYNEGRINELEDY
GREA_RHOPB      MIEKV-PMTAGGYAALEVELKQRQSVDRPRIIEHIAEARSHGDLSENAEYHAAKEEQSHNEGRIAELEDK
GREA_CHLSY      -------------------------VERKQIAERIAAAKELGDISESGEYEDAKKAQALLEGRIRELKHL
GREA_CHLAA      -------------------------VERKQIAERIAAAKELGDISESGEYEDAKKAQALLEGRIRELKHL
GREA_HELPY      -------------------------VERPNIVKEIDIARGHGDLKENAEYHAAKEKQRFIEARIVDLSEI
GREA_HELPJ      -------------------------VERPNIVKEIDIARGHGDLKENAEYHAAKEKQRFIEARIVDLSEI
GREA_CLOD6      --------------------------------ERIKVAISFGDLSENAEYDEAKKEQAQVEERILKLENM
GREA_HELAH      -------------------------VERPNIVKEIDIARGHGDLKENAEYHAAKEKQRFIEARIVDLSEI
GREA_BARHE      ---------------------------RPRIIEAISEARAHGDLSGNAEYHAAKEAQSHNEGRINELEDY
GREA_XANCP      ------PMTSKGAQRLREELDHLKSVKRPAVITAIAEARAHGDLKENAEYHAAREQQSFIEGRIKQLEGE
GREA_RHOP5      ------PMTANGYAALQVELKQRQTVDRPRIIEHIAEARSHGDLSENAEYHAAKEEQSHNEGRIADLEDK
GREA_RHOBA      ----------------------------PMIVQKIAEAREEGDLKENAEYHAQRENQGMLMAKINELRDK
GREA_HELPS      -------------------------VERPNIVKEIDIARGHGDLKENAEYHAAKEKQRFIEARIVDLSEI
GREA_RICCN      -------------------------VERKKISADIAEAREHGDLSENAEYEAAREKQAFIEGRIKELEDM
GREA_PSYCK      -----YPMTPQGHAALEAELKQLKSIDRPRITASIAEAREHGDLKENAEYHAAREQQGFCEARIRDIEAK
GREA_PSYA2      -----YPMTPQGHAALEAELKQLKSIDRPRITASIAEAREHGDLKENAEYHAAREQQGFCEARIRDIEAK
GREA_HELPH      -------------------------VERPNIVKEIDIARGHGDLKENAEYHAAKEKQRFIEARIVDLSEI
GREA_HELPG      -------------------------VERPNIVKEIDIARGHGDLKENAEYHAAKEKQRFIEARIVDLSEI
GREA_HELP2      -------------------------VERPNIVKEIDIARGHGDLKENAEYHAAKEKQRFIEARIVDLSEI
GREA_VESOH      -------------------------VSRPRIIEDIRIARAHGDLKENAEYHAAKEEQSFVEGRIKEIELK
GREA_CAMLR      -------------------------VERPKVVEEIDIARSHGDLKENAEYHAAREKQAFIEGKIAELGDL
GREA_BUCBP      ------PMTILGVEKLRKELEMLKTIKRPKIIKSIIEARQHGDLKENSEYHAAREEQGFCEGRIKEIELK
GREA_RHILO      ---------------------------RPRIIEAISEARSHGDLSENAEYHAAKEAQSLNEGRVNELEDL
GREA_NEIMB      -------------------------VARPEVIEAIAEARSHGDLSENAEYEAAKERQGFIEGRISELEHK
GREA_ANASK      ------PMTKGGLVRLKDELRRLKSVERPKIVKEIAEARAHGDLSENAEYHAAKEKQSHIEGRIAQVEHW
GREA_RICCK      ------------------------------ISEDIAEAREHGDLSENAEYEAAREKQAFIEGRIKELEDM
GREA_ALHEH      -------------------------VERPRIIQAIAEAREHGDLKENAEYHAAREQQSFVEGRIQEIEGK
GREA_NEIMA      -------------------------VARPEVIEAIAEARSHGDLSENAEYEAAKERQGFIEGRISELEHK
GREA_HELHP      ----TEPMTNYGYEKLCAELKNLKEVERPRIVVEIDIARSHGDLKENAEYHAAREKQAFIEARINELGLM
GREA_CAMHC      ------PMTLYGYEKITAELKDLKMVQRPNIVRDIDIARSHGDLKENSEYHAAREKQAFIENRIAEISDI
GREA_MARMM      ------PMTVAGQIALDEELKRLKTIERPAVIAAISEAREHGDLSENAEYHAAKERQGWIEGRVQELEDK
GREA_METCA      ------PMTTRGAEKLREELNHLKTVARPRVIEAIAEARAHGDLKENAEYQAAREQQGFIEGRIKEIEAK
GREA_SPHAL      ---------------------------RPLIVDAIEEARAHGDLSENAEYHAAKERQGQVEATIGDLEDK
GREA_RHOSK      ------PMTRAGFTALDDELKTLKTVERPAVIRSIAEAREHGDLSENAEYHAAREKQSFIEGRIKELEAI
GREA_RHOS4      ------PMTRAGFTALDDELKTLKTVERPAVIRSIAEAREHGDLSENAEYHAAREKQSFIEGRIKELEAI
GREA_RHOS1      ------PMTRAGFTALDDELKTLKTVERPAVIRSIAEAREHGDLSENAEYHAAREKQSFIEGRIKELEAI
GREA_CHLP8      ---------------------------RKEVLEKIAEARSHGDLSENAEYDAAREEQSQLEAKIGDLENK
GREA_RICBR      -------------------------VERKKVSEDIAEARAHGDLSENAEYEAAREKQAFVEARIKHLEDI
GREA_RICB8      -------------------------VERKKVSEDIAEARAHGDLSENAEYEAAREKQAFVEARIKHLEDI
GREA_RICPR      ------------------------------ISEDIAEAREHGDLSENAEYEAAREKQAFIEGRIKELEDM
GREA_PASMU      ---KQIPMTIRGAEQLKQELDFLKNTRRPEIINAIAEAREHGDLKENAEYHAAREQQGFCEGRIQEIEGK
GREA_HYPNA      ------PMTAEGHAALQAELKVLKSVERPSIIAAISEARSHGDLSENAEYHAAKEKQSFIEGRISELDDK
GREA_VIBPA      ----------------------------PQISEAIAEARELGDLKENAEYHAAREEQGICEAQIRDIEYK
GREA_METS4      -------------------------VERPRIIQAIAEARALGDLSENAEYHAAKEAQSLNEGRVLELESL
GREA_HAEIN      ------PMTVRGAEQLREELDFLKNVRRPEIIKAIAEAREHGDLKENAEYHAAREQQGFCEGRIQEIEGK
GREA_METNO      -------------------------VERPRIIQAIAEARALGDLSENAEYHAAKEAQSLNEGRVLELESL
GREA_THISH      ---------------------------RPRVIAAIAEAREHGDLKENAEYHAAREQQGFIEGRIKEIEAK
GREA_THENN      -----------------------------EISERIKEARELGDLSENSEYEAAKNEQGRVGSRIMEIEQI
GREA_RICTY      ------------------------------ISEDIAEAREHGDLSENAEYEAAREKQAFIEGRIKELEDM
GREA_RHOS5      ------PMTRAGFAALDDELKLLKTVERPAVIRAIAEAREHGDLSENAEYHAAREKQSFIEGRIKELEAL
GREA_SPHWW      ---------------------------RPLIIDAIEEARAHGDLSENAEYHAAKERQGQIEASIADIEDR
GREA_CHLTE      ---------------------------RKEVLEKIAEARSHGDLSENAEYDAAREEQSQLEAKIGEIENK
GREA_YERPG      ---KQIPMTVRGADKLREELDYLKGVRRPKIISDIADAREHGDLKENAEYHAAREQQGFCEGRIQEIEAK
GREA_YERPE      ---KQIPMTVRGADKLREELDYLKGVRRPKIISDIADAREHGDLKENAEYHAAREQQGFCEGRIQEIEAK
GREA_RALSO      ---------------------------RPAVVNAIAEARAQGDLSENADYDAAKERQGFIEGRILEIESK
GREA_PSYWF      -----YPMTPQGHAALEAELKQLKSVDRPRITAAIAEAREHGDLKENAEYHAAREQQGFCEARIRDIEAK
GREA_PSEAE      -----FPMTVQGARALEEEVKHLKGVLRPQISQAIAEARELGDLKENAEYHAAREQQGMVEARIRDIEAK
GREA_PARDP      ------PMTRAGYDQLDEELRELRSVQRPAVIRAIAEAREHGDLSENAEYHAAREKQSFVEGRIKELEMI
GREA_MYCA5      -------------------------VLRPQVIEEIKEARNQGDLSENAEYDAARDKQATIENEITEIQHI
GREA_HAEDU      ---KQIPMTVRGAELLREELEFLKNVRRPQIIDAIAEAREHGDLKENAEYHAAREQQGFCEGRIQEIEGK
GREA_NITOC      -------------------------VVRPKVVTAIAEARAHGDLKENAEYHAAREEQGFVEGRIRDLEHQ
GREA_HAMD5      ------PMTLRGAEKLREELQHLKSVLRPQIIAAIAEAREHGDLKENAEYHAAREQQGFCEGRIQEIESK
GREA_JANSC      ------PMTPKGLEAMNGELKQLKSVERPAIIKAIAEAREHGDLSENAEYHSAKEKQSFIEGRIKELEGS
GREA_HALHL      ---------------------------RPRVIQAIAEAREHGDLKENAEYHAAREQQSFIEGRIQEIEGK
GREA_AZOC5      ------PMTGAGFVALEEELRFRQQVERPRIISAISEARAHGDLSENAEYHAAKELQSLNEGRIAELEDK
GREA_DESDA      ---------------------------RPEIIQAIKEAREEGDLRENAGYDAARERQGMAEARIKYIESR
GREA_CHLPD      --------------------------KRKEVLEKIAEARAHGDLSENAEYDAAREEQSLTEAHIADLENK
GREA_CHLCH      ---------------------------RKEVLEKIAEARAHGDLSENAEYDAAREEQSQIEARIGDLESK
GREA_MYCHJ      -------------------------VERVNVIQEIKDARSQGDLSENAEYDVAREKQGIIESRIRELETI
GREA_MYCH7      -------------------------VERVNVIQEIKDARSQGDLSENAEYDVAREKQGIIESRIRELETI
GREA_MYCH2      -------------------------VERVNVIQEIKDARSQGDLSENAEYDVAREKQGIIESRIRELETI
GREA_CLOPH      MAEKKNILTYEGLKQLEDELQDLKVNKRKEVSQKIKEAREQGDLSENAEYDAAKDEQRDIEARIEEIDKI
GREA_BLOPB      ---KRIPMTLRGAEKLREELDYLRNVLRPEIIKNISEAREHGDLKENAEYHAAREQQGFCEGRIQEIESK
GREA_PSYIN      -----YPMTANGAAKLRSELKQLKTVTRPRIVKAIAEAREHGDLKENAEYHAAREQQGFCEGRIQDIEAK
GREA_PSEPK      MSITKYPMTVQGARALEEEHLFLSKTERPRLSQAIGEARELGDLKENAEYHAAREEQGMVEARIRDIEGR
GREA_PROVI      -------------------------VTRAEVLEKIAEARSHGDLSENAEYDAAREQQSQTEARIADLESK
GREA_ACIBS      -----YPMTPEGKIALEKELQHLKTVERPRITQAIAEAREHGDLKENAEYHAAREQQGFCEGRIQDIEGK
GREA_VEREI      ----TIPITKRGAEKLKQELHHLKTVERPSVITAIAEARAQGDLSENADYDAAKDRQGFVEGRIQEIEGK
GREA_CHLPB      ---------------------------RKEVLEKIAEARAHGDLSENAEYDAAREQQRQLENKIGDLESK
GREA_CAUCR      ------PMTVAGYQTLDEELKRLKTVERPAVIAAIAEARSHGDLSENAEYHAAKERQGWIEGQIAEIEDK
GREA_CAUCN      ------PMTVAGYQTLDEELKRLKTVERPAVIAAIAEARSHGDLSENAEYHAAKERQGWIEGQIAEIEDK
GREA_PSESM      -----YPMTVQGARALEEELTHLTKVIRPKLSQDIGTARELGDLKENAEYHAAREQQGMVEARIRDIEGR
GREA_PELPB      ---------------------------RREVLEKIAEARAHGDLSENAEYDAAREEQSHTEARIADLENK
GREA_NOVAD      ---------------------------RPRIVDAIEEARAHGDLSENAEYHAAKERQGQVEATIADLEDR
GREA_OCHA4      ----------------------------------------HGDLSENAEYHAAKEAQSLNEGRINELEDL
GREA_MYCCT      -------------------------VTRPKVIEELVEARNQGDLSENADYDAARNRQAEVEARIKEVETL
GREA_DESVV      ---------------------------RPGVIQAIKEAREEGDLSENAGYDAARERQGMLEARIKYIESR
GREA_DESVH      ---------------------------RPGVIQAIKEAREEGDLSENAGYDAARERQGMLEARIKYIESR
GREA_CHLL2      ---------------------------RKEVLEKIAEARSHGDLSENAEYDAAREQQSQTEARIADLENK
GREA_SILPO      ------PMTPSGFAALEAELKQLKSVERPAIIKAIAEAREHGDLSENAEYHSAREKQSFIEGRIKELEGV
GREA_NAUPA      ---------------------------RPEVAKEIDSARELGDLKENAEYHAAKEKQSHIERRIAELSDI
GREA_MESFL      -------------------------VVRPQVIEELVEARNQGDLSENADYDAARNRQAEVEARIKELETM
GREA_VIBVU      ----------------------------PLITEAIAEARELGDLKENAEYHAAREEQGICEAQIRDIEYK
GREA_ZYMMO      ---------------------------RPKIIDAIEEARAHGDLSENAEYHAAKERQGQVEAMIGDIEGK
GREA_SYNAS      ----------------------------PANIKDIEIARAHGDLSENAEYTAAKEKQSFLHGKLQELENN
