[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for spne4:ACF55446.1

[Show Plain Result]


## Summary of Sequence Search
    1::408
   15::362     3e-27  31%  418 aa  OXLT_OXAFO RecName: Full=Oxalate:formate antiporter;       
   10::345     3e-23  29%  402 aa  YHJX_ECOLI RecName: Full=Inner membrane protein yhjX;
   10::285     4e-09  30%  416 aa  YBFB_BACSU RecName: Full=Uncharacterized MFS-type transporter ybfB;
   53::412     2e-07  27%  477 aa  MT12B_DANRE RecName: Full=Monocarboxylate transporter 12-B;        
   13::190     2e-06  25%  509 aa  MOT9_HUMAN RecName: Full=Monocarboxylate transporter 9;       
  326::565     2e-06  27%  673 aa  ESBP6_YEAST RecName: Full=Uncharacterized transporter ESBP6;
   23::153     3e-06  35%  373 aa  Y38K_THETE RecName: Full=Uncharacterized 38 kDa protein in 23S RNA
   13::190     9e-06  25%  509 aa  MOT9_PONAB RecName: Full=Monocarboxylate transporter 9;       
   25::192     3e-05  26%  507 aa  MOT9_CHICK RecName: Full=Monocarboxylate transporter 9;       
   16::313     3e-05  24%  444 aa  GARP_ECOLI RecName: Full=Probable galactarate transporter;AltName:
   16::313     3e-05  24%  444 aa  GARP_ECO57 RecName: Full=Probable galactarate transporter;AltName:
  131::410     4e-05  26%  486 aa  MOT12_HUMAN RecName: Full=Monocarboxylate transporter 12;       
   25::190     5e-05  26%  508 aa  MOT9_MOUSE RecName: Full=Monocarboxylate transporter 9;       
  149::320     8e-05  29%  449 aa  TUB3_AGRVI RecName: Full=Putative tartrate transporter;
   29::296     8e-05  24%  484 aa  MOT2_MOUSE RecName: Full=Monocarboxylate transporter 2;       
  132::303     1e-04  27%  433 aa  TUB4_AGRVI RecName: Full=Putative tartrate transporter;
   19::203     1e-04  33%  474 aa  MFSD9_HUMAN RecName: Full=Major facilitator superfamily
  101::336     1e-04  21%  512 aa  ANTR3_ARATH RecName: Full=Probable anion transporter 3,
   29::296     2e-04  24%  484 aa  MOT2_MESAU RecName: Full=Monocarboxylate transporter 2;       
  100::271     3e-04  24%  519 aa  PHT43_ORYSJ RecName: Full=Probable anion transporter 3,
   73::163     4e-04  42%  426 aa  MOT13_BOVIN RecName: Full=Monocarboxylate transporter 13;       
   81::243     7e-04  26%  619 aa  MCH1_ASPFU RecName: Full=Probable transporter mch1;
    1::408

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxNRYIIAFAGVILHLMLGSTYAWSVYRNPIIEKTGWDQASVAFAFSLAIFCLGLSAAFMGRLVXKFGP
OXLT_OXAFO      ---NRWFYLVLAVLLMCMIGVQYSWTLYANPVKDNLGVSLAAVQTAFTLSQVIQAGSQPGGGYFVDKFGP
YHJX_ECOLI      ----RWLTLIGTIITQFALGSVYTWSLFNGALSAKLDAPVSQXXXXXXXXXXXXXXXXXXXXKLQERFGV
YBFB_BACSU      ------IVSVTFLILLAVQGVRLSFGAFVEPWERQFSIDRSTISLISTVSFIVYGISQPVIGRLVDKWGA
MT12B_DANRE     --------------------------------------DYSGTAWIHSL-VDCTTMLCAPLGSLIGQLSC
MOT9_HUMAN      -----WVIVFVSFLTQLCYGSPLAVGVLYIEWLDAFGEGKGKTAWVGSLASGVGLLASPVCSLCVSSFGA
