[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for spne4:ACF55485.1

[Show Plain Result]


## Summary of Sequence Search
    1::347
  136::312     3e-09  25%  390 aa  Y1607_METJA RecName: Full=Uncharacterized glycosyltransferase
  143::369     2e-08  27%  381 aa  WAAK_SALTY RecName: Full=Lipopolysaccharide
  171::368     5e-08  25%  381 aa  EPSD_BACSU RecName: Full=Putative glycosyltransferase epsD;        
  203::316     2e-07  32%  389 aa  TUAC_BACSU RecName: Full=Putative teichuronic acid biosynthesis
  139::366     3e-07  23%  452 aa  GPI3_YEAS7 RecName: Full=Phosphatidylinositol
  139::366     1e-06  23%  452 aa  GPI3_YEAST RecName: Full=Phosphatidylinositol
  139::366     1e-06  23%  452 aa  GPI3_YEAS6 RecName: Full=Phosphatidylinositol
  139::366     1e-06  23%  452 aa  GPI3_YEAS1 RecName: Full=Phosphatidylinositol
  172::310     2e-06  21%  407 aa  WCAI_ECOLI RecName: Full=Putative colanic acid biosynthesis
  142::357     2e-05  25%  456 aa  GPI3_SCHPO RecName: Full=Phosphatidylinositol
  274::381     5e-05  27%  942 aa  Y2592_STRCO RecName: Full=Exopolysaccharide phosphotransferase
  173::314     5e-05  31%  352 aa  LPCC_RHILV RecName: Full=Lipopolysaccharide core biosynthesis
  152::302     9e-05  26%  377 aa  COTSA_BACSU RecName: Full=Spore coat protein SA;       
  123::349     1e-04  25%  353 aa  RFBU_SALTY RecName: Full=Protein rfbU;         EC=2.4.-.-;
  234::458     2e-04  26%  463 aa  GLGA_AQUAE RecName: Full=Glycogen synthase;       
  249::412     3e-04  34%  484 aa  GLGA2_GEOMG RecName: Full=Glycogen synthase 2;       
  152::301     4e-04  26%  358 aa  YC07_KLEPN RecName: Full=Uncharacterized 41.2 kDa protein in cps
    1::347

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
Y1607_METJA     ----------------------------------------------------------------------
WAAK_SALTY      ----------------------------------------------------------------------
EPSD_BACSU      ----------------------------------------------------------------------
TUAC_BACSU      ----------------------------------------------------------------------
GPI3_YEAS7      ----------------------------------------------------------------------
GPI3_YEAST      ----------------------------------------------------------------------
GPI3_YEAS6      ----------------------------------------------------------------------
GPI3_YEAS1      ----------------------------------------------------------------------
WCAI_ECOLI      ----------------------------------------------------------------------
GPI3_SCHPO      ----------------------------------------------------------------------
Y2592_STRCO     ----------------------------------------------------------------------
LPCC_RHILV      ----------------------------------------------------------------------
COTSA_BACSU     ----------------------------------------------------------------------
RFBU_SALTY      ----------------------------------------------------------------------
GLGA_AQUAE      ----------------------------------------------------------------------
GLGA2_GEOMG     ----------------------------------------------------------------------
YC07_KLEPN      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxFLKGIVKRYVFSFYNRMEHLVVVNPMFIEDLVAAGIPREKVTYIP
Y1607_METJA     ---------------------------KAIHAMEYLSTYESCQVITVSKSLKEEVCSIFNTPEDKVKVIY
WAAK_SALTY      ---------------------------------------------IIVPSQFLKAFYEERLPAAAVSIVP
EPSD_BACSU      ----------------------------------------------------------------------
TUAC_BACSU      ----------------------------------------------------------------------
GPI3_YEAS7      -------------------------------KLLTFTLTNIDRVICVSNTCKENMIVRTELSPDIISVIP
GPI3_YEAST      -------------------------------KLLTFTLTNIDRVICVSNTCKENMIVRTELSPDIISVIP
GPI3_YEAS6      -------------------------------KLLTFTLTNIDRVICVSNTCKENMIVRTELSPDIISVIP
GPI3_YEAS1      -------------------------------KLLTFTLTNIDRVICVSNTCKENMIVRTELSPDIISVIP
WCAI_ECOLI      ---------------------------------------HNVDNVSTISRSMMNKAIEKGVAAENVIFFP
GPI3_SCHPO      -----------------------------------------VNHVICVSHTCRENTVLRAVLNPKVSVIP
Y2592_STRCO     ----------------------------------------------------------------------
LPCC_RHILV      ----------------------------------------------------------------------
COTSA_BACSU     --------------------------------------------------------------RSKTKTVY
RFBU_SALTY      -------------------------FIQKVYFRFLLKMVKRCKHVLTVS-YTVKDSIAKNVDSEKISVIY
GLGA_AQUAE      ----------------------------------------------------------------KLRGIL
GLGA2_GEOMG     --------------------------------------------------------------------IL
YC07_KLEPN      --------------------------------------------------------VDAGISKNKIKVVY