GREA_GRAFK      -------------------------VERPKASEAIGEARDKGDLSENAEYDAAKEAQGLLEMKISKMEEV
GREA_DESVM      ---------------------------RPAIIQAIKEAREEGDLKENAGYDAARERQGMLEARISYIESR
GREA_CAMJJ      --------------------------QRPAVVIEIDTARSHGDLKENAEYHAAREKQALIESRIAELSDL
GREA_CAMJD      --------------------------QRPAVVIEIDTARSHGDLKENAEYHAAREKQALIESRIVELSDL
GREA_BUCAP      ------PMTVRGAEKLREELEQLKNVKRPRITVQIAEARKHGDLKENAEYHSAREEQSFCEGRIQEIESK
GREA_VIBCH      ------------------------------ITEAIAEARELGDLKENAEYHAAREEQGICEAQIRDIEYK
GREA_BRUSU      ----------------------------------------HGDLSENAEYHAAKEAQSLNEGRINELEDL
GREA_BRUSI      ----------------------------------------HGDLSENAEYHAAKEAQSLNEGRINELEDL
GREA_BRUME      ----------------------------------------HGDLSENAEYHAAKEAQSLNEGRINELEDL
GREA_BRUMB      ----------------------------------------HGDLSENAEYHAAKEAQSLNEGRINELEDL
GREA_BRUC2      ----------------------------------------HGDLSENAEYHAAKEAQSLNEGRINELEDL
GREA_BRUAB      ----------------------------------------HGDLSENAEYHAAKEAQSLNEGRINELEDL
GREA_BRUA2      ----------------------------------------HGDLSENAEYHAAKEAQSLNEGRINELEDL
GREA_BRUA1      ----------------------------------------HGDLSENAEYHAAKEAQSLNEGRINELEDL
GREA_POLNA      ----TLPITKRGAEKLKAELHNLKTVQRPWVINAISEARAQGDLSENAEYEVAKDRQGFIEGRIQEIEGK
GREA_ORITB      -------------------------VERLKITTDISTAREFGDLSENAEYKAAKERQLLNDKKIYDLENK
GREA_CAMJR      --------------------------QRPAVVIEIDTARSHGDLKENAEYHAAREKQALIESRIAELSDL
GREA_CAMJE      --------------------------QRPAVVIEIDTARSHGDLKENAEYHAAREKQALIESRIAELSDL
GREA_CAMJ8      --------------------------QRPAVVIEIDTARSHGDLKENAEYHAAREKQALIESRIAELSDL
GREA_AGRRK      ------------------------------IIEAISEARAHGDLSENAEYHAAKEAQSHNEGRIGELEDL
GREA_WIGBR      ------PMTLKGAEKLREELKYLKQTKRSEIIKSISEARQYGDLKENAEYQAAKEQQYFCESRIKEIESK
GREA_NITSB      ---------------------------RPKVVEEIERAKEHGDLRENAEYHAAKERLAFIDARLTELSDL
GREA_CAUSK      ------PMTAGGYQTLDEELKRLKTIERPAVIAAISEARQHGDLSENAEYHAAKERQGWIEGRIAEIEDK
GREA_RHILW      ----------------------------------------HGDLSENAEYHAAKEAQSHNEGRISELEDL
GREA_BEII9      -------------------------------------ARSHGDLSENAEYHAAKEAQSLNEGRIAELEDK
GREA_AGRT5      ----------------------------------------HGDLSENAEYHAAKEAQSHNEGRITELEDL
GREA_RHILV      ----------------------------------------HGDLSENAEYHAAKEAQSHNEGRISELEDL
GREA_RHIL3      ----------------------------------------HGDLSENAEYHAAKEAQSHNEGRISELEDL
GREA_ORITI      -------------------------VERLKITTDISTAREFGDLSENAEYKAAKERQLLNDKKIYDLENK
GREA_DESAD      ---------------------------RPEVIKAIAEAREEGDLKENGGYHAARERQGMLEAKINYIESR
GREA_THICR      -----HPMTKEGADALQEELQHLKKVERPAVSNAIAEAREHGDLKENAEYHAAREQQGLMEARIKQIESL
GREA_AGRVS      ----------------------------------------HGDLSENAEYHAAKEAQSHNEGRVSELEDL
GREA_SALTY      ----------------------------------------HGDLKENAEYHAAREQQGFCEGRIKDIEAK
GREA_SALTI      ----------------------------------------HGDLKENAEYHAAREQQGFCEGRIKDIEAK
GREA_RHIEC      ----------------------------------------HGDLSENAEYHAAKEAQSHNEGRITELEDL
GREA_RHIE6      ----------------------------------------HGDLSENAEYHAAKEAQSHNEGRITELEDL
GREA_SHIFL      ----------------------------------------HGDLKENAEYHAAREQQGFCEGRIKDIEAK
GREA_ECOLI      ----------------------------------------HGDLKENAEYHAAREQQGFCEGRIKDIEAK
GREA_ECOL6      ----------------------------------------HGDLKENAEYHAAREQQGFCEGRIKDIEAK
GREA_ECO57      ----------------------------------------HGDLKENAEYHAAREQQGFCEGRIKDIEAK
GREA_SINMW      ----------------------------------------HGDLSENAEYHAAKEAQSHNEGRISELEDL
GREA_RHIME      ----------------------------------------HGDLSENAEYHAAKEAQSHNEGRISELEDL
GREA_UREPA      -------------------------VKWPAITKQLQDAREQGDLSENADYDAAKNEQAALKKRKDXXXXX
GREA_UREP2      -------------------------VKWPAITKQLQDAREQGDLSENADYDAAKNEQAALKKRKDXXXXX
GREA_PETMO      MAEQVYQLTREGYXXXXXXXXXXXXXXMGEVAERIKEARELGDLSENSEYEEAKNEQGMIDSRIKEIDYI
GREA_MAGSM      ----------------------------------------HGDLSENAEYHAAKEQQSFNEGRIAKLEGM
GREA_MYCMS      -------------------------VVRPKVIEELVEARNQGDLSENADYDAARNRQAEVEARIKEVETL
GREA_WOLSU      ---------------------------RPQIVKEIDIARGHGDLKENAEYHAAKERQLFIEARINELSEI
GREA_UREU1      -------------------------VKWPAITKQLQDAREQGDLSENADYDAAKNEQAALKKRKDXXXXX
GREA_SYNFM      ---------------------------RPMVIRAIEEARSHGDISENAEYEAAKEKQAMIEGRIQDLCQK
GREA_PELUB      ---------------------------RPQIVAAISEARSHGDLKENAEYHAAKEEQSHNEGRITEINDI
GREA_DESPS      ----------------------------------IEVAREHGDLKENAEYHAAKERQGMIEARIMDLKDK
GREA_ARCB4      ------PMTLAGYNKVTAELDFLKKTERPETVIALDEARQLGDLKENAEYHSAKEKLKLIDIQIAELNAV
GREA_NEOSM      --------------------------------------RELGDLSENAEYHEARKEQSFVEGKIRELQLC
GREA_FRATW      ----------------------------------------HGDLKENAEYHAARERQGIIEGRIKDIESK
GREA_FRATT      ----------------------------------------HGDLKENAEYHAARERQGIIEGRIKDIESK
GREA_FRATO      ----------------------------------------HGDLKENAEYHAARERQGIIEGRIKDIESK
GREA_FRATN      ----------------------------------------HGDLKENAEYHAARERQGIIEGRIKDIESK
GREA_FRATM      ----------------------------------------HGDLKENAEYHAARERQGIIEGRIKDIESK
GREA_FRATH      ----------------------------------------HGDLKENAEYHAARERQGIIEGRIKDIESK
GREA_FRATF      ----------------------------------------HGDLKENAEYHAARERQGIIEGRIKDIESK
GREA_FRAT1      ----------------------------------------HGDLKENAEYHAARERQGIIEGRIKDIESK
GREA_THESQ      -----------------------------EISERIKEARELGDLSENSEYEAAKNEQGRVGSRIMEIE-Q
GREA_THEP1      -----------------------------EISERIKEARELGDLSENSEYEAAKNEQGRVGSRIMEIEQI
GREA_THEMA      -----------------------------EISERIKEARELGDLSENSEYEAAKNEQGRVGSRIMEIEQI
GREA_SULNB      -------------------------VERGVIAKVIDEARELGDLKENAEYHAAKDKQGLMEARIAELTDV
GREA_FRAP2      MTNGRVPMTPAGEQALRAELSRLKKTERPXXXXXXXXXRDHGDLKENAEYHAARERQGIIEGRIKDIESK
GREA_BUCAT      ------PMTVRGAXXXXXXXXXXXSINRPXXXXXXXXXXXHGDLKENAEYHSAREEQSFCEGRIKEIELK
GREA_BUCAI      ------PMTVRGAXXXXXXXXXXXSINRPXXXXXXXXXXXHGDLKENAEYHSAREEQSFCEGRIKEIELK
GREA_BUCA5      ------PMTVRGAXXXXXXXXXXXSINRPXXXXXXXXXXXHGDLKENAEYHSAREEQSFCEGRIKEIELK
GREA_AMOA5      ---------------------------RAKVAEQLSEARDKGDLSENAEYDAAKEAQEILERRIAKLEEL
GREA_THERP      MARERIPITREGLEALRQEYEYLVKHRRPEIARVIQEAREHGDIRENAAYDAAKHDQAFXXXXXXXXXXX
GREA_MYCGE      -------------------------VKRPEIIRLLQEARDQGDLSENADYDAAKAQQGEIETRIAEIQDI
GREA_BUCCC      ------PMTLRGFNKLKSELKKLKYITRPCIVKAIANARQLGDLKENAEYHSAREEQSFCENRICEIENK
GREA_FLAJ1      -------------------------VMRPKASQDIADARDKGDLSENAEYDAAKEAQGLLEMRIAKLEEV
GREA_MYCPU      -------------------------VERPAVILEIKEARQQGDLSENAEYDAAREKQGQIEDRITELENI
GREA_MESSB      ----------------------------------------HGDLSENAEYHAAKEAQSLNEGRISELEDL
GREA_ACHLI      -SKKVYELTQSGLDQLKDELTHLKDVKRVENLEALKEAREQGDLSENADYDAARNEQARIEARILEIESI
GREA_MYCGA      -------------------------VKRADVIKLIQEAREQGDLSENADYDSAKATQSEIESRITEIQDI
GREA_DESMR      ----------------------------PGVILAIKEAREEGDLRENAGYEAARERQGMLEARINYIESR
GREA_MYCPN      -------------------------VKRPAIIKLLQEARDQGDLSENADYDAAKAQQGEIETRIAEIQDI
GREA1_LACPL     --------------------------QRPEXXXXXXXXXXXGDRSENAEYSSAKRDLGRLESRLRYLNKQ
GREA_ACICJ      ---------------------------------------SHGDLSENAEYHSARERQSFIEGRXXXXXXX
GREA_THEM4      -----------------------------EIAERIKEARELGDLSENSEYQEAKNEQGRIAARINELENM
GREA_FLAPJ      -------------------------IERPKASADIAEARDKGDLSENAEYDAAKEAQGLLELKIKKMEEV
GREA_DEHE1      -------------------------VKRIDVIEEMRLAAMDKDMRENAPYHAAKEQRGQIEGRIKEIEHE
GREA_CHLT3      ---------------------------RQQVLEKITEAKSHGDLSXXXXXXXXXXXXXXXXSRISTLERV
GREA_THEAB      -----------------------------EIAQRIKEARELGDLSENSEYQEAKNEQGRIAARINELENM
GREA_PROA2      -------------------------VVRKEVLEKIAEARAHGDLSXXXXXXXXXXXXXXXXSKIVDLENK
GREA_MYCAP      -------------------------VERPAVQASLKEARAQGDLSENAEYDAARDRQSXXXXXXXXXXXX
GREA_TREPS      -------------------------VRIPENSREIGRALELGDLRENAEYKAAREEQTRLNNMVTRLQEE
GREA_TREPA      -------------------------VRIPENSREIGRALELGDLRENAEYKAAREEQTRLNNMVTRLQEE
GREA_SACEN      ---------------------------RPVIAAKINEAREEGDLKENGGYHAAREEQGHLESRIRQLQEL
GREA_BORBU      -------------------------VEIPENSKEIGKARELGDLKENAEYHSAKEKQQFLTKRLNSLMLE
GREA_STRCO      ---------------------------RTEISAKIAAAREEGDLRENGGYHAAKEEQGKQELRVRQLTQL