ESBP6_YEAST     ----------------------------------------------------------------------
Y38K_THETE      ----------------------YTWNLLAPMIGRAMGLGVLAEAVGFTIYVIVSTVAQPAGGALADLRGP
MOT9_PONAB      -----WVIVFVSFFTQLCYGSPLAVGVLYIEWLDAFGEGKGKTAWVGSLASGVGLLASPVCSLCVSSFGA
MOT9_CHICK      ----------------LCYGSPLAVGVLYLEWLDAFGEGKGKTAWVGSLANGIGLLASPVCSICVSSFGA
GARP_ECOLI      ----RYLIL---LIIFIVTAVNYALSIAGTEVAKELQLSAVSMGYIFSAFGWAYLLMQIPGGWLLDKFGS
GARP_ECO57      ----RYLIL---LIIFIVTAVNYALSIAGTEVAKELQLSAVSMGYIFSAFGWAYLLMQIPGGWLLDKFGS
MOT12_HUMAN     ----------------------------------------------------------------------
MOT9_MOUSE      ----------------LSYGSPLAVGVLYVEWLDAFGEGKGKTAWVGSLASGVGLLASPVCSLFVSSFGA
TUB3_AGRVI      ----------------------------------------------------------------------
MOT2_MOUSE      ----------------ISIGFSYAFTVFFKDIQEIFNTTSSQIAWISSIMLAVMYAGGPISSVLVNNYGS
TUB4_AGRVI      ----------------------------------------------------------------------
MFSD9_HUMAN     ----------------------------------------------------------------------
ANTR3_ARATH     ------VVILTACMMCLCNADRVVMSVAVVPLADKLGWSSSFLGVVQSSFLWGYIFSSVIGGALVDRYGG
MOT2_MESAU      ----------------ISIGFSYAFTVFFKDIQQIFQASYSEIAWISSIMLAVMYAGGPISSVLVNNYGS
PHT43_ORYSJ     ------VAAMLGLALALCNADRVVMSVAIVPLSQAYGWTPSFAGVVQSSFLWGYLVSPIIGGALVDYYGG
MOT13_BOVIN     ---------------------------------------------------------------LSTKFGP
MCH1_ASPFU      ------VCSFAGVISCLGAGSITAFSLYGPLFLTRLHYSQLQVNAVSIAAEISMYLPVPLFGYLCDRYTP


                         .         .         *         .         .         .         .:140
query           RVMGSLSAFLYAGGNILTGFAIDRQELWXXXXXXXXXXXXXXXXXXXTPVSTIIKWFPDKRGLATGLAIM
OXLT_OXAFO      RI-----PLMFGGAMVLAGWTMGMVDSVPXXXXXXXXXXXXXXXXXXXXMNTANRWFPDKRGLASGFTAA
YHJX_ECOLI      KRVTMASGILLGLGFFLTAHSDNLMMLWLSXXXXXXXXXXXXXXXT---LSNCVKWFPERKGLISAFAIG
YBFB_BACSU      RAVLAWSALLTGVSIFLTYLVTSPWQLFLLYXXXXXXXXXXXXXXXXXXXXXX--WFSKKRGLAFGIMEA
MT12B_DANRE     RIAVILGGFLASVGLVLSSFATSXXXXXXXXXXXXXXXXXXCY----TPAIAMVGYFCERKALAYGIAMS
MOT9_HUMAN      RPVTIFSGFMVAGGLMLSSFA---PNIYFLFFSYGIVVGLGCGLLYTATVTITCQYFDDRRGLALGLIST
ESBP6_YEAST     ------------------------------------------------PATTVLPWFLKKRAVAMGVSLL
Y38K_THETE      RGVGALSAVL----SXXXXXXXXXXXXXXXXXXXXXXXSAGEGVLYGIAFNLAVKWYQDKLGLATGLVSL
MOT9_PONAB      RPVTIFSGFMVAGGLMLSSFA---PNIYFLFFSYGIVVGLGCGLLYTATVTITCLYFDDRRGLALGLIST
MOT9_CHICK      RPVAIFSGFMVAGGLMMSSFA---PNIYFLYLSYGIVVGLGCGLLYNATVTITCQYFDKRRGLALGLIST
GARP_ECOLI      KKVYTYSLFFWSLFTFLQGFVDMFPLAWAGISMFFMRFMLGFSEAPSFPANAVAAWFPTKRGTASAIFNS
GARP_ECO57      KKVYTYSLFFWSLFTFLQGFVDMFPLAWAGISMFFMRFMLGFSEAPSFPANAVAAWFPTKRGTASAIFNS
MOT12_HUMAN     -------------------------------------------------IAMVGKYFSRRKALAYGIAMS
MOT9_MOUSE      RPVTIFSGFLVAGGLMLSSLA---PNIYFLFFSYGIVVGLGCGLLYTATVTITCQYFDSRRGLALGLIST
TUB3_AGRVI      -------------------------------------------------------WFPARRRAATALFMA