                         +         .         .         .         .         *         .:210
query           NFVNKEKWHPLPQEEVVRLRTDLGLSDNQFIVVGAGQVQKRKGIDDFIRLAEELPQITFIWAGGFSFGGM
Y1607_METJA     NGINPWEFDNLSWEEKINFRRSIGVQDDEKMILFVGRLTYQKGIEYLIRA---MPKILERHNAKLVIAGS
WAAK_SALTY      NGFCAETYKRNPQDN---LRQQLNIAEDATVLLYAGRISPDKGILLLLQAFKQLSNIKLVVVGDPYASRK
EPSD_BACSU      --VNTERFRPVSPIEQQRLREKHGFREDDFILVYPAELNLNKNQKQLIELKEKIPSLRLVFAGE---GAM
TUAC_BACSU      ------------EETKEEIRKRLGLPLDQRLAVYVGRLVREKGIFELSEAIESLPKAVFVGDGPAKSTLT
GPI3_YEAS7      NAVVSEDFKPRDPTDSTKRKQ----SRDKIVIVVIGRLFPNKGSDLLTRIIPKVEDVEFIVAGDIDFQQM
GPI3_YEAST      NAVVSEDFKPRDPTGGTKRKQ----SRDKIVIVVIGRLFPNKGSDLLTRIIPKVEDVEFIVAGDIDFQQM
GPI3_YEAS6      NAVVSEDFKPRDPTGGTKRKQ----SRDKIVIVVIGRLFPNKGSDLLTRIIPKVEDVEFIVAGDIDFQQM
GPI3_YEAS1      NAVVSEDFKPRDPTGGTKRKQ----SRDKIVIVVIGRLFPNKGSDLLTRIIPKVEDVEFIVAGDIDFQQM
WCAI_ECOLI      NWSEIARFQHVADADVDALRNQLDLPDNKKIILYSGNIGEKQGLENVIEAADRLRDEPLI----FAIVGQ
GPI3_SCHPO      NALVAENFQPDPSKA----------SKDFLTIVVISRLYYNKGIDLLIRICAQHPKVRFVIAGD---GPK
Y2592_STRCO     ----------------------------------------------------------------------
LPCC_RHILV      -----------------------------------GRVRHQKGTDLFVRMIELLPQHT-EWTAVVS-GRV
COTSA_BACSU     SGVDLKTYHPRWTNEGQRMRSELGLHGKK-IVLFVGRLSKVKGPHILLQIIEEHPDVMMVFIGSKWFGDL
RFBU_SALTY      NSVNKSDFIQKKEKE------------NYFLAVGASW--PHKNIHSFIKNKK-------VWSDSYNLCGR
GLGA_AQUAE      NGIDYEVWNPEKDKYIYQLSKELGIEAEKPLISFINRFTHQKGVELILNCAEEMSKLN----ANFVFLG-
GLGA2_GEOMG     NGLDSEEWNPSLDRRIFRLQRELGLKAGASIIIGVGRIVEQKGIDLVIDLAEEL-QLVILGTGDLRL--M
YC07_KLEPN      NAVSLDG-----QEKLERIKNENEVQKEKINILFVGRFDKQKGYDYLLNVIKDVSKYTFNIIGD----SV