GREB_YERPE      ---------------------------RPVVTQAVSEAAAMGDRSENAEYIYGKKRLREIDRRVRFLAKR
GREB_PSEAE      -------------------------VRRPQVTQAVSEAAALGDRSENAEYIYGKKMLREIDSRVRFLRKR
GREA_CHLPN      --------------------------------KEIEDARSLGDLRENSEYKFALEKRARLQEEIRVLSEE
GREA_CHLTR      -----------------------------ENAKEIEDARALGDLRENSEYKIALERRARLQEEIHVLSEE
GREB_NEIMA      ---------------------------RPEIVQIVNWAAGNGDRSENGDYLYGKXXXXXXXXXXXFLTKR
GREA_CHLMU      --------------------------------KEIEDARALGDLRENSEYKFALERRARLQEEIRVLSEE
GREB_PASMU      ---------------------------RPKVTQAVSDAAALGDRSENAEYIYGKRRLREIDRRVRFLTKR
GREA_STRAW      -----------------------------------------GDLRENGGYHAAKEEQGKQELRVRQLTQL
GREB_HAEIN      ---------------------------RPKVTQAVSDAAALGDRSENAEYIYGKRRLREIDRRVRFLTKR
GREB_NEIMB      ---------------------------RPEIVQIVNWAAGNGDRSENGDYLYGKXXXXXXXXXXXFLTKR
GREB_SALTY      ---------------------------RPEVTKKVTWAASLGDRSENADYQYNKKRLREIDRRVRYLTKC
GREB_SALTI      ---------------------------RPEVTKKVTWAASLGDRSENADYQYNKKRLREIDRRVRYLTKC
GREA_RHOE4      ---------------------------RPVIAAEINERREEGDLKENGGYHAAREEQGQQEARIRQLQEL
GREA_MYCTU      ---------------------------RPVIAAEINDRREEGDLRENGGYHAAREEQGQQEARIRQLQDL
GREA_MYCTA      ---------------------------RPVIAAEINDRREEGDLRENGGYHAAREEQGQQEARIRQLQDL
GREA_MYCBT      ---------------------------RPVIAAEINDRREEGDLRENGGYHAAREEQGQQEARIRQLQDL
GREA_MYCBP      ---------------------------RPVIAAEINDRREEGDLRENGGYHAAREEQGQQEARIRQLQDL
GREA_MYCBO      ---------------------------RPVIAAEINDRREEGDLRENGGYHAAREEQGQQEARIRQLQDL
GREB_PSEPK      -------------------------VYRPEITQKVAWAASLGDRSENADYQYNKKLLREIDRRVRYLRKR
GREB_ECOLI      ---------------------------RPEVTKKVTWAASLGDRSENADYQYNKKRLREIDRRVRYLTKC
GREB_XANCP      -----------------------------------------GDRSENAEYTYRKKQLGEIDRRVRYLSKR
GREB_ECOL6      ---------------------------RPEVTKKVTWAASLGDRSENADYQYNKKRLREIDRRVRYLTKC
GREB_ECO57      ---------------------------RPEVTKKVTWAASLGDRSENADYQYNKKRLREIDRRVRYLTKC
GREA_MYCA9      ---------------------------RPVIAAEINERREEGDLRENGGYHAAREEQGQQEARIRQLQEL
GREB_HAEDU      ---------------------------RPKVTQSVSEAAALGDRSENAEYIYGKXXXXXXXXXXXFLSKR
GREA_MYCS2      ---------------------------RPVIAAEINDRREEGDLRENGGYHAAREEQGQQEARIRQLQEL
GREA_MYCLE      ---------------------------RPVIAAEINDRREEGDLRENGGYHAAREEQGQQEARIRQLQDL
GREA_MYCLB      ---------------------------RPVIAAEINDRREEGDLRENGGYHAAREEQGQQEARIRQLQDL
GREB_PSESM      ---------------------------RPDITQKVAWAASLGDRSENADYQYNKKLLREIDRRVRYLRKR
GREA_MYCVP      ---------------------------RPVIAAEINDRREEGDLRENGGYHAAREQQGQEEARIRQLQEL
GREB_VIBVY      ---------------------------RPEITQKVSWAASLGDRSENADYTYNKRLLRQIDRRVRFLSKF
GREB_VIBVU      ---------------------------RPEITQKVSWAASLGDRSENADYTYNKRLLRQIDRRVRFLSKF
GREB_XANAC      ------------------------------------------------EYTYRKKQLGEIDRRVRYLSKR
GREB_VIBCH      --------------------------QRPEITQKVSWAASLGDRSENADYTYNKRLLRQIDRRVRFLSKL
GREB_VIBPA      --------------------------KRPEITKIVTWAASLGDRSENADYTFNKRLLRQIDRRVRFLRKF
Y3817_MYCBO     -----------------------------------------GDHGDAAEAIQRADELAILGDRINELDRR
Y3788_MYCTU     -----------------------------------------GDHGDAAEAIQRADELAILGDRINELDRR
CATB_ACIAD      ----------------------------PEISVRVDVNRAW------SELECVKGIQQLQDGGIDLIEQP
RNK_SHIFL       -----------------------------------------------------------------ALNAE
RNK_ECOLI       -----------------------------------------------------------------ALNAE
RNK_ECOL6       -----------------------------------------------------------------ALNAE
RNK_ECO57       -----------------------------------------------------------------ALNAE


                         .         .         *         .         .         .         .:140
query           IRYAEIVNSDAVAQDEVAIGKTVTIQEIGEDEEEVYIIVGSAGADAFAGKVSNESPIGQALIGKKTGDTA
GREA_STRZT      IRYAEIVNSDAVAQDEVAIGKTVTIQEIGEDEEEVYIIVGSAGADAFAGKVSNESPIGQALIGKKTGDTA
GREA_STRZP      IRYAEIVNSDAVAQDEVAIGKTVTIQEIGEDEEEVYIIVGSAGADAFAGKVSNESPIGQALIGKKTGDTA
GREA_STRZJ      IRYAEIVNSDAVAQDEVAIGKTVTIQEIGEDEEEVYIIVGSAGADAFAGKVSNESPIGQALIGKKTGDTA
GREA_STRR6      IRYAEIVNSDAVAQDEVAIGKTVTIQEIGEDEEEVYIIVGSAGADAFAGKVSNESPIGQALIGKKTGDTA
GREA_STRPJ      IRYAEIVNSDAVAQDEVAIGKTVTIQEIGEDEEEVYIIVGSAGADAFAGKVSNESPIGQALIGKKTGDTA
GREA_STRP7      IRYAEIVNSDAVAQDEVAIGKTVTIQEIGEDEEEVYIIVGSAGADAFAGKVSNESPIGQALIGKKTGDTA
GREA_STRP4      IRYAEIVNSDAVAQDEVAIGKTVTIQEIGEDEEEVYIIVGSAGADAFAGKVSNESPIGQALIGKKTGDTA
GREA_STRP2      IRYAEIVNSDAVAQDEVAIGKTVTIQEIGEDEEEVYIIVGSAGADAFAGKVSNESPIGQALIGKKTGDTA
GREA_STRPN      IRYAEIVNSDAVAQDEVAIGKTVTIQEIGEDEEEVYIIVGSAGADAFVGKVSNESPIGQALIGKKTGDTA
GREA_STRPI      IRYAEIVNSDAVAQDEVAIGKTVTIQEIGEDEEEVYIIVGSAGADAFAGKVSNESPIGQDLIGKKTGDTA
GREA_STRSV      IRYAEIVNSDAVAKDEVAIGKTVTIQEVGESEEEVYIIVGSAGADAFAGKVSNESPIGQALIGKKTGDTA
GREA_STRGC      IRYAEIVDSDAVAKDEVGIGKTVTIQEVGETEKEVYIIVGSAGADAFAGKVSNESPIGQALIGKKKGDIA
GREA_STRMU      IRYAEIVDSDAVAKNEVAIGKTVIVREVGTNDEDTYSIVGAAGADVFAGKISNESPIAQALIGKKTGDKV
GREA_STRPG      IRYAEIIDSDAVAKDEVAIGKTVIVQEVGTTDKDTYHIVGAAGADIFSGKISNESPIAQALIGKKTGDKV
GREA_STRP8      IRYAEIIDSDAVAKDEVAIGKTVIVQEVGTTDKDTYHIVGAAGADIFSGKISNESPIAQALIGKKTGDKV
GREA_STRP6      IRYAEIIDSDAVAKDEVAIGKTVIVQEVGTTDKDTYHIVGAAGADIFSGKISNESPIAQALIGKKTGDKV
GREA_STRP3      IRYAEIIDSDAVAKDEVAIGKTVIVQEVGTTDKDTYHIVGAAGADIFSGKISNESPIAQALIGKKTGDKV
GREA_STRP1      IRYAEIIDSDAVAKDEVAIGKTVIVQEVGTTDKDTYHIVGAAGADIFSGKISNESPIAQALIGKKTGDKV
GREA_STRTD      IRYAEIVDSDAVANDEVAIGKTVVVQEVGTSDKDTYHIVGAAGADIFSGKISNESPIAQALIGKKVGDKV
GREA_STRSY      IRYAEIVNSDAVAADEVAIGKXXXXXXXXXXXXXXYHIVGAAGADVFANKISNESPIGHALIGKKTGDVA
GREA_STRS2      IRYAEIVNSDAVAADEVAIGKXXXXXXXXXXXXXXYHIVGAAGADVFANKISNESPIGHALIGKKTGDVA
GREA_STRT2      IRYAEIVDSDAVANDEVAIGKTVVVQEVGTSDKDTYHIVGAAGADIFSGKISNESPIAQALIGKKVGDKV
GREA_STRT1      IRYAEIVDSDAVANDEVAIGKTVVVQEVGTSDKDTYHIVGAAGADIFSGKISNESPIAQALIGKKVGDKV
GREA_STRA5      IRYAEIIDSDAVAKDEVAIGKTVLVQEVGTNDKDTYHIVGAAGADIFSGKISNESPIAHALIGKKTGDLA
GREA_STRA3      IRYAEIIDSDAVAKDEVAIGKTVLVQEVGTNDKDTYHIVGAAGADIFSGKISNESPIAHALIGKKTGDLA
GREA_STRA1      IRYAEIIDSDAVAKDEVAIGKTVLVQEVGTNDKDTYHIVGAAGADIFSGKISNESPIAHALIGKKTGDLA
GREA_STRU0      IRFAEIIDSDAVAKDEVAIGKTVVVQEVGTTDKDTYHIVGSAGADIFSGKISNESPIAQALIGKKKGDIA
GREA_LACLS      IRYAEIVNNAKIAKDEVALGKNVTFVEVGETDEESYQIVGTAEADPFTGKISNESPIARVLIGKKVGDIV
GREA_LACLA      IRYAEIVDNAKIAKDEVALGKNVTFVEVGETDEESYQIVGTAEADPFSGKISNESPIARVLIGKKVGDIV
GREA_LACLM      IRYAEIVDNAKIAKDEVALGKNVTFVEVGETDEESYQIVGTAEADPFTGKISNESPIARVLIGKKVGDIV
GREA_LACF3      LQYAVIIDNEDVAADEVSMGREITFQELPDEEPESYTIVGESESDPLSGKISNESPMAKGLLGHKVGDTV
GREA_LEUMM      IDNAEIIDSNATAKDEVSLGKTVTFKELPNEEPETYAIVGSVEADPLAGKISNESPMANALIGKKVGETV
GREA_BACCR      IRNAVIIKDTGEVSTVVTLGKTVTFKELPNGDEEAYTIVGSAEADPFEGRISNDSPIAKSLLGKQIGEKV
GREA_BACCN      IRNAVIIEDTGEESTVVTLGKTVTFKELPDGDEEAYTIVGSAEADPFEGRISNDSPIAKSLLGKQIGEKV
GREA_BACCQ      IRNAVIITDNGEESTVVTLGKTVTFKELPDGDEEAYTIVGSAEADPFEGRISNDSPIAKSLLGKQIGEKV
GREA_BACC7      IRNAVIITDNGEESTVVTLGKTVTFKELPDGDEEAYTIVGSAEADPFEGRISNDSPIAKSLLGKQIGEKV
GREA_BACC1      IRNAVIITDNGEESTVVTLGKTVTFKELPDGDEEAYTIVGSAEADPFEGRISNDSPIAKSLLGKQIGEKV
GREA_GEOTN      IRNAVIIEEDKENPDVVSLGKSVTFIELPDGEEETYTIVGSAEADPFEGKISNDSPIAKSLIGHRVGDEV
GREA_BACHK      IRNAVIITDNGEESTVVTLGKTVTFKELPNGDEEAYTIVGSAEADPFEGRISNDSPIAKSLLGKQIGEKV
GREA_BACCZ      IRNAVIITDNGEESTVVTLGKTVTFKELPNGDEEAYTIVGSAEADPFEGRISNDSPIAKSLLGKQIGEKV
GREA_BACAN      IRNAVIITDNGEESTVVTLGKTVTFKELPNGDEEAYTIVGSAEADPFEGRISNDSPIAKSLLGKQIGEKV
GREA_BACAC      IRNAVIITDNGEESTVVTLGKTVTFKELPNGDEEAYTIVGSAEADPFEGRISNDSPIAKSLLGKQIGEKV
GREA_BACAA      IRNAVIITDNGEESTVVTLGKTVTFKELPNGDEEAYTIVGSAEADPFEGRISNDSPIAKSLLGKQIGEKV
GREA_GEOKA      IRNAVIIEEDKENPDVVSLGKSVTFIELPDGEEETYTIVGSAEADPFEGKISNDSPIAKSLLGRRVGDEV
GREA_LISW6      IRNAQIIDAAEAHNGLVTLGNTVTFIELPDGEEETYTIVGSAEADPFEGKISNDSPIAKGLLGHKEGEEV
GREA_LISMO      IRNAQIIDAAEAHNGLVTLGNTVTFIELPDGEEETYTIVGSAEADPFEGKISNDSPIAKGLLGHKEGEEV
GREA_LISMH      IRNAQIIDAAEAHNGLVTLGNTVTFIELPDGEEETYTIVGSAEADPFEGKISNDSPIAKGLLGHKEGEEV
GREA_LISMF      IRNAQIIDAAEAHNGLVTLGNTVTFIELPDGEEETYTIVGSAEADPFEGKISNDSPIAKGLLGHKEGEEV
GREA_LISMC      IRNAQIIDAAEAHNGLVTLGNTVTFIELPDGEEETYTIVGSAEADPFEGKISNDSPIAKGLLGHKEGEEV
GREA_LISIN      IRNAQIIDAAEAHNGLVTLGNTVTFIELPDGEEETYTIVGSAEADPFEGKISNDSPIAKGLLGHKEGEEV