MOT2_MOUSE      RPVVIVGGLLCCIGMILASYSNSVIELYLTVGFIGGLGLAFNLQ----PALTIIKYFYRRRPLANGCAMA
TUB4_AGRVI      -------------------------------------------------------WFPARRRAATAIFMA
MFSD9_HUMAN     ----------------------------------------------------------------------
ANTR3_ARATH     KRVLAWGVALWSLATLLTPWAAAHSTLALLCVRAFFGLAEGVAMPSMT--TLLSRWFPDERASAVGISMA
MOT2_MESAU      RPVVIIGGLLCCTGMILASFSNSVLELYLTIGFIGGLGLAFNLQ----PALTIIKYFYRRRPMANGLAMA
PHT43_ORYSJ     KRVMAYGVALWSLATFLSPWAAARS-LWLFLSTRVLLGMAEGVALPSMN-NMVLRWFPTERSSAVGIAMA
MOT13_BOVIN     RPAVMTGGILTALGMLLASFATSLTHLYXXXXXXXXXXWALTF----TPLACLSRYFSRRRSLAMGLALT
MCH1_ASPFU      SPLALLSGLVFGGGYLLAAFAYRSGPLWWVMVVAFVAIGTATSCMYLAAVTTCAKNFGKHKGIMLAVPIA


                         +         .         .         .         .         *         .:210
query           GFGFASLLTSPIAQHLIAGVGLVETFYILGASYFIIMLLASQFIKRPNEQELAILSASGKEKTDSLTQGM
OXLT_OXAFO      GYGLGVLPFLPLISSVLKVEGVGAAFMYTXXXXXXXXXXXAFVIRFPGQQ-------GAKKQIVVTDKDF
YHJX_ECOLI      SYGLGSLGFKFIDTQLLETVGLEKTFVIWGAIALLMIVFGATLMKDAPKQEV-------KTSNGVVEKDY
YBFB_BACSU      GFGAGQMLLVPGSLMLIHWFSWKXXXXXXXXXXXXXXFPAALLMLRNNPSEIGGLAASEKE-TAPKTTAL
MT12B_DANRE     GSGIGTFILAPVVQLLIEHYSWRGALLILGG--FVLNLCVCGALLRPKEEEACPLPVDSEVKPPTLNGGP
MOT9_HUMAN      GSSVGLFIYAALQRMLVEFYGLDGCLLIVGA--LALNILACGSLMRP-----------------------
ESBP6_YEAST     GTGAGGVVYGLATNKMLSDFGNTRCLRIIGISCSISVLVAIALLKERNPTP-----AIGLKSPRAMFEQL
Y38K_THETE      GFGLGSAVANP----LIASVG-------------------------------------------------
MOT9_PONAB      GSSVGLFIYAALQRMLVEFYGLDGCLLIVGA--LALNILACGSLMRP-----------------------
MOT9_CHICK      GSSVGLFIYAALQRELIELYGLDGCLLIVGA--LSLNILACGSLMRPLE---------------------
GARP_ECOLI      AQYFSLALFSPLLGWLTFAWGWEHVFTVMGVIGFVLTALWIKLIHNPTDEELKFISENGKKPGSAAASGP
GARP_ECO57      AQYFSLALFSPLLGWLTFAWGWEHVFTVMGVIGFVLTALWIKLIHNPTDEELKFISENGKKPGSAAASGP
MOT12_HUMAN     GSGIGTFILAPVVQLLIEQFSWRGALLILGG--FVLNLCVCGALMRPPEQNHVCRTQKEDIKRVSPYSSL
MOT9_MOUSE      GSSVGLFIYAALQRMLIEFYGLDGCLLIVGA--LALNILACGSLMRP-----------------------
TUB3_AGRVI      AAPLSTVLGSPISGALMEMHGLMQWMFLIEAAPALILGVVVLFFLTDRPEKAKWLT---EEERNWLVKTM
MOT2_MOUSE      GSPVFLSTLAPFNQYLFNNYGWKGSFLILG-GIFLHSCVAGCLMRGPSPNTKKSKSKVGSRHDSTLKKAS
TUB4_AGRVI      AAPLSTVLGSPISMHGFLGLAGWQWMFLIEAAPAVILGVVVLFYLTDRPEKAKWLS---EDERNWLVKTM
MFSD9_HUMAN     -------------------------------------------------------TAERKQEQKTGTEAE
ANTR3_ARATH     GFHMGNVVGLLLTPLMLSSIGISGPF-ILFASLGLLWVSTSPFITR---SELRLIQAGKPVQPSTISPKP
MOT2_MESAU      GSPVFLSSLAPFNQYLFNSYGWKGSFLILG-GIFLHSCVAGCLMRQTSPRXXXXXXXVGSRQDGSMKKAS
PHT43_ORYSJ     GFQLGNLLLSPI---IMSRAGIFGPFVIFGLFGFLWVLV-------------------------------
MOT13_BOVIN     GVGLSSFAFAPLFQWLL-----------------------------------------------------
MCH1_ASPFU      GFGLSGMWQSQVATYLL-----------------------------------------------------


                         .         .         .         +         .         .         .:280