                         .         .         .         +         .         .         .:280
query           TDGYEHYKKIMENPPKNLIFPGIVSPERMRELYALADLFLLPSYNELFPMTILEAASCEAPIMLRDLDLY
Y1607_METJA     GDMRDYLEDLCYQVRHKVVFLGFVNGDTLKKLYKSADVVVIPSVYEPFGIVALEAMAAGTPVVV------
WAAK_SALTY      GEKAEYQKKVLDAAKEDCIMAGGQSPDQMHNFYHIADLVIVPSVEEAFCMVAVEAAAGKAVLASKKGGIS
EPSD_BACSU      EHTYQTLAEKL-GASAHVCFYGFCSD--IHELIQLADVSVASSIREGLGMNVLEGMAAEQPAIATDNRGH
TUAC_BACSU      QKGH--------------IVTGQVPNHQVRDYLLAADLFVLPSYSEGMPTVVIEALALRVPVICTDV---
GPI3_YEAS7      IESHRLQKRVQ--------LLGSVPHEKVRDVLCQGDIYLHASLTEAFGTILVEAASCNLLIVTTQVGGI
GPI3_YEAST      IESHRLQKRVQ--------LLGSVPHEKVRDVLCQGDIYLHASLTEAFGTILVEAASCNLLIVTTQVGGI
GPI3_YEAS6      IESHRLQKRVQ--------LLGSVPHEKVRDVLCQGDIYLHASLTEAFGTILVEAASCNLLIVTTQVGGI
GPI3_YEAS1      IESHRLQKRVQ--------LLGSVPHEKVRDVLCQGDIYLHASLTEAFGTILVEAASCNLLIVTTQVGGI
WCAI_ECOLI      GGGKARLEKMQQRGLRNMQFFPLQSYDALPALLKMGDCHLV-----------------------------
GPI3_SCHPO      SIDLEQMRKYMLQDRVEML--GSVRHDQVRDVMVRGHIYLHPSLTEAFGTVLVEAASCGLYVISTKVGGV
Y2592_STRCO     --------------------------QHMTEEWARASLTILPSQDEAFPLVLLEAFAAGVPAVAYDIEII
LPCC_RHILV      TAEHVAFADVAAGLSDRILFLGEVPD--IKIWYRRLTLYVAPSRNEGFGLTPLEAMASRTAVVASDAGAY
COTSA_BACSU     NNYVKHLHTLGAMQKDHVTFIQFVKPKDIPRLYTMSDVFVCSSWQEPLARVHYEAMAAGLPII-------
RFBU_SALTY      TDAMSLQQMVVDLELKDKVFLHEVSFNELKILYSKAYALVYPSIDEGFGIPPIEAMASNTPVIVSDIPVF
GLGA_AQUAE      TGEYENAFLDVSKIYKNFKVFAEFNEGFARKLYASSDFILMPSYFEPCGLTQMIGMRYGCVPIVRKTDTV
GLGA2_GEOMG     HQLHEFRNKGVKNVSINLGFKEPLAPK----IYAGCDMFLMPSRFEPCGLSQLIALSYTVPIVRRTGGLA
YC07_KLEPN      HDVFEKIEK------ENVVYYGWVDNKELPAYFCENDVLLMPSRWESFGLVAVEAQLYGVPVIANNVSLP


                         .         *         .         .         .         .         +:350
query           KVILEGNYRATAGREEMKEAILEYQANPAVLKDLKEKAKNISREYSEEHLLQIWLDFYEKxxxxxxx
Y1607_METJA     -------------------------------------------------------------------
WAAK_SALTY      EFVLDGGYHLA---EPMSSDSIINDINRALAHQIAEKAKSVFSKYSWENVAQ---------------
EPSD_BACSU      REIIENGFLIKIGSAAFARRIEQLYHKPELCRKLGQEGRKTALRFSEARTVEEMADIY---------
TUAC_BACSU      -------------------------------------------------------------------
GPI3_YEAS7      PEVLPNEMTVYAEQTSVSDLV---QATNKAINIIRSKALDTSSFHDSVSKMYDWMD-----------
GPI3_YEAST      PEVLPNEMTVYAEQTSVSDLV---QATNKAINIIRSKALDTSSFHDSVSKMYDWMD-----------
GPI3_YEAS6      PEVLPNEMTVYAEQTSVSDLV---QATNKAINIIRSKALDTSSFHDSVSKMYDWMD-----------
GPI3_YEAS1      PEVLPNEMTVYAEQTSVSDLV---QATNKAINIIRSKALDTSSFHDSVSKMYDWMD-----------
WCAI_ECOLI      -------------------------------------------------------------------
GPI3_SCHPO      PEVLPSHMTRFARPEEDDLA----DTLSSVITDYLDHKIKTETFHEEVKQMYSWIDVAER-------
Y2592_STRCO     RHGEDGLLVPPNDVESLAEAISRLMGDEALLRSYGEKAHEGSTRFAADVIVKQWEELF---------
LPCC_RHILV      AELITGSVVAASDGEALTRAIAPYIADPAL-------------------------------------
COTSA_BACSU     -------------------------------------------------------------------
RFBU_SALTY      EVLTNGALYVNPDDEKSWQSAIK---NIEQLPDAISRFNNYVARYDFDNMKQMWL------------
GLGA_AQUAE      KDISEGGYGITF-EEPSKETFLCSLKRAIELYENAKKFRNMSLDFSCDRMTKEYIECYEE-------
GLGA2_GEOMG     DTVID--------------------------------------------------------------
YC07_KLEPN      EVISDG-------------------------------------------------------------