GREA_BACSU      IRNAKIIEDDG-GSNVVGLGKTVTFVELPDGDEESYTIVGSAEADPFEGKISNDSPIAKSLLGKKVDEEV
GREA_LEUCK      IENAEIIDPNATAADVVSLGKTVTFKELPDEEPETYAIVGSTESDPLAGKISNESAMAVALLDKKVGDKV
GREA2_LACPL     LQYAEIIDSDKIDETEVSVGKIVTFKELPDEEPESYTIVGAAEADPMVGKISNDSPIAKGLIGHHVDEEV
GREA_MACCJ      LRHAVIIEDDG-SKSEVQIGRTVTFAEVPGNEEESYKIVGSAEADPFEGKISNESPIAKALLGKKVGDEV
GREA_BACA2      IRNAKIIEDDG-GSNVVGLGKTVSFIELPDGEEESYTIVGSAEADPFEGKISNDSPIAKSLLGRKVDEEV
GREA_BACP2      IRNAKIIEDEGNS-NIVSLGKTVTFVELPDGEEESYTIVGSAEADPFEGKISNDSPIAKSLLGKQVDDKV
GREA_OCEIH      IRNAVIIENDNDNPNIVSLGKSVSFVELPDGDEETYTIVGSAEADPFEGKISNDSPMATSLLGKEIGEEV
GREA_BACSK      IRNAVMIENEKVDGNVVSLGKTVRLMELPDGEEEEYTIVGSAESDPFEGKISNDSPMAQSLLGKTVNDRV
GREA_STAS1      LRNALIIE-DTGNNNEVQLGKTVTIVELPGEEEEEYQIVGSAESDAFKGKISNESPMAKSLIGKKLDDEV
GREA_STAHJ      LRYALII-EDTGDNNVVQIGKTVTFIELPGDEEESYQIVGSAEADAFNGKISNESPMAKALIGKSLKDEV
GREA_STACT      IRNALIIE-DSGDNNVVQIGKTVTFIEIPDGEEEVYQIVGSAEADAFNGKISNESPIAKSLIGKHLDDEV
GREA_STAES      IRNALII-EDNGDNNVVQIGKTVTFIELPGDEEESYQIVGSAEADAFKGKISNESPMAKALIGKGLNDQV
GREA_STAEQ      IRNALII-EDNGDNNVVQIGKTVTFIELPGDEEESYQIVGSAEADAFKGKISNESPMAKALIGKGLNDQV
GREA_OENOB      IQFAQVIDASSASKNVVTLGKKISFKEVPDGDEETYTIVGSAESDPLSGKISNDSPMGKALLDHKTGDKV
GREA_BACLD      IRNAKIIEDDGANSDIVSLGKTVTFTELPDGEEESYTIVGSAEADPFEGKISNDSPIAKSLLGKQVGDEV
GREA_THEPX      LKNAKVIDEEDIKLDQVSIGCTVKVYDESYNEEVEYTIVGSAEADPMNNKISDESPIGKALLGKKVGDVV
GREA_THEP3      LKNAKVIDEEDIKLDQVSIGCTVKVYDESYNEEVEYTIVGSAEADPMNNKISDESPIGKALLGKKVGDVV
GREA_STAAW      LRNALII-EDTGDNNVVKIGKTVTFVELPGDEEESYQIVGSAESDAFNGKISNESPMAKALIGKGLDDEV
GREA_STAAT      LRNALII-EDTGDNNVVKIGKTVTFVELPGDEEESYQIVGSAESDAFNGKISNESPMAKALIGKGLDDEV
GREA_STAAS      LRNALII-EDTGDNNVVKIGKTVTFVELPGDEEESYQIVGSAESDAFNGKISNESPMAKALIGKGLDDEV
GREA_STAAR      LRNALII-EDTGDNNVVKIGKTVTFVELPGDEEESYQIVGSAESDAFNGKISNESPMAKALIGKGLDDEV
GREA_STAAN      LRNALII-EDTGDNNVVKIGKTVTFVELPGDEEESYQIVGSAESDAFNGKISNESPMAKALIGKGLDDEV
GREA_STAAM      LRNALII-EDTGDNNVVKIGKTVTFVELPGDEEESYQIVGSAESDAFNGKISNESPMAKALIGKGLDDEV
GREA_STAAE      LRNALII-EDTGDNNVVKIGKTVTFVELPGDEEESYQIVGSAESDAFNGKISNESPMAKALIGKGLDDEV
GREA_STAAC      LRNALII-EDTGDNNVVKIGKTVTFVELPGDEEESYQIVGSAESDAFNGKISNESPMAKALIGKGLDDEV
GREA_STAAB      LRNALII-EDTGDNNVVKIGKTVTFVELPGDEEESYQIVGSAESDAFNGKISNESPMAKALIGKGLDDEV
GREA_STAA9      LRNALII-EDTGDNNVVKIGKTVTFVELPGDEEESYQIVGSAESDAFNGKISNESPMAKALIGKGLDDEV
GREA_STAA8      LRNALII-EDTGDNNVVKIGKTVTFVELPGDEEESYQIVGSAESDAFNGKISNESPMAKALIGKGLDDEV
GREA_STAA3      LRNALII-EDTGDNNVVKIGKTVTFVELPGDEEESYQIVGSAESDAFNGKISNESPMAKALIGKGLDDEV
GREA_STAA2      LRNALII-EDTGDNNVVKIGKTVTFVELPGDEEESYQIVGSAESDAFNGKISNESPMAKALIGKGLDDEV
GREA_STAA1      LRNALII-EDTGDNNVVKIGKTVTFVELPGDEEESYQIVGSAESDAFNGKISNESPMAKALIGKGLDDEV
GREA_BACHD      IRNAEIIEESEGDANVVSLGKTVKFVEIPDGEEEEYTIVGSAESDPFEGKISNDSPMAQSLLGHTIDDVV
GREA_THETN      LKNAKVIDEEDIKLDEVSIGCTVKVFDETYNEEVEYTIVGSAEADPMNNKISDESPIGKALLGKKVGETI
GREA_FINM2      LLHAKVIQDDENQKDVVTVGSTVTYKNLNLNKEMTYQIVGTAESDPFAGRISNESPTGKALLNLKVGDTT
GREA_CLOBH      LKNASIVDENEVPKDVVSVGSIVKVKDYEFDEEVEYIIVGSAEADPMNNKISNESPVGHGLIGKKAGDII
GREA_CLOB1      LKNASIVDENEVPKDVVSVGSIVKVKDYEFDEEVEYIIVGSAEADPMNNKISNESPVGHGLIGKKAGDII
GREA_CLOBM      LKNASIVDENEVPKDIVSVGSIVKVKDYEFDEEVEYIIVGSAEADPMNNKISNESPVGHGLIGKKVGDII
GREA_CLOBL      LKNASIVDENEVPKDIVSVGSIVKVKDYEFDEEVEYIIVGSAEADPMNNKISNESPVGHGLIGKKVGDII
GREA_CLOBK      LKNASIVDENEVPKDIVSVGSIVKVKDYEFDEEVEYIIVGSAEADPMNNKISNESPVGHGLIGKKVGDII
GREA_CLOBJ      LKNASIVDENEVPKDIVSVGSIVKVKDYEFDEEVEYIIVGSAEADPMNNKISNESPVGHGLIGKKVGDII
GREA_CLOB6      LKNASIVDENEVPKDIVSVGSIVKVKDYEFDEEVEYIIVGSAEADPMNNKISNESPVGHGLIGKKVGDII
GREA_CLOPS      LKNAVVVDESEISTDIVTVGSIVKVMDFDFDEEVEYSIVGSAEADPMNFKISNESPVGEGLMGKKVGDVV
GREA_CLOPE      LKNAVVVDESEISTDIVTVGSIVKVMDFDFDEEVEYSIVGSAEADPMNFKISNESPVGEGLMGKKVGDVV
GREA_CLOP1      LKNAVVVDESEISTDIVTVGSIVKVMDFDFDEEVEYSIVGSAEADPMNFKISNESPVGEGLMGKKVGDVV
GREA_CLONN      LRNANVVDESEISLDAVSVGSIVKVKDYDFDEIIDFHIVGSAEADPMENKISNESPVGSALIGKKVGDVI
GREA_CLOB8      LKNAVVVDESEIPSDIVSVGSKVKVKDYEFDEEVEYSIVGSAEADPMNFKISNESPVGNALVGKKVGDVV
GREA_CLOTH      LKNAKVIDEEDIQTDVVSIGSKVKVLDMEFDEEVEYYIVGSTEADPSQYKISNESPVGKALIGGKIGDIV
GREA_ALKOO      LRKAVIIDEEDINTDIVSIGSIVQVNDLEFDEIVEYTIVGSTEADPYELKISNESPVGRALLGTKVGDVV
GREA_XYLFT      LSHAEVIDVAKLAGTKIVFGATVTLADLGTDEESRYQIVGDLEADIKQGLVAISSPVARALIGKQEGDTI
GREA_XYLFM      LSHAEVIDVAKLAGTKIVFGATVTLADLGTDEESRYQIVGDLEADIKQGLVAISSPVARALIGKQEGDTI
GREA_XYLF2      LSHAEVIDVAKLAGTKIVFGATVTLADLGTDEESRYQIVGDLEADIKQGLVAISSPVARALIGKQEGDTI
GREA_ROSCS      LARAQIIDEENGSNHEVRIGSRVTVRIDGEHEEETWTIVGSTEAKPSEGKISNESPIGAALLGKRPSQQV
GREA_PELPD      LARAYVVDLSNMKPDKVVFGSTVTLYDTASEEEITYKIVGEDEADIKLGKISCTSPVGKALIGHKLDDSV
GREA_BARQU      IARAEVINVSRLSGDKIKFGATIKLLDEDTEEKKVYQIVGDQEADVKTGKISISSPIARALIGKQEGDVI
GREA_RHOPT      LARADIIDVSKLSGDTVKFGATVTLIDEDTEKKAVWQIVGEAEADAKKGKISITSPLARALIGKKAGSSV
GREA_RHOPA      LARADIIDVSKLSGDTVKFGATVTLIDEDTEKKAVWQIVGEAEADAKKGKISITSPLARALIGKKAGSSV
GREA_PHEZH      MARAQVIDVSKLSGEQVKFGATVSLIDEDTEEEARYQIVGEHEADVKAGRVSVTSPIARAIIGKETGDVV
GREA_NITWN      LARADIIDVSKLSGDTIKFGATVTLIDEDTDKKAVWQIVGEAEADAKQGRISITSPLARALIGKKKGSSV
GREA_XYLFA      LSHAEVIDAKLNAGTKIVFGATVTLVDLETDEESRYQIVGDLEADIKQGLVAISSPVARALIGKQEGDTI
GREA_NITHX      LARAEIIDVSKLSGDTIKFGATVTLIDEDTDKKAVWQIVGEAEADAKKGRISITSPLARALIGKKKGASV
GREA_CLOK5      LKNASMVDEDEVPLDIVGIGSIVKVKDYDLDEEVEYLIVGSAEADPINNKISNESXXXXXXXXXXXXDVI
GREA_CLOK1      LKNASMVDEDEVPLDIVGIGSIVKVKDYDLDEEVEYLIVGSAEADPINNKISNESXXXXXXXXXXXXDVI
GREA_CLOAB      LKNANVIDESELKNDVVSVGSKVMVKDYQFDEEIEFSIVGSAEADPIENKISNESPVGSALIGKKVGDEI
GREA_SYNWW      LKKARLMEDEDIRTDVVSLGSRITLKEMKSGRXXXXXXXXXXXXXXXDGKISDESPVGKAIMGKKVKSTV
GREA_RUTMC      LSRMQVIDVTKLNQDRCVFGTTITLMNIEDDSETTYKIVGEDEADIILGKISCHSPIASALMGNEEGDEV
GREA_BRASB      LARADVIDVTKLSGETIKFGATVTLIDEDTEKKTVWQIVGEVEADAKKGKISITSPLARALIGKKMGTTV
GREA_XANAC      LSHAEIIDTKLSAGTKIVFGATVTLADTETDEEKRYQIVGDLEADIKMGLIAISSPLARALIGKLEGDSV
GREA_ROSS1      LARAQIIDEENGDNHEVRIGSRVTVRIDGEDGEETWTIVGSTEAKPSEGKISNESPIGSALLGKRPRQKV
GREA_BRAJA      LARADIIDISKLSGDTIKFGATVTLVDEDTEKKAVWQIVGEVEADAKKGRISITSPLARALIGKKKGSTV
GREA_BAUCH      LSHAQIIDTKLFPSGKVVFGVTVSVQNLNINEEQTYRIVGDDEANFKHNLISISSPIARGLIGKKKGDIV
GREA_THEYD      LARAYVIDPSKINQNKVAFGAKVRVIDIDTEEEKEFHLVGPDEADVKNGKISITSPVGKALIGKEVGEQV
GREA_CHLAD      LSRAEIIDEDQASTGEVRIGSSVTVRFEDDGSEETWTIVGSAEANPRQGRISNESPIGAALLGKRVRNKV
GREA_RHORT      TSRAEVIDISKLSGDTVRFGATVSVLDEDSEEQTTYQIVGAHEADLKAGRISVASPIGKALIGKKVGDSI
GREA_PELCD      IARAEVIKPGDVVTDKIVFGASVTLFDVDTDSEVTYKIVGEDEADLKHGKISVTSPVGRALIGHRLDDEV
GREA_CLOBA      LKNAVVVDESEIPKDIVSVGSKVKVKDYDFDEEVEYSIVGSAEADPMSFKISNESPVGKAL---------
GREA_BART1      IARAEVIDVSRLSGDKIKFGATIKLLDEDTEEKKVYQIVGDQEADVKIGKISISSPIARALIGKQEGDVI
GREA_CLOBB      LKNAVVVDESEIPKDIVSVGSKVKVKDYDFDEEVEYSIVGSAEADPMSFKISNESPVGNAL---------
GREA_RICFE      TARAEIIDIGKLSGDNIKFGATVTLIDDDTEEEVTYIIVGEYEADITRKRVSIASPIAKALIGKSVGDFV
GREA_LEGPL      LSHAQIIDISKLPNNKVIFGSTVTICHVATGSELTYKIVGEDEADIKLNKISYSSPIARALIGKELDDAV
GREA_LEGPH      LSHAQIIDISKLPNNKVIFGSTVTICHVATGSELTYKIVGEDEADIKLNKISYSSPIARALIGKELDDAV
GREA_LEGPC      LSHAQIIDISKLPNNKVIFGSTVTICHVATGSELTYKIVGEDEADIKLNKISYSSPIARALIGKELDDAV
GREA_LEGPA      LSHAQIIDISKLPNNKVIFGSTVTICHVATGSELTYKIVGEDEADIKLNKISYSSPIARALIGKELDDAV
GREA_GEOLS      LARAHVVDLTGLKPDKVVFGATVTLYDTASEEEITYKIVGEDEADIKLGKISCTSPVGKALIGHKLDDSV
GREA_BARBK      IARAEVIDVSRLSGNQIKFGATVKLLNEDTEEKKVYQIVGDQEADVKIGKISISSPIARALIGKEEGDVI
GREA_RHOPB      LARADIIDISKLSGDTIKFGATVTLIDEDTEKKAVWQIVGEPEADAKKGRISITSPLARALIGKKKGASV
GREA_CHLSY      LSRAEVIDEDQASNGEVRVGSSVTVRFEDDGTEETWTIVGSAEANPRQGRISNESPLGAALLGKRARNKV
GREA_CHLAA      LSRAEVIDEDQASNGEVRVGSSVTVRFEDDGTEETWTIVGSAEANPRQGRISNESPLGAALLGKRARNKV
GREA_HELPY      VANAQVIDPSALAHNKVSFGSTIKILNLDNDKEFSYTIVGSVESDPAKGLISFGSPIAKSLIGKSKGDAV
GREA_HELPJ      VANAQVIDPSALAHNKVSFGSTIKILNLDNDKEFSYTIVGSVESDPAKGLISFGSPIAKSLIGKSKGDAV
GREA_CLOD6      VRKAVIIDESKIDLNVVTIGSIVKVKDLEFDEEVEYTIVGSTEADPYDGKISNESPVGKALLGRAAKEVV
GREA_HELAH      ISNAQVIDPGALMHNKVSFGSTIKILNLDNDKEFSYTIVGSVESDPAKGLISFGSPIAKSLIGKSKGDVA
GREA_BARHE      IARAEVINVSRLSGDKIKFGATIKLLDEDTEEKKVYQIVGDQEADVKTGKISISSPIARALIGKQEGDVI
GREA_XANCP      LSHAEIIDTKLAAGTKIVFGATVTLADTETDEEKRYQIVGDLEADIKLGLIAISSPLARALIGKLEGDSV
GREA_RHOP5      LARADVIDITKLSGDTIMFGATVTLVDEDTEKKAVWQIVGEPEADAKKGRISITSPLARALIGKKKGASV