query           TANQALKSNRFYILWIIFFINIACGLGLISAASPMAQEMAGLSTSHAAVMVGVLGIFNGFGRLLWASLSD
OXLT_OXAFO      NSGEMLRTPQFWVLWTAFFSVNFGGLLLVANSVPYGRSL-GLAAGVLTIGVSIQNLFNGGCRPFWGFVSD
YHJX_ECOLI      TLAESMRKPQYWMLAVMFLTACMSGLYVIGVAKDIAQSLAHLDVVSAANAVTVISIANLSGRLVLGILSD
YBFB_BACSU      SVAGMFRMRQF---WFLIFPFLICGVGLMDTHLIPFSHDHGFSTTVTSAAVSLLAGFNIAGILLSGIVAD
MT12B_DANRE     TRSAASDAKQYHFLLMPDFLVLAGSFLLLASGCPYALDV-GVGHQHAAFLMSILGVIDIVGNITFGWLTD
MOT9_HUMAN      ----------------------------------------------------------------------
ESBP6_YEAST     KAMFSLKTKPFVVLIALWFMFALFAYNMMVFTLSSYAISKGLSSHDASTLTAILNGSQSIGRPLMGLAGD
Y38K_THETE      ----------------------------------------------------------------------
MOT9_PONAB      ----------------------------------------------------------------------
MOT9_CHICK      ----------------------------------------------------------------------
GARP_ECOLI      KLHKQLLSNRMMVFFGQYFINTITWFFLTWFPIYLVQE-KGMSILKVGLVASIPALCGFAGGVLGGVFSD
GARP_ECO57      KLHKQLLSNRMMVFFGQYFINTITWFFLTWFPIYLVQE-KGMSILKVGLVASIPALCGFAGGVLGGVFSD
MOT12_HUMAN     TKEWALQQEYSFLLMSDFVVLAVSVLFMAYGCSPLFVYLVGVSHQQAAFLMSILGVIDIIGNITFGWLTD
MOT9_MOUSE      ----------------------------------------------------------------------
TUB3_AGRVI      NAEQALADIRVIALALVYF-GTSAGLYTLGIWAPQIIKQFGLSAIEVGFINAVPGIFAVVAMVLWARHSD
MOT2_MOUSE      KVSTAQKVNRFLDFSLFFLINVILFLGIFAPIIFLAQKHIGVDDYNSAFLLSVMAFIDMFAR--------
TUB4_AGRVI      NAEQAAKGKRVIALALVYF-GTSAGLYTLGIWAPQIIKEFGLSSLQVGFINAVPGIFAVAAMVLWARHSD
MFSD9_HUMAN     AADSAVGARRFLLLYLVGFLDLF-GVSMVVPLLSLHVKSLGASPTVAGIVGSSYGILQLFSSTLVGCWSD
ANTR3_ARATH     NPSLRLLLSKL-PTWAIIFANVTNNWG-------------------------------------------
MOT2_MESAU      KVSTAEKINRFLDFSLFFLINVIMFLGFIIFLAPYAKD-KGVDEYNAALLLSVMAFVDMFAR--------
PHT43_ORYSJ     ----------------------------------------------------------------------
MOT13_BOVIN     ----------------------------------------------------------------------
MCH1_ASPFU      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           YIGRPXXXXXXXXXXXXXXXXXXXXTDSVLFVVAMSILMTCYGAGFSLIPAYLSDIFGTKELAALHGYIL
OXLT_OXAFO      KIGRTMSVVFGINAVVLALFPTIAALGDVAFIAMLAIAFFTWGGSYALFPSTNSDIFGTAYSARNYGFFW
YHJX_ECOLI      KIARRVITIGQVISLVGMAALLFAPLNAVTFFAAIACVAFNFGGTITVFPSLVSEFFGLNNLAKNYGVI-
YBFB_BACSU      ----------------------------------------------------------------------
MT12B_DANRE     LKKYRNICYMFAVGMEGLCCLFIPLLRTFVWLVPFSVLYGYFGAYVALIPVVTSDVVGRQYLSSALGVVY
MOT9_HUMAN      ----------------------------------------------------------------------
ESBP6_YEAST     KFGRANXXXXXXXXXXXYMFAFWIPAHTFVQLIFFSILVSCVGVANVMNTVLIADMVKPEE-------FL
Y38K_THETE      ----------------------------------------------------------------------
MOT9_PONAB      ----------------------------------------------------------------------
MOT9_CHICK      ----------------------------------------------------------------------