GREA_RHOBA      IARASIIDVSSLPKDEVVFGCTVTVEDVAYGDEEQFTLVGAGDEDYDSGKILVTSPFGQGLVGKKVGETA
GREA_HELPS      IANAQVIDPSVLAHNKVSFGSTIKILNLDNDKEFSYTIVGSVESDPSKGLISFGSPIAKSLIGKSKGDAV
GREA_RICCN      TARAEIIDIGKLSGDNIKFGATVTLIDDDTEEEVTYIIVGEYEADITRKRVSIASPIAKALIGKSVGDFV
GREA_PSYCK      LGGAQVIDPTTLPKDRVIFGVSVVIENMDTEEEKQYKIVGDDEADFKAGKISVNSPIARGLIGKSEGDEA
GREA_PSYA2      LGGAQIIDPATLPKDRVIFGVSVVIENMDTEEEKQYKIVGDDEADFKAGKISVNSPIARGLIGKSEGDEA
GREA_HELPH      VANAQVIDPSVLAHNKVSFGSTIKILNLDNDKEFSYTIVGSVESDPAKGLISFGSPIAKSLIGKSKGDAV
GREA_HELPG      VANAQVIDPSVLAHNKVSFGSTIKILNLDNDKEFSYTIVGSVESDPAKGLISFGSPIAKSLIGKSKGDAV
GREA_HELP2      VANAQVIDPSVLAHNKVSFGSTIKILNLDNDKEFSYTIVGSVESDPAKGLISFGSPIAKSLIGKSKGDAV
GREA_VESOH      LSRMQIIDVTKLSQDRCVFGTTITLMNSVDNSEITYQIVGEDEADISLDKISCHSPIASALMGNEEGDKV
GREA_CAMLR      ISRAQIIDPASYEHDSVKFGSCVVVEDLESEKQSTYTIVGVNEGNLEKGYISINSPIARAMLGKKEGDDF
GREA_BUCBP      LSKARIIDITKVKNNGVIIGSTVTILNLTSNQEFTYRIVGDDESNFKRKLISINSPMSRGLVGKKVSDVA
GREA_RHILO      IARAEVIDVTKLSGDKVKFGATVVLVDEDTEEKKTYQIVGDQEADVKSGRISISSPIARALIGKEVGDAI
GREA_NEIMB      LSVAHIINPTEIAEGKIVFGXXXXXXXXXXXXHVIYQIVGEDEADIKQGKIYVGSPIARALIGKEEGDTA
GREA_ANASK      IASAEVIDVTKHAGDRVVFGATVSLEDAESGDQVTYRIVGELEADLKQGKISVTSPIARALIGRSEGDTV
GREA_RICCK      AARAEIIDISKLSGDNIKFGATVTLIDDDTEEKVTYIVVGEYEADITRKRVSIASPIAKALIGKSVGDFV
GREA_ALHEH      LSNAQVIDPAAVAQGKVIFGATVDLVDEDSGKEVTYQIVGEDEADIKQGLVSVNSPIARALIGKEEGDLV
GREA_NEIMA      LSVAHIINPTEIAEGKIVFGXXXXXXXXXXXXXXXYQIVGEDEADIKQGKIYVGSPIARALIGKEEGDTA
GREA_HELHP      LANAQVIDPASLPHNKVSFGSSVKILNLDTDKEFVYTLVGSMESNPSKGLISVSSPIAKALMGKSEGDEV
GREA_CAMHC      VSRAKVIDPSTYEHDKVKFGSTVTIMDVETELEKTYVIVGISESDISKGYININTPLARQLLGKVEGDDV
GREA_MARMM      LARAQVIDITKMSGDTVKFGATVTVLDEDTEQESTYQIVGEDESDVKSGKISISSPIARSMINKEVGDVA
GREA_METCA      LANAQIIDVTRLPGGKVVFGATAEIEDLASGEVVTYQIVGEDEAEIKEGRISVTSPIARALIGKQEGDVA
GREA_SPHAL      LSRAQVIDPTTLSGDRIVFGATVTLTD--EDDKPVYQIVGQAEADAKAGKISYNSPLGRALIGRRVDDEI
GREA_RHOSK      LSLAEVID-PAKLSGSIKFGATVTILDEETEEERTYQIVGEAEADIEAGLLNIKSPLARALIGKDEGDSI
GREA_RHOS4      LSLAEVID-PAKLSGSIKFGATVTILDEETEEERTYQIVGEAEADIEAGLLNIKSPLARALIGKDEGDSI
GREA_RHOS1      LSLAEVID-PAKLSGSIKFGATVTILDEETEEERTYQIVGEAEADIEAGLLNIKSPLARALIGKDEGDSI
GREA_CHLP8      LASATILDPKQIKTDRVYILTSVKLRNL-DDEDEIYTLVSSEEADSDLGKISVRSPVGRALIGKSVGDKV
GREA_RICBR      TARAEIINVAKLSGDSIKFGATVVLIDDETEEEVMYHIVGEYEADITKKRVSIASPIAKALIGKSVGDIV
GREA_RICB8      TARAEIINVAKLSGDSIKFGATVVLIDDETEEEVMYHIVGEYEADITKKRVSIASPIAKALIGKSVGDIV
GREA_RICPR      TARAEIIDICKLSGDNIKFGATVTLIDDDTEEEVTYIIVGEYEADITKKRVSIASPIAKALIGKSVGDFV
GREA_PASMU      LANSQIIDVTKIPNNKVIFGATILLLNIDTEEEVSYQIVGDDEANIKAGLISVNSPIARGLIGKEVDDVV
GREA_HYPNA      LARADVIDVSKLGGSKVRFGATVTIADVDTEDEQTYKIVGEDEADVKQGKISVTSPIARALIGK------
GREA_VIBPA      LSVAQVIDVTKMENTKVIFGSTVTLIDVDTDEEKTYQIVGDDEADIKAGRISVSSPIARGLIGKMEGDEV
GREA_METS4      ISRAEIIDVSKLSGTKVKFGATVQLIDEDTEEEKTYQIVGEPEADVRSGRVSITSPVARALIGKGVGDTV
GREA_HAEIN      LGNAQIIDVSKMPNNKVIFGATVVLVNTNTDEEVTYRIVGDDEADIKSGLISVNSPIARGLIGKELDDTV
GREA_METNO      ISRAEVIDVAKLSGSKVKFGATVQLIDEDTEEEKTYQIVGEPEADVRSGRVSITSPVARALIGKGVGDTV
GREA_THISH      LSNAQIIDVTTLAGGKVVFGATVDLSDEETGKEVTYQIVGDDEADIKEGKISVNSPIARALIGKEEGDVV
GREA_THENN      LSNAEIIE-DSEEGDEVTLGKWVTIRNLDTGEEHKFRIVTPQEADFFAQKLSADSPLGKSLLGRKVGDIV
GREA_RICTY      TARAEIIDICKLSGDNIKFGATVTLIDDDTEEEVTYVIVGEYEADITKKRVSIASPIAKALIGKSVGDFV
GREA_RHOS5      LSLAEVID-PARLSGSIKFGATVTILDEETEEEKTYQIVGEAEADIENGLLNIKSPLARALIGKDEGDSI
GREA_SPHWW      LSRAQVIDPSMLSGDKIVFGATVTL--LDDDEKPVYQIVGQTEADAKTGKISYNSPLGRALIGKKVDDEV
GREA_CHLTE      LASATILDPKQIKTDRVYILTSVKLRNLAEDEIIEYTLVSSEEADSDLGKISVRSPVGRSLIGKSVGDKV
GREA_YERPG      LSNAQVIDITKMPNNRVIFGATVRVLNLNTEEEQNYRIVGDDEADFKQNLISVNSPIARGLIGKEVDDVV
GREA_YERPE      LSNAQVIDITKMPNNRVIFGATVRVLNLNTEEEQNYRIVGDDEADFKQNLISVNSPIARGLIGKEVDDVV
GREA_RALSO      LAAAQVIDPAGLADGRIVFGATIDLEDLDSGKPVTYQIVGDDEADLDSGKISISSPIARALIGKYEGDVA
GREA_PSYWF      LSGAQVIDPATLPRERVVFGVTVVIENLDTEEQKRYQIVGDDEADFKNNKISVNSPIARGLIGKSEGDEA
GREA_PSEAE      LSNAQVIDVTAIPHSKVIFGTTVDIANVETDETVTYQIVGDDEADIKGGKISVNSPIARALIGKTEGDAV
GREA_PARDP      LSRAEVIDPTRL-NGSIKFGATVTLVDEDSEEERTYQIVGEAEADLERGLLNIRSPLARALIGKDEGDSI
GREA_MYCA5      LDNYEIIKTQTNRQSVVRIGSNVSVVSLKDDTVINFQIVGALDTDPFNGKISNTSPLAKAVIGRKAGEVV
GREA_HAEDU      LGNAQVIDVAKMTNNKVIFGATVGLVNIDTDEEVTYRIVGDDEANIKEGLISVNSPIARGLVGKSVDDSV
GREA_NITOC      LAHAQIIDVSKLQKDRVVFGVTVDLVNIETDEEASYQIVGDLEANIKENKISINSPIARALIGKREGDEI
GREA_HAMD5      LSHAQIIDVTKIANKGIVIGATVTVLNTHSEEKKIYQIVGDDEANFKKDLISVNSPIARGLIAKKISDVA
GREA_JANSC      ISLAQVID-PATLSGAIKFGATVDLVDXXXXXXKTYMIVGEAEADIEKGLLNIKSPLARALIGKEEGDSV
GREA_HALHL      LSNAQIIDPAAVAAPKIVFGATVALEDTDTEETVTYQIVGEDEADIKQHLISVNSPIARALIGKEEGDEA
GREA_AZOC5      ISRAEVIDVSKLSGDIVKFGAXXXXXXXXXXXXRVWQIVGDSEADAKAGRISISSPVARALIGKKKGSSV
GREA_DESDA      MALYQVIDLDTLSGDKVIFGATVDLEDVDSGEAKTYTILGPDEADPSKGSISFLSPVGQALLGREEGDEV
GREA_CHLPD      LSTATILDPKQVKTDKVYILTSVKLRDLDKEGEIIYTLVSSEEADTDLGKISVRSPVGRALIGKTVGEKV
GREA_CHLCH      LSAATILDPKQIKTDKVYILTSVKLRNLDNPDEIIYTLVSSEEADTDAGKISVRSPVGRSLIGKTVGAKV
GREA_MYCHJ      ISKAKIIKAD-LGSSRVSIGSKVSLENVESGEIQTFQIVSSIDADPFKSKISNFSPIAQALLGQHQGDEV
GREA_MYCH7      ISKAKIIKAD-LGSSRVSIGSKVSLENVESGEIQTFQIVSSIDADPFKSKISNFSPIAQALLGQHQGDEV
GREA_MYCH2      ISKAKIIKAD-LGSSRVSIGSKVSLENVESGEIQTFQIVSSIDADPFKSKISNFSPIAQALLGQHQGDEV
GREA_CLOPH      LKNAXXXXXXXXXXXTVNIGCLVRILDMEFNDELEYKIVGSTEANSLKGKISNESPVGKALIGARKDDVI
GREA_BLOPB      LFNAHIIDTKLTTDDKVVFGATVGVENLDTTYRQTYSIVGDDEANLKEHMISINSPIARGLIGHKEGDIV
GREA_PSYIN      LSNARIIDITNITNNKVIFGATVTIVNVETDAEVTYKIVGDDEANIKINLISVSSPLARGLIGKTLDDEI
GREA_PSEPK      LQNSVVIDVTTIPHTKVIFGTTVVLANTETDEEVTYQIVGEDEADVKQGKLSSGAPIARAIIGKEEGDTV
GREA_PROVI      LSSATILDPKHIKTDKVYILTSVELLNLDDKKETLYTLVSSEESDSDLGKISVRSPVGRALIGKAVGDKV
GREA_ACIBS      LGTAQVIAKDLEQNGRVVFGVTVTIENLDTEERNTYKIVGDDEADFKINKISVNSPIALGLLGKKEGDEV
GREA_VEREI      LSVAQVIDPGEVGGGKVVFGATVQLEDEESGDTVTYQIVGEDEADLKQGLINISSPIARALIGKEEGDTA
GREA_CHLPB      LTRATILDPKQVKTDRVYILTSVKLKNLDAQKEEIYTLVSSDEADTDLGKISVRSPVGKSLLGKAVGDKV
GREA_CAUCR      IARAQVIDVTKLSGKQVKFGAXXXXXXXXXXXXARYQIVGDHEADVKSGRISLSSPLSRAMIGKEVGEVV
GREA_CAUCN      IARAQVIDVTKLSGKQVKFGAXXXXXXXXXXXXARYQIVGDHEADVKSGRISLSSPLSRAMIGKEVGEVV
GREA_PSESM      MQNAVVIDVTTIAHTKVIFGTTVEIANVETDESVVYQIVGEDEADIKKGKISVGSPIARALIAKEEGDVV
GREA_PELPB      LASATILDPKQIKTDKVYILTSVKLKNLDTPDEIIYTLVSSEEADTDSGKISVRSPVGRALIGKAVGEKV
GREA_NOVAD      VSRAQIIDPTTLSGDKIIFGATVTL--LDDDEKPVYQIVGPYEADAKKGMISYNSPLGKALIGRKVDEEI
GREA_OCHA4      VARAEIIDVSKLSGDRIKFGATVTMIDEDTDEEKVYQIVGDQEADVKEGRISISSPIARALIGKGEGDTI
GREA_MYCCT      INRAKVINSKTHSTGEVKIGSTVEFLSSLDHKTKEIKIVGAIEADPFSRLISNESPIAKAILGKKIGDTV
GREA_DESVV      MAQFNVIDLDTISGDKVMFGATVKIEDLESGEEKEYTLLGPDEADYAKGSISVQSPVARAMLGKEEGDEI
GREA_DESVH      MAQFNVIDLDTISGDKVMFGATVKIEDLESGEEKEYTLLGPDEADYAKGSISVQSPVARAMLGKEEGDEI
GREA_CHLL2      LSTATILDPKLIKTDKVYILTSVKLKNLQEDEVIEYTLVSSEEADTDLGKISVRSPVGRSLIGKTVGDKV
GREA_SILPO      LSLADVIDPTKLS-GAIKFGARVTLVDEDTDEEKTWQIVGEHEANIEKGLLNIKSPIARALIGKDEGDSV
GREA_NAUPA      LSRAVVVDPKEHAHNRVAFGSTVYLIDVDTDEKEKYTIVGAPEANPDKGLISYHSPLAKALIGKEVGDEV
GREA_MESFL      ISKAKLIEDSSTTDGAIKIGSKVKFIMLNTKQTREVKIVGAVEADPFKGLISNESPIAKAILGKKVGESV
GREA_VIBVU      LSVAQVIDVSKMENNKVIFGATVTLIDCDTEEEKTYQIVGDDEADIKSGRISVNSPIARGLIGKMEGDEV
GREA_ZYMMO      LSRALVIDPKTLSGDKVIFGATVHL--LDEDDKPVYQIVGQTEANAKGGRISYNSPLGRALIGRKVDDEI
GREA_SYNAS      LALSNVIDLKMLSDDRIVFGATVIIEEASTGKQTNYQLVGPFESNISENKISVTSPIGKALIGKSIGDEV
GREA_GRAFK      VANARVIDESQLDTSKVLVHSHVKIKNQTNGAEMTYKLVAQSEADLKSGKISVDSPIGKGLLGKKVGDTA
GREA_DESVM      MAQFNVINLDSLSGDKVMFGATVEIEDLDSGEAKRYTLLGPDEADYAQGTISVLSPVARALLGKEEGDEI
GREA_CAMJJ      LARAQVIDPSSYEHDSVKFGSSVVIIDLDTEKESKYTLVGICEGDLDKGYISIASPIAKAMLGKKEGDDF
GREA_CAMJD      LARAQVIDPSSYEHDSVKFGSSVVIMDLDTEKESKYTLVGICEGDLDKGYISIASPIARAMLGKKEGDDF
GREA_BUCAP      LSNSQIIDITKISNDRVVFGSTVTILNIKNNAVFTYQIVGDDESDFKKNLISINSPMSRGLIGKTVNTIA
GREA_VIBCH      LSVAQVIDVTKMENSKVIFGATVTVIDVNSDEEKTYQIVGDDEADIKSGRISVNSPIARGLIGKFEGDEV
GREA_BRUSU      VARAEVIDVSKLTGDRIKFGATVTMIDEDTEEEKIYQIVGDQEADVKEGRISISSPIARALIGKGEGDTI
GREA_BRUSI      VARAEVIDVSKLTGDRIKFGATVTMIDEDTEEEKIYQIVGDQEADVKEGRISISSPIARALIGKGEGDTI
GREA_BRUME      VARAEVIDVSKLTGDRIKFGATVTMIDEDTEEEKIYQIVGDQEADVKEGRISISSPIARALIGKGEGDTI
GREA_BRUMB      VARAEVIDVSKLTGDRIKFGATVTMIDEDTEEEKIYQIVGDQEADVKEGRISISSPIARALIGKGEGDTI
GREA_BRUC2      VARAEVIDVSKLTGDRIKFGATVTMIDEDTEEEKIYQIVGDQEADVKEGRISISSPIARALIGKGEGDTI
GREA_BRUAB      VARAEVIDVSKLTGDRIKFGATVTMIDEDTEEEKIYQIVGDQEADVKEGRISISSPIARALIGKGEGDTI
GREA_BRUA2      VARAEVIDVSKLTGDRIKFGATVTMIDEDTEEEKIYQIVGDQEADVKEGRISISSPIARALIGKGEGDTI
GREA_BRUA1      VARAEVIDVSKLTGDRIKFGATVTMIDEDTEEEKIYQIVGDQEADVKEGRISISSPIARALIGKGEGDTI
GREA_POLNA      LSAAQVIDPTTFTGTRVVFGSTVKLEDEATGDSVTYQIVGEDEADIKLGLVNIGSPIARALIGKDEGDSA
GREA_ORITB      LANAEVIEITKINSNSVKFGARVVLLDLDTEKEVVYQIVGEYEADITQNLISIASPIAQALIGKKAGDII
GREA_CAMJR      LARAQVIDPSSYEHDSVKFGSSVVIMDLDTEKESKYTLVGICEGNLDKGYISIASPIAKAMLGKKEGDDF
GREA_CAMJE      LARAQVIDPSSYEHDSVKFGSSVVIMDLDTEKESKYTLVGICEGNLDKGYISIASPIAKAMLGKKEGDDF
GREA_CAMJ8      LARAQVIDPSSYEHDSVKFGSSVVIMDLDTEKESKYTLVGICEGNLDKGYISIASPIAKAMLGKKEGDDF
GREA_AGRRK      TARAEVIDLTKMSGSKIKFGAKVKLIDEDTEEEKSYQIVGDQEADVKAGRISISSPIARALIGKEVGDSI
GREA_WIGBR      LMHSKIIDIKKIPRDRVVFGSTITIKNLKTLEEKTYKIVGDDEANFKNNLISISSPLSRGLIGKKTLEIV
GREA_NITSB      LARAQVIDPSKLPHDKVGFGSTVKLLDXXXXXXXXYTIVGSTESNPEHGLISYNTPLARQLIGKEEGDEI
GREA_CAUSK      IARAQVIDVSKLSGKQVKFGAXXXXXXXXXXXXXRYQIVGDHEADVKEGRISLSSPLSRAMIGKEVGEVV
GREA_RHILW      TARAEVIDLTKMSGDKIKFGAKVKLVDEDTEEEKTYQIVGDQEADVKAGRISISSPIARALIGKEVGDSI
GREA_BEII9      LSRAEIIDVSKLSGNTVMFGAXXXXXXXXXXXXKIYQIVGESEADVKAGRVSITSPTARALIGKKIGDSV
GREA_AGRT5      TARAEVIDLSKMSGSKIKFGATVKLIDEDSDEEKTYQIVGDQEADVKAGRISISSPIARALIGKEVGDSI
GREA_RHILV      TARAEVIDLTKMSGDKIKFGAKVKLIDEDTEEEKTYQIVGDQEADVKAGRISISSPIARALIGKEVGDSI
GREA_RHIL3      TARAEVIDLTKMSGDKIKFGAKVKLIDEDTEEEKTYQIVGDQEADVKAGRISISSPIARALIGKEVGDSI
GREA_ORITI      LANAEVIEITKINSNSVKFGARVVLLDRDTEKEVVYQIVGEYEADITQNLISIASPIAQALIGKKAGDII
GREA_DESAD      IPQFNVVDMTTLGGEKITFGATVTLEDIDTGAEKTYTIMGPDESDFKKGIISIESPVGKALLGKIEGDEV
GREA_THICR      LGSVQIIDVTKLNPNKVVFGSTVTILNVDTEEEVTYKIVGEEEADIKHNKISVNSPIARALIAKEEGEEI
GREA_AGRVS      TARAEVIDLSKMSGSKIKFGATVKLIDEDTDEEKIYQIVGDQEADVKAGRISISSPIARAMIGKEAGDSI
GREA_SALTY      LSNAQVIDVTKMPNNRVIFGATVTVLNLDTDEEQTYRIVGDDEADFKQNLISVNSPIARGLIGKEQDDVV
GREA_SALTI      LSNAQVIDVTKMPNNRVIFGATVTVLNLDTDEEQTYRIVGDDEADFKQNLISVNSPIARGLIGKEQDDVV
GREA_RHIEC      TARAEVIDLTKMSGDKIKFGAKVKLVDEDTEEEKTYQIVGDQEADVKAGRISISSPIARALIGKEVGDSI
GREA_RHIE6      TARAEVIDLTKMSGDKIKFGAKVKLVDEDTEEEKTYQIVGDQEADVKAGRISISSPIARALIGKEVGDSI
GREA_SHIFL      LSNAQVIDVTKMPNNRVIFGATVTVLNLDSDEEQTYRIVGDDEADFKQNLISVNSPIARGLIGKEEDDVV
GREA_ECOLI      LSNAQVIDVTKMPNNRVIFGATVTVLNLDSDEEQTYRIVGDDEADFKQNLISVNSPIARGLIGKEEDDVV
GREA_ECOL6      LSNAQVIDVTKMPNNRVIFGATVTVLNLDSDEEQTYRIVGDDEADFKQNLISVNSPIARGLIGKEEDDVV
GREA_ECO57      LSNAQVIDVTKMPNNRVIFGATVTVLNLDSDEEQTYRIVGDDEADFKQNLISVNSPIARGLIGKEEDDVV
GREA_SINMW      IARAEVIDLSKMSGSKIKFGARVKLVDEDTEEEKTYQIVGDQEADVKQGRISISSPIARALIGKEVGDSI
GREA_RHIME      IARAEVIDLSKMSGSKIKFGARVKLVDEDTEEEKTYQIVGDQEADVKQGRISISSPIARALIGKEVGDSI
GREA_UREPA      XXXXXXXXDVLRSTDEVSIGSTIEIYNYQKDCEEVITLVGSMDSDPFANKISIDTPLGKALVKQKKGTEV
GREA_UREP2      XXXXXXXXDVLRSTDEVSIGSTIEIYNYQKDCEEVITLVGSMDSDPFANKISIDTPLGKALVKQKKGTEV
GREA_PETMO      LDNAEIINGGNHDNSTVSLGKKVKIKDYRLNREQEFVLVTPQEANIEENKISIESPIGRSLLGRKKGEVI
GREA_MAGSM      LASAEVIDTSRLNSSRIVFGAKVTVIDEDTEEESTYHIVGDEEADLEKGKISISSPMARGMIGKEAGDSI
GREA_MYCMS      INRAKVIDSKTHSTGEVKIGSTVQFVSSLDNKLKEIKIVGAIEADPFSNLISNESPIAKAIIGKKVNTTV
GREA_WOLSU      LSRTQVVDPATITHEKISFGSTFKVMDLDTEFVYEYTIVGAPESNPDRGFISFYSPLARQLIGKVPGDEI
GREA_UREU1      XXXXXXXXDVMRSTDEVSIGSTIEIYNYQKDHKEVITLVGSMDSDPFANKISMDTPLGKAVVKQKEGSEV
GREA_SYNFM      MGECEIVEPSDNDNGRAIFGSXXXXXXXXXXXXXSYRLVGPYEADVQSGTISVVSPLGKALIGKEEGEEI
GREA_PELUB      IARANVIDVTKMSNDKVIFGSTVDLENLDTGEKITYKIVGKDEADLQKKLIFFQSPIGRGLIGKNKNDLV
GREA_DESPS      LGRAEVIDCLQVSCKRVVFGTVVVLLDLDTDEEVTYQLLGPEESEVKAGSISVLSPIGRSMLSKEEGDEV
GREA_ARCB4      ISKAVIIDPTTLPHDRVSFGSTIDLVDVDTDEEFTYTIVGGVESSAEKGMISFNSPLAKQLMGKEAGDEL
GREA_NEOSM      LSEAEVIDVSQFTGERVKFGASVTLENMESKSVLIYQIVGNLESDIKEGKISVSSPIGKAVMNKEVGEIV
GREA_FRATW      LSNAQVIDVTKIANGMVIFGATVTIMNVDTEEETTYKIVGEDEADIDNQKISVVAPLARALIKKEEGDEI
GREA_FRATT      LSNAQVIDVTKIANGMVIFGATVTIMNVDTEEETTYKIVGEDEADIDNQKISVVAPLARALIKKEEGDEI
GREA_FRATO      LSNAQVIDVTKIANGMVIFGATVTIMNVDTEEETTYKIVGEDEADIDNQKISVVAPLARALIKKEEGDEI
GREA_FRATN      LSNAQVIDVTKIANGMVIFGATVTIMNVDTEEETTYKIVGEDEADIDNQKISVVAPLARALIKKEEGDEI
GREA_FRATM      LSNAQVIDVTKIANGMVIFGATVTIMNVDTEEETTYKIVGEDEADIDNQKISVVAPLARALIKKEEGDEI
GREA_FRATH      LSNAQVIDVTKIANGMVIFGATVTIMNVDTEEETTYKIVGEDEADIDNQKISVVAPLARALIKKEEGDEI
GREA_FRATF      LSNAQVIDVTKIANGMVIFGATVTIMNVDTEEETTYKIVGEDEADIDNQKISVVAPLARALIKKEEGDEI
GREA_FRAT1      LSNAQVIDVTKIANGMVIFGATVTIMNVDTEEETTYKIVGEDEADIDNQKISVVAPLARALIKKEEGDEI
GREA_THESQ      ILXXXXXXXXXXXXXXITLGKWVVIRNLDTGEEHKFRIVTPQEADFFAQKLSSDSPLGKSLLGRKVGDVV
GREA_THEP1      LSNAXXXXXXXXXXX-VTLGKWVVIKNLDTGEEHKFRIVTPQEADFFAQKLSSDSPLGKSLLGRKVGDVV
GREA_THEMA      LSNAXXXXXXXXXXX-VTLGKWVVIKNLDTGEEHKFRIVTPQEADFFAQKLSSDSPLGKSLLGRKVGDVV
GREA_SULNB      VGRAQVVDPSTFSHDRVSFGSTVVLVDQDTDEEVRYTIVGGQESNPQSGLISIQSPMARVLIGKEEGDEV
GREA_FRAP2      LSNAQVIDVTKLANGMVIFGATVTVINVDTEEETTYQIVGEDEADIDNHKISVVAPLARALIKKEVGDEI
GREA_BUCAT      LSNSQIIDVTKISNNRVIFGSTVSILNIKNNEKFTYRIVGDDESDFKKNLISINSPIARGLIGKEINDVV
GREA_BUCAI      LSNSQIIDVTKISNNRVIFGSTVSILNIKNNEKFTYRIVGDDESDFKKNLISINSPIARGLIGKEINDVV
GREA_BUCA5      LSNSQIIDVTKISNNRVIFGSTVSILNIKNNEKFTYRIVGDDESDFKKNLISINSPIARGLIGKEINDVV
GREA_AMOA5      MINARVINKDNINTSAXXXXXXXXXXXXXXXXXXTYTMVSEEEADLKEGKISIESPIGKGLLGKKAGEVA
GREA_THERP      XXXXXXXXQPTDGDRSVVVGSTVTIEIDGEIE--TYTIVGAIEAKPSAGRISNESPVGRALLGHRAGEIV
GREA_MYCGE      LANAKLI-SDHQAKTKVSLGSTVEIYDYSSKSNEKYTIVGTLEANPEEHKISNESPLALAIYGRLIGDEC
GREA_BUCCC      LLRAQIIDITKIPFKGIVIGSTVTVLQISTSNIFVYTIVGDDEANYKEFSISIHSPMSRALIGKKKNDII
GREA_FLAJ1      YANARLIDESQLDVSKVLVLSNVKIKNQSNGMEMKYTLVAESEADLKTGKISVTSPIGKGLLGKSVGEIA
GREA_MYCPU      LSNA--ISIQESHSDKIGLGSVVRILNQSTGKERTFKIVGSFDTDPTQNKISYESPLAKSIIGFSKGDVV
GREA_MESSB      IARAEVIDVTKLSGDTVKFGAXXXXXXXXXXXXKTYQIVGDQEADVKSGRISISSPIARALIGKGVGDLI
GREA_ACHLI      LKNVKIINDDSTT---VNIGKKVLLHFVEKNKDVEYHVVGTIEADPKNFKISIESPLGRAIKGKEVGDLV
GREA_MYCGA      LNHYEIIKEVDTKNKRVIVGAKVTIHDHSDECNYTYEIVGPIESDPAENKISHESPVAKAIMDKKEGESA
GREA_DESMR      MSRFNVIDLATLGGEQVIFGATVEIEDVDTGDVKKYTLLGPDEAEPSKGSISLLSPVGLALLGKFVGDEI
GREA_MYCPN      LANVKLINSQTKKANKVTLGSTVEIYDYSSKTHEKYTIVGALEANPEEHRISNESPLAHAIYGRLVDDEC
GREA1_LACPL     LQYAQIVQP--ADNDQLDIGKFVTIEFLDDHDQITYQLVGKQEANLEQQKISFTSPIGQALANHTVDDVV
GREA_ACICJ      XXXXXXXDPSTLSGDTVKFGAHVELIDEESDKEVTYQIVGVHEADIKAGRISVTSPLAKSLIGKKPGDTV
GREA_THEM4      LSKAEVI--EGLDTNVINIGNWVIIKNLETGEEKTIQIVTPHEADVFNNKISFESPIGRILXXXXXXXXX
GREA_FLAPJ      YSNARLIDESQLDVSKALVLSHVKIKNQSNGMEMSYHLVAESEADLKTGKISVTSPIGKGLLGKSVGEIA
GREA_DEHE1      LKYADVSEYTDTNTSKVNMGSTVKLRDPKNGECCTYTLVSPKEIEPLKGKISASSPIGKAVFNRNKGEQI
GREA_CHLT3      LSTATILDEKDIKTDKVYILTTVLLKDLDRDEEVEYTLVSSEEADSENGKISVKSPIGKNLLGKSVGEIV
GREA_THEAB      LSKAEVI--EGLDTNVINIGNWVLIKNLDTGEEKTIQIVTPHEADVFNNKISFESPIXXXXXXXXXXXXX
GREA_PROA2      LTRASILDPKQIRTDRVYILTSVKLRNLDETDDEIYTLVSSEEADTDQGKISVRSPVGKALIGKAVGEKV
GREA_MYCAP      XXXXXXXDTKSAVQNKAGIGATVRYLNMKTNKELVVTIMGPHDSNPIENKISNESPVAQAIMANGIGDVV
GREA_TREPS      IERAQVFDPTTVVAGRVSFGTVISLKNHTSGEDETYTILGPWESAPERGIISYMSPLGSNLLNRKTGE--
GREA_TREPA      IERAQVFDPTTVVAGRVSFGTVISLKNHTSGEDETYTILGPWESAPERGIISYMSPLGSNLLNRKTGE--
GREA_SACEN      LRTAKV--GDVPTEAGVAPGSVLTVRYDDEDETEKFLLTREEGAHGDLEVYSPSSPLGQALLDAKEGETR
GREA_BORBU      IENAKVIDTKDLQSSVVGFGTKVVILNEVTGKDESYLILGPWESNPDEGIISYKSPFGENLLDSREGDSL
GREA_STRCO      LESAKVGEAPA-ADGVVAPGMVVTIAFDGEDDTLTFLLASREYASSDIETYSPQSPLGSGVLGHKVGDDA
GREB_YERPE      LEVLKIVDPDPRQEGKVFFGAWVRVEN-EQEEQRIFRLVGPDEFDPAKKWISIDSPVARALIGKQVDDEV
GREB_PSEAE      LENLKVVGERPADPNRVYFGAWVTLED--EDGEQAYRIVGPDELDLRNNQISIDSPLARALVGKELDAEV
GREA_CHLPN      INRARILTKDLVFTDKVGVGCKVTLKDAGEVVE--YTILGPWDADPDSCILSLQSKLAQNMLGKKLNDVV
GREA_CHLTR      INRAKILTKDAVFTDSVGVGCKVVL-ESDQGDKVCYTILGPWDANPDEKILSLKSKLAQEMVGKAVGETV
GREB_NEIMA      LEAAVVVDPELEATDQVFFGATVGLLR-GDGREQTVKIVGIDEIDTAQNKISWISPLARCLIKAREGDEV
GREA_CHLMU      INRAKILTKDAVFTNSVGVGCKVVLED-EQGEEDCYTILGPWDANPEEKILSLKSKLAQEMVGKTVGESV
GREB_PASMU      LEVLQIVDYHPKQEGKVFFGAWVALEEAGEEKH--YRIVGCDEFDPAKNWISIDSPVARALIGKSIDDEI
GREA_STRAW      LENAKVGEAPA-ADGAVAPGMVVTIAFDGDEDDTLFLLASREYASADIETYSPQSPLGSGVNGKKVGEDA
GREB_HAEIN      LEVLQIVDYNPKQEGKVFFGAWVEL-ENEEGETKQYRIVGCDEFAPAKNWISIDSPVARALIGKTLDDEV
GREB_NEIMB      LEAAVVVDPELEATDQVFFGATVGLLR-DDGREQTVKIVGIDEIDTAQNKISWISPLARCLIKAREGDEV