GARP_ECOLI      YL--------------------------------------------------------------------
GARP_ECO57      YL--------------------------------------------------------------------
MOT12_HUMAN     -------------------RRCLKNYQYVCYLFAVGMDGLCYGAYVTLIPVVTTEIVGTTSLSSALGVVY
MOT9_MOUSE      ----------------------------------------------------------------------
TUB3_AGRVI      RTG-------------------------------------------------------------------
MOT2_MOUSE      ----------------------------------------------------------------------
TUB4_AGRVI      KTG-------------------------------------------------------------------
MFSD9_HUMAN     VVGRRXXXXXXXXXXXXXXXXXXXXTNVFLFVLAR-VPAGIFKHTLSISRALLSDVVPEKERPLVIGHFN
ANTR3_ARATH     ----------------------------------------------------------------------
MOT2_MESAU      ----------------------------------------------------------------------
PHT43_ORYSJ     ----------------------------------------------------------------------
MOT13_BOVIN     ----------------------------------------------------------------------
MCH1_ASPFU      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           TAWAMAGLAGPILLAETYKMAHSYTQTLFVxxxxxxxxxxxxxxxxxxxxxxxxxxxx
OXLT_OXAFO      AAKATASIFG------------------------------------------------
YHJX_ECOLI      ----------------------------------------------------------
YBFB_BACSU      ----------------------------------------------------------
MT12B_DANRE     FLHAVPYLVSPPIGGWLVDTTGTYTAT-------------------------------
MOT9_HUMAN      ----------------------------------------------------------
ESBP6_YEAST     PAWAFVNYCGPFLL--------------------------------------------
Y38K_THETE      ----------------------------------------------------------
MOT9_PONAB      ----------------------------------------------------------
MOT9_CHICK      ----------------------------------------------------------
GARP_ECOLI      ----------------------------------------------------------
GARP_ECO57      ----------------------------------------------------------
MOT12_HUMAN     FLHAVPYLVSPPIAGRLVDTTGSYT---------------------------------
MOT9_MOUSE      ----------------------------------------------------------
TUB3_AGRVI      ----------------------------------------------------------
MOT2_MOUSE      ----------------------------------------------------------
TUB4_AGRVI      ----------------------------------------------------------
MFSD9_HUMAN     TASGVGFILGPVVGGYLTELEDGFYLTAFI----------------------------
ANTR3_ARATH     ----------------------------------------------------------
MOT2_MESAU      ----------------------------------------------------------
PHT43_ORYSJ     ----------------------------------------------------------
MOT13_BOVIN     ----------------------------------------------------------
MCH1_ASPFU      ----------------------------------------------------------