GREB_SALTY      MENLKIVDYSPQQEGKVFFGAWVEIENDDGDRLKFRIV----GYDEIFGRISIDSPMARALLKKEVGDLA
GREB_SALTI      MENLKIVDYSPQQEGKVFFGAWVEIENDDGDTLKFRIV----GYDEIFGRISIDSPMARALLKKEVGDLA
GREA_RHOE4      LNSAKV--GEAPTQSGVALGSVVKVYYDGDDTETFLIATREEGADAKLEVYSPNSPLGGALLEAKVGDTR
GREA_MYCTU      LSNAKV--GEAPKQSGVALGSVVKVYYNGDKSDSETFLIATRQEGVSDGKLSPNSPLGGALIDAKVGETR
GREA_MYCTA      LSNAKV--GEAPKQSGVALGSVVKVYYNGDKSDSETFLIATRQEGVSDGKLSPNSPLGGALIDAKVGETR
GREA_MYCBT      LSNAKV--GEAPKQSGVALGSVVKVYYNGDKSDSETFLIATRQEGVSDGKLSPNSPLGGALIDAKVGETR
GREA_MYCBP      LSNAKV--GEAPKQSGVALGSVVKVYYNGDKSDSETFLIATRQEGVSDGKLSPNSPLGGALIDAKVGETR
GREA_MYCBO      LSNAKV--GEAPKQSGVALGSVVKVYYNGDKSDSETFLIATRQEGVSDGKLSPNSPLGGALIDAKVGETR
GREB_PSEPK      LEDVKVVAYSPEQEGKVFFGAWVEI-ENDEGETMKFRIVGYDEIYGRNDYISIDSPMARALLKKEEGDEV
GREB_ECOLI      LENLKIVDYSPQQEGKVFFGAWVEI----ENDDGVTHRFRIVGYDEIFGRISIDSPMARALLKKEVGDLA
GREB_XANCP      LEALRVVDTAPTDPQAVFFGAQVELEDADSGELLRYRIVGPDETDAGRGWISIDSPLARALLKKRVDDEF
GREB_ECOL6      MENLKIVDYSPQQEGKVFFGAWVEI----ENDDGVTHRFRIVGYDEIFGRISIDSPMARALLKKEVGDLA
GREB_ECO57      MENLKIVDYSPQQEGKVFFGAWVEI----ENDDGVTHRFRIVGYDEIFGRISIDSPMARALLKKEVGDLA
GREA_MYCA9      LNNAKV--GEAPTQSGVALGSVVKVYYDGDKGDTETFLIATRQEGVKDGKLSPSSPLGGALIDAKVGETR
GREB_HAEDU      LEALQIIDYHPQQAGKVFFGAWIELEN-NEGEINQYRIVGCDEFDPTKNWISIDSPVARALIGKCVDDEI
GREA_MYCS2      LNNAKV--GEAPKQSGVALGSVVKVYYDDDENDTETFLIATRQEGISDGKLSPNSPLGGALLDAKVGESR
GREA_MYCLE      LNIAKV--GEAPKQSGVALGSVVKVYYNDDKSDTETFLIATRQEGVNEGKLSPNSPLGGALIDAKVGETR
GREA_MYCLB      LNIAKV--GEAPKQSGVALGSVVKVYYNDDKSDTETFLIATRQEGVNEGKLSPNSPLGGALIDAKVGETR
GREB_PSESM      LEDMRVVQYSPEQEGRVFFGAWVEIENEAGDLKKFRVV----GYDEIYGRISIDSPMARALLKKEVGDEV
GREA_MYCVP      LNNAKV--GEAPKQSGIALGSVXXXXXXXXXXXXXXFLIGTREQGVSDGKLSPNSPLGGALIDAKVGESR
GREB_VIBVY      LPEVKIVDYAPQQEGKVFFGAWVEIEEAGEGPEEIY---GDA-----KGYISIDSPMARALLKKEVDDEV
GREB_VIBVU      LPEVKIVDYAPQQEGKVFFGAWVEIEEAGEGPEEIY---GDA-----KGYISIDSPMARALLKKEVDDEV
GREB_XANAC      LEALRVVDTAPTDANAVFFGAQVELEDAGSGELLRYRIVGPDETDAGRGWISIDSPLARALLKKRVDDEF
GREB_VIBCH      LPELKIVDYSPQQEGKVFFGAWVEIEEAGEVKK--FRIVGPEEIYGDADYISIDSPMARALLKKQVDEEF
GREB_VIBPA      LPEVTIVDYSPQQEGKVFFGAWVEIENEAGDVKKFRIVGPEEIYGDAKDYISIDSPMARAMLKKQVDEEF
Y3817_MYCBO     LRTGPTPWSGS---ETLPGGTEVTLRFPDGEVVTMHVIVEETPVGREAETLTARSPLGQALAGHQPGDTV
Y3788_MYCTU     LRTGPTPWSGS---ETLPGGTEVTLRFPDGEVVTMHVIVEETPVGREAETLTARSPLGQALAGHQPGDTV
CATB_ACIAD      ---CAIENTDALARLTARFDVAIMADEVLTGPDSAYRIAKKSGADVFAVKVEQSGGLIEALAGISLYGGT
RNK_SHIFL       LDRAQMCSPEEMPHDVVTMNSRVKFRNLSDGEVRVRTLVYPAKMTDSNTQLSVMAPVGAALLGLRVGDSI
RNK_ECOLI       LDRAQMCSPEEMPHDVVTMNSRVKFRNLSDGEVRVRTLVYPAKMTDSNTQLSVMAPVGAALLGLRVGDSI
RNK_ECOL6       LDRAQMCSPEEMPHDVVTMNSRVKFRNLSDGEVRVRTLVYPAKMTDSNTQLSVMAPVGAALLGLRVGDSI
RNK_ECO57       LDRAQMCSPEEMPHDVVTMNSRVKFRNLSDGEVRVRTLVYPAKMTDSNTQLSVMAPVGAALLGLRVGDSI


                         +         .         .         .         .         *         .:210
query           TIETPVGSYDVKILKVEKTA
GREA_STRZT      TIETPVGSYDVKILKVEKTA
GREA_STRZP      TIETPVGSYDVKILKVEKTA
GREA_STRZJ      TIETPVGSYDVKILKVEKTA
GREA_STRR6      TIETPVGSYDVKILKVEKTA
GREA_STRPJ      TIETPVGSYDVKILKVEKTA
GREA_STRP7      TIETPVGSYDVKILKVEKTA
GREA_STRP4      TIETPVGSYDVKILKVEKTA
GREA_STRP2      TIETPVGSYDVKILKVEKTA
GREA_STRPN      TIETPVGSYDVKILKVEKTA
GREA_STRPI      TIETPVGSYDVKILKVEKTA
GREA_STRSV      TVETPVGSYDVKILKVEKT-
GREA_STRGC      TVETPVGSYDVKILKVEKT-
GREA_STRMU      MIESPAGSYQVEIVKVKKT-
GREA_STRPG      RIESPAATYDVEIISVEKT-
GREA_STRP8      RIESPAATYDVEIISVEKT-
GREA_STRP6      RIESPAATYDVEIISVEKT-
GREA_STRP3      RIESPAATYDVEIISVEKT-
GREA_STRP1      RIESPAATYDVEIISVEKT-
GREA_STRTD      AIESPAGSYSVEILSVEKTS
GREA_STRSY      TIETPAGSYDVKILKVEKT-
GREA_STRS2      TIETPAGSYDVKILKVEKT-
GREA_STRT2      AIESPAGSYSVEILSVEKTS
GREA_STRT1      AIESPAGSYSVEILSVEKTS
GREA_STRA5      TIESPAGSYQVEIISVEKT-
GREA_STRA3      TIESPAGSYQVEIISVEKT-
GREA_STRA1      TIESPAGSYQVEIISVEKT-
GREA_STRU0      DIVSPATTYQVEIISVEKT-
GREA_LACLS      NVPLPVGEMTVKIVKVD---
GREA_LACLA      NVPLPVGEMTVKIVKVD---
GREA_LACLM      DVPLPVGEMTVKIVKVD---
GREA_LACF3      EIEIPNGSMKVKILSVK---
GREA_LEUMM      AVPLPNGSIDVEIINVTK--
GREA_BACCR      TIQTPGGEMQVEIVSVK---
GREA_BACCN      VIQTPGGEMQVEIISVK---
GREA_BACCQ      AIQTPGGEMQVEIISVK---
GREA_BACC7      AIQTPGGEMQVEIISVK---
GREA_BACC1      AIQTPGGEMQVEIISVK---
GREA_GEOTN      TVQTPGGEMLVKIVAVK---
GREA_BACHK      AIQTPGGEMQVEIISVK---
GREA_BACCZ      AIQTPGGEMQVEIISVK---
GREA_BACAN      AIQTPGGEMQVEIISVK---
GREA_BACAC      AIQTPGGEMQVEIISVK---
GREA_BACAA      AIQTPGGEMQVEIISVK---
GREA_GEOKA      TVQTPGGEMLVKIVAVK---
GREA_LISW6      TIQTPAGDMNVKIEKI----
GREA_LISMO      TIQTPAGDMSVKIEKI----
GREA_LISMH      TIQTPAGDMSVKIEKI----
GREA_LISMF      TIQTPAGDMSVKIEKI----
GREA_LISMC      TIQTPAGDMSVKIEKI----
GREA_LISIN      TIQTPAGDMSVKIEKI----
GREA_BACSU      TVQTPGGEMLVKIVKI----
GREA_LEUCK      SVPLPSGSIDVEILKVEK--
GREA2_LACPL     AINIPAGTMTVKILKVE---
GREA_MACCJ      NVPLPNGNMRVKIVEI----
GREA_BACA2      TVQTPGGEMLVKIVKI----
GREA_BACP2      TVQTPGGEMFVQIVKI----
GREA_OCEIH      TVTTPGGDIDVRITNVE---
GREA_BACSK      VVNTPGGEMEVEILEI----
GREA_STAS1      RVPLPGGEINVKIVNIK---
GREA_STAHJ      RVPLPGGEINVKIVNIK---
GREA_STACT      RVPLPNGAIKVKITNIQ---
GREA_STAES      RVPLPGGEMNVKIVEIK---
GREA_STAEQ      RVPLPGGEMNVKIVEIK---
GREA_OENOB      EIPLPENSVTVEILHVSK--
GREA_BACLD      TVQTPGGEMLVKIVKI----
GREA_THEPX      SVEVPAGIIKLKILEIRK--
GREA_THEP3      SVEVPAGIIKLKILEIRK--
GREA_STAAW      RVPLPGGEMNVKIVNIQ---
GREA_STAAT      RVPLPGGEMNVKIVNIQ---
GREA_STAAS      RVPLPGGEMNVKIVNIQ---
GREA_STAAR      RVPLPGGEMNVKIVNIQ---
GREA_STAAN      RVPLPGGEMNVKIVNIQ---
GREA_STAAM      RVPLPGGEMNVKIVNIQ---
GREA_STAAE      RVPLPGGEMNVKIVNIQ---
GREA_STAAC      RVPLPGGEMNVKIVNIQ---
GREA_STAAB      RVPLPGGEMNVKIVNIQ---
GREA_STAA9      RVPLPGGEMNVKIVNIQ---
GREA_STAA8      RVPLPGGEMNVKIVNIQ---
GREA_STAA3      RVPLPGGEMNVKIVNIQ---
GREA_STAA2      RVPLPGGEMNVKIVNIQ---
GREA_STAA1      RVPLPGGEMNVKIVNIQ---
GREA_BACHD      IVNTPGGEMEVKILEI----
GREA_THETN      SVEVPAGVIKLKILEIRR--
GREA_FINM2      KVETPGGIVELKVLTVKK--
GREA_CLOBH      EVAVPDGVSKYEILEVNR--
GREA_CLOB1      EVAVPDGVSKYEILEVNR--
GREA_CLOBM      EVTVPDGVSKYEILEVNR--
GREA_CLOBL      EVTVPDGVSKYEILEVNR--
GREA_CLOBK      EVTVPDGVSKYEILEVNR--
GREA_CLOBJ      EVTVPDGVSKYEILEVNR--
GREA_CLOB6      EVTVPDGVSKYEILEVNR--
GREA_CLOPS      EIEVPGGTTKFEVLGIRR--
GREA_CLOPE      EIEVPGGTTKFEVLGIRR--
GREA_CLOP1      EIEVPGGTTKFEVLGIRR--
GREA_CLONN      NVPVPDGISKFEILEI----
GREA_CLOB8      EVTVPDGVNKFEILGISRS-
GREA_CLOTH      EVTVPDGVIKFKILEIRK--
GREA_ALKOO      EVQIPDGVTKYEILKITR--
GREA_XYLFT      VIEAPAGRREYEVVAVE---
GREA_XYLFM      VIEAPAGRREYEVVAVE---
GREA_XYLF2      VIEAPAGRREYEVVAVE---
GREA_ROSCS      TVETPSGTMKLTILNIQ---
GREA_PELPD      KVKVPAGTKEYEIIDIK---
GREA_BARQU      EVNAPGGAHNYEIIKVQ---
GREA_RHOPT      EVVAPGGAKAYEIAKVE---
GREA_RHOPA      EVVAPGGAKAYEIAKVE---
GREA_PHEZH      EVNTPGGVKAYEITKVE---
GREA_NITWN      EVVAPGGAKAYEIAKVE---
GREA_XYLFA      VIEAPAGRREYEVVAVE---
GREA_NITHX      EVVAPGGAKAYEITKVE---
GREA_CLOK5      EIQVPDGVSKYKILNIRR--
GREA_CLOK1      EIQVPDGVSKYKILNIRR--
GREA_CLOAB      EVNVPDGVDKYKILAIK---
GREA_SYNWW      SVEAPAGTIKYKIIKVEK--
GREA_RUTMC      TVKAPKGDIVYEVLSVE---
GREA_BRASB      EVMAPGGAKSYEIAKVE---
GREA_XANAC      TIDAPAGQREYEVVSV----
GREA_ROSS1      TVETPSGTMKLTIVDIQ---
GREA_BRAJA      EVNAPGGAKAYEITKVE---
GREA_BAUCH      LIKTPRGEVKYQILKIE---
GREA_THEYD      TIKAPAKTFNYEIISI----
GREA_CHLAD      TVHTPSGVMKLTILKV----
GREA_RHORT      EVKAPGGSYEVTMVR-----
GREA_PELCD      RIKVPSG---LKIYEVVNIA
GREA_CLOBA      --------------------
GREA_BART1      EVNAPGGAHNYEIIKVQ---
GREA_CLOBB      --------------------
GREA_RICFE      EVTTPKGSKSYEVVTVE---
GREA_LEGPL      TVETPGGMVEYEIIQVQ---
GREA_LEGPH      TVETPGGMVEYEIIQVQ---
GREA_LEGPC      TVETPGGMVEYEIIQVQ---
GREA_LEGPA      TVETPGGMVEYEIIQVQ---
GREA_GEOLS      KVKVPAGT------------
GREA_BARBK      EVNAPGGAHNYEIIKIQ---
GREA_RHOPB      EVVAPGGAKAYEITKVE---
GREA_CHLSY      TVHTPSGVMKLTILKV----
GREA_CHLAA      TVHTPSGVMKLTILKV----
GREA_HELPY      SIQLPNGESDFEILDI----
GREA_HELPJ      SIQLPNGESDFEILDI----
GREA_CLOD6      EVQVPDGVAKFEILEIRR--
GREA_HELAH      SIQLPNGESDFEILDI----
GREA_BARHE      EVNAPGGAHNYEIIEVQ---
GREA_XANCP      TIDAPAGQREYEVVSV----
GREA_RHOP5      EVMAPGGAKAYEITKVE---
GREA_RHOBA      EVDVPAGKLKFKILKIE---
GREA_HELPS      SIQLPNGESDFEILDI----
GREA_RICCN      EVTTPKGSKSYEVVTVE---
GREA_PSYCK      RIETPKGVVEYEIMKV----
GREA_PSYA2      RIETPKGVVEYEIMKV----
GREA_HELPH      SIQLPNGESDFEILDI----
GREA_HELPG      SIQLPNGESDFEILDI----
GREA_HELP2      SIQLPNGESDFEILDI----
GREA_VESOH      IVKAPKGDIVYKILSVE---
GREA_CAMLR      KVRLPKGESEFEIISIEYKA
GREA_BUCBP      TIKTPVGDVKYKILKIE---
GREA_RHILO      EVNAPGGARGYEIVQVQ---
GREA_NEIMB      EVQAPGGVREYDIIEV----
GREA_ANASK      VVRSPGGEKEYEIQSV----
GREA_RICCK      EVTTPKGSKSYEVVEVEYKA
GREA_ALHEH      TVQAPGGEREYEIVEV----
GREA_NEIMA      EVQAPGGVREYDIIEV----
GREA_HELHP      SITLPNGENEFEILEV----
GREA_CAMHC      ILNLPNGVSEIEIVSVE---
GREA_MARMM      EVNAPGGLKSYEIMSV----
GREA_METCA      TVQAPGGTREYEIVSV----
GREA_SPHAL      EVTVPSGDKYYLVTKIE---
GREA_RHOSK      EVKTPGGERGYEVVSV----
GREA_RHOS4      EVKTPGGERGYEVVSV----
GREA_RHOS1      EVKTPGGERGYEVVSV----
GREA_CHLP8      TISVPKGELHYEILDI----
GREA_RICBR      EVMTPGGSYEVVTIKYEE--
GREA_RICB8      EVMTPGGSYEVVTIKYEE--
GREA_RICPR      EVTTPKGLKSYEVVTVE---
GREA_PASMU      VIQTPGGKVEFEILEVE---
GREA_HYPNA      --------------------
GREA_VIBPA      AIQTPGGAKDFEIDRVE---
GREA_METS4      EVTTPGGGKSYEIVGI----
GREA_HAEIN      NITTPGGVVEFDIIEV----
GREA_METNO      EVSTPGGGKSYEIVGI----
GREA_THISH      TVKAPGGDKDYEIVAVK---
GREA_THENN      KVKAPGGVQRYQVVEV----
GREA_RICTY      EVITPKGLKSYEVVTVE---
GREA_RHOS5      EVKTPGGERGYEVVSV----
GREA_SPHWW      EVTVPSGDRFYLVSKIE---
GREA_CHLTE      TISVPKGELHYEILDI----
GREA_YERPG      VIHTPGGEVEYEILSVE---
GREA_YERPE      VIHTPGGEVEYEILSVE---
GREA_RALSO      TVVAPGGEYEVRAVK-----
GREA_PSYWF      RIETPSGLVEFEIIEV----
GREA_PSEAE      LVRTPGGDVEYEIVEV----
GREA_PARDP      EVVTPGGGKSYEIISI----
GREA_MYCA5      EVEAP-NKYQVKIVHV----
GREA_HAEDU      SIITPGGKVEFDIISVE---
GREA_NITOC      QVQAPSG-------------
GREA_HAMD5      VIHTPGGEVEYEILDVK---
GREA_JANSC      EVRTPGGAKGFEIVKI----
GREA_HALHL      VVQAPGGERTYEIVEV----
GREA_AZOC5      EVVTPKGARSFEIVEV----
GREA_DESDA      SVEIPRGRVTYEIIGV----
GREA_CHLPD      QIMVPKGELHYEILEI----
GREA_CHLCH      TIVVPKGELHYEILEI----
GREA_MYCHJ      EVDVN-EKYSVRILEV----
GREA_MYCH7      EVDVN-EKYSVRILEV----
GREA_MYCH2      EVDVN-EKYSVRILEV----
GREA_CLOPH      EIEINGNSFKYKVLEIQKS-
GREA_BLOPB      RINTPKGKVRYKILQVK---
GREA_PSYIN      SIVTPGGTIDYEIISVQYIA
GREA_PSEPK      VVKTPSGTVEYEIVEVK---
GREA_PROVI      TIIVPKGELHYEVKKI----
GREA_ACIBS      KITTPQG-------------
GREA_VEREI      EVQAPSGIRRYEVVAV----
GREA_CHLPB      QIQVPKGELHYEILEI----
GREA_CAUCR      EVNTPGGVKAYEILKVE---
GREA_CAUCN      EVNTPGGVKAYEILKVE---
GREA_PSESM      VVKTPSGVIEYEIIEV----
GREA_PELPB      QIVVPKGELHYEILEI----
GREA_NOVAD      EVTVPSGDKFYLVQKIE---
GREA_OCHA4      EVNAPGGSRSYEIV------
GREA_MYCCT      EIKDILKPYKITIKSIK---
GREA_DESVV      VVDAPRGKIHYEIVSI----
GREA_DESVH      VVDAPRGKIHYEIVSI----
GREA_CHLL2      HITVPKGELHFEILDI----
GREA_SILPO      EVKTPGGQKSYEILSIE---
GREA_NAUPA      EVNLPGG---VKVYEIDK--
GREA_MESFL      EVKDINAPYSIEIKEV----
GREA_VIBVU      AISTPGGMKDFEIDSVE---
GREA_ZYMMO      EVSVPSGDRYYLISKIE---
GREA_SYNAS      KVHTPGGIRNFEVVDI----
GREA_GRAFK      EIEVPNGTVKFDVIEI----
GREA_DESVM      VVDAPRGRISYEIISV----
GREA_CAMJJ      KVRLPKGESEFEILSI----
GREA_CAMJD      KVRLPKGESEFEILSI----
GREA_BUCAP      IIHTPSGNVKYKILKID---
GREA_VIBCH      SIATPGGNKVFEIDRVE---
GREA_BRUSU      EVNAPGGSRSYEIIALK---
GREA_BRUSI      EVNAPGGSRSYEIIALK---
GREA_BRUME      EVNAPGGSRSYEIIALK---
GREA_BRUMB      EVNAPGGSRSYEIIALK---
GREA_BRUC2      EVNAPGGSRSYEIIALK---
GREA_BRUAB      EVNAPGGSRSYEIIALK---
GREA_BRUA2      EVNAPGGSRSYEIIALK---
GREA_BRUA1      EVNAPGGSRSYEIIALK---
GREA_POLNA      EVQAPGGIRRYEIVTV----
GREA_ORITB      EVITPKGGRFYELLKVQ---
GREA_CAMJR      KVRLPKGESEFEILSI----
GREA_CAMJE      KVRLPKGESEFEILSI----
GREA_CAMJ8      KVRLPKGESEFEILSI----
GREA_AGRRK      EVNAPGGAKAYEILSI----
GREA_WIGBR      NINTPSG-------------
GREA_NITSB      TVKLPKGEIDFEVLEV----
GREA_CAUSK      EVYTPGGVKAYEILKVE---
GREA_RHILW      EVNAPGGSKAYEILQV----
GREA_BEII9      EVNTPGGGKSYEILNV----
GREA_AGRT5      EVNAPGGAKGYEILAVQ---
GREA_RHILV      EVNAPGGSKAYEILQV----
GREA_RHIL3      EVNAPGGSKAYEILQV----
GREA_ORITI      EVITPKGGRFYELLKVQ---
GREA_DESAD      VVNAPKGKIEYGIVSV----
GREA_THICR      TVKAPSGNIEYEIVEIQ---
GREA_AGRVS      EVVAPGGSKAYEIIAV----
GREA_SALTY      VIKTPGGDVEYEVLKVE---
GREA_SALTI      VIKTPGGDVEYEVLKVE---
GREA_RHIEC      EVNAPGGSKAYEILQV----
GREA_RHIE6      EVNAPGGSKAYEILQV----
GREA_SHIFL      VIKTPGGEVEFEVIKVE---
GREA_ECOLI      VIKTPGGEVEFEVIKVE---
GREA_ECOL6      VIKTPGGEVEFEVIKVE---
GREA_ECO57      VIKTPGGEVEFEVIKVE---
GREA_SINMW      EVNAPGGSKAYEILAVQ---
GREA_RHIME      EVNAPGGSKAYEILAVQ---
GREA_UREPA      TVHTLASPYKVKIIKI----
GREA_UREP2      TVHTLASPYKVKIIKI----
GREA_PETMO      NIKTARGS------------
GREA_MAGSM      EVRAPGGTRHFEVVEI----
GREA_MYCMS      EIKDISKPYKITIKSIK---
GREA_WOLSU      NAKLPNGEIDYEVLEV----
GREA_UREU1      TVHTLALPYKVKIIKI----
GREA_SYNFM      RVQTPKGVRNIEVLEI----
GREA_PELUB      EIKTPAGNFEIKDVK-----
GREA_DESPS      VTKTPGGTREFEVVEIK---
GREA_ARCB4      NATLPGGAKTFEILKV----
GREA_NEOSM      EIDLPSGKKTYKILGVE---
GREA_FRATW      TLDTPKGKVTYEIVAVE---
GREA_FRATT      TLDTPKGKVTYEIVAVE---
GREA_FRATO      TLDTPKGKVTYEIVAVE---
GREA_FRATN      TLDTPKGKVTYEIVAVE---
GREA_FRATM      TLDTPKGKVTYEIVAVE---
GREA_FRATH      TLDTPKGKVTYEIVAVE---
GREA_FRATF      TLDTPKGKVTYEIVAVE---
GREA_FRAT1      TLDTPKGKVTYEIVAVE---
GREA_THESQ      KVKAPSGVQRYQVIAV----
GREA_THEP1      KVKAPSGVQRYQVMAV----
GREA_THEMA      KVKAPSGVQRYQVIAV----
GREA_SULNB      ELTLPSGTYDIEEILYEE--
GREA_FRAP2      ILDTPKGKVTYEIVDVE---
GREA_BUCAT      IICTPGGDVEYKILKI----
GREA_BUCAI      IICTPGGDVEYKILKI----
GREA_BUCA5      IICTPGGDVEYKILKI----
GREA_AMOA5      IVEAPAGKIEFEILDI----
GREA_THERP      PIETPNGTLMARIIEVQ---
GREA_MYCGE      DVVGIEVPYRVKILKI----
GREA_BUCCC      KVNTPTG-------------
GREA_FLAJ1      EITVPNGTLKFEILEITR--
GREA_MYCPU      EIDAP-DKYTTKILSV----
GREA_MESSB      EVNAPGGARGYEVLRVQ---
GREA_ACHLI      QIKS----------------
GREA_MYCGA      EVIGIEHPYKVTIKKI----
GREA_DESMR      VVDAPRGKINYEIVSI----
GREA_MYCPN      DVVGIEVPYRVKIVKI----
GREA1_LACPL     TVNAPNGAYQVKVIAVKR--
GREA_ACICJ      SVPAPGGDRSYEILAV----
GREA_THEM4      XXXAPKGVFKYQILGIK---
GREA_FLAPJ      EITVPNGILKFEVLEITR--
GREA_DEHE1      EIEVPSGT------------
GREA_CHLT3      EIKVPKGIMRYEVLNIK---
GREA_THEAB      XIKAPKGVFKYQILGIK---
GREA_PROA2      QIHVPKGELHYEILEI----
GREA_MYCAP      EVEVP-QKYNIKVLDI----
GREA_TREPS      --------------------
GREA_TREPA      --------------------
GREA_SACEN      EYELPGGTMKVTLVKAE---
GREA_BORBU      NFVINNTNFKYFVKKIE---
GREA_STRCO      QYELPNGKASVRILKAE---
GREB_YERPE      TVQTPNGEATYWILEI----
GREB_PSEAE      LVRTPAGEKLWFVVEIE---
GREA_CHLPN      ILQ-----------------
GREA_CHLTR      LFQ-----------------
GREB_NEIMA      VLNTPEGREEIEILSVE---
GREA_CHLMU      LFQ-----------------
GREB_PASMU      KVETPSG-------------
GREA_STRAW      QYELPNGKLSVKILKAE---
GREB_HAEIN      RVETPSGFITLYVNKI----
GREB_NEIMB      VLNTPEGREEIEILSVE---
GREB_SALTY      VVNTPVGEANWYVNAIE---
GREB_SALTI      VVNTPVGEANWYVNAIE---
GREA_RHOE4      EYNLPNGS------------
GREA_MYCTU      SYTVPNGS------------
GREA_MYCTA      SYTVPNGS------------
GREA_MYCBT      SYTVPNGS------------
GREA_MYCBP      SYTVPNGS------------
GREA_MYCBO      SYTVPNGS------------
GREB_PSEPK      VVHTPTG-------------
GREB_ECOLI      VVNTPAG-------------
GREB_XANCP      EAQLPSGKHTFVVVVVEYAA
GREB_ECOL6      VVNTPAG-------------
GREB_ECO57      VVNTPAG-------------
GREA_MYCA9      SYTVPNGT------------
GREB_HAEDU      EVQTPTGKAVFYINKI----
GREA_MYCS2      TYTVPSGN------------
GREA_MYCLE      SYTVPNGN------------
GREA_MYCLB      SYTVPNGN------------
GREB_PSESM      LVNTPEG-------------
GREA_MYCVP      SYTVPSGN------------
GREB_VIBVY      QVPTPSGIKEWFINSIE---
GREB_VIBVU      QVPTPSGIKEWFINSIE---
GREB_XANAC      DAHLPAGKHTFVVVSVD---
GREB_VIBCH      QVHTPTGIKEWFINSIE---
GREB_VIBPA      TVRTPEGDKEWFINSIE---
Y3817_MYCBO     TYSTPQGPNQVQLLAVK---
Y3788_MYCTU     TYSTPQGPNQVQLLAVK---
CATB_ACIAD      MLEGPVGS------------
RNK_SHIFL       HWELPGGATHLEVLELE---
RNK_ECOLI       HWELPGGATHLEVLELE---
RNK_ECOL6       HWELPGGATHLEVLELE---
RNK_ECO57       HWELPGGATHLEVLELE---