[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for spne4:ACF55561.1

[Show Plain Result]


## Summary of Sequence Search
    1::321
    2::282     3e-27  31%  298 aa  XERC_STAAB RecName: Full=Tyrosine recombinase xerC;
    8::295     1e-26  29%  305 aa  XERC_OCEIH RecName: Full=Tyrosine recombinase xerC;
    2::282     1e-26  30%  298 aa  XERC_STAAN RecName: Full=Tyrosine recombinase xerC;
    2::282     1e-26  30%  298 aa  XERC_STAAM RecName: Full=Tyrosine recombinase xerC;
    2::282     1e-26  30%  298 aa  XERC_STAA9 RecName: Full=Tyrosine recombinase xerC;
    2::282     1e-26  30%  298 aa  XERC_STAA2 RecName: Full=Tyrosine recombinase xerC;
    2::282     1e-26  30%  298 aa  XERC_STAA1 RecName: Full=Tyrosine recombinase xerC;
    2::282     2e-26  30%  298 aa  XERC_STAAT RecName: Full=Tyrosine recombinase xerC;
    2::282     2e-26  30%  298 aa  XERC_STAAR RecName: Full=Tyrosine recombinase xerC;
    2::282     2e-26  30%  298 aa  XERC_STAAE RecName: Full=Tyrosine recombinase xerC;
    2::282     2e-26  30%  298 aa  XERC_STAAC RecName: Full=Tyrosine recombinase xerC;
    2::282     2e-26  30%  298 aa  XERC_STAA8 RecName: Full=Tyrosine recombinase xerC;
    2::282     2e-26  30%  298 aa  XERC_STAA3 RecName: Full=Tyrosine recombinase xerC;
   22::311     2e-26  31%  318 aa  XERC_LEPIN RecName: Full=Tyrosine recombinase xerC;
   22::311     2e-26  31%  318 aa  XERC_LEPIC RecName: Full=Tyrosine recombinase xerC;
    2::282     2e-26  30%  298 aa  XERC_STAAW RecName: Full=Tyrosine recombinase xerC;
    2::282     2e-26  30%  298 aa  XERC_STAAS RecName: Full=Tyrosine recombinase xerC;
    2::282     8e-26  31%  298 aa  XERC_STAAU RecName: Full=Tyrosine recombinase xerC;
   36::303     2e-25  32%  308 aa  XERC_CORGL RecName: Full=Tyrosine recombinase xerC;
    2::275     1e-24  29%  285 aa  XERCL_PYRHO RecName: Full=Probable tyrosine recombinase xerC-like;
    2::275     3e-24  32%  286 aa  XERC_PYRFU RecName: Full=Probable tyrosine recombinase xerC-like;
    5::287     6e-24  32%  306 aa  XERC_HERA2 RecName: Full=Tyrosine recombinase xerC;
   19::282     1e-23  32%  296 aa  XERC_STAS1 RecName: Full=Tyrosine recombinase xerC;
   52::294     2e-23  29%  301 aa  XERC_PEDPA RecName: Full=Tyrosine recombinase xerC;
    5::299     4e-23  31%  300 aa  XERC_ANOFW RecName: Full=Tyrosine recombinase xerC;
    6::293     5e-23  31%  304 aa  XERC_BACSU RecName: Full=Tyrosine recombinase xerC;
   26::279     7e-23  32%  304 aa  XERC_HAEDU RecName: Full=Tyrosine recombinase xerC;
    3::294     1e-22  30%  305 aa  XERC_BACP2 RecName: Full=Tyrosine recombinase xerC;
   53::307     1e-22  30%  315 aa  XERC_CHLTR RecName: Full=Tyrosine recombinase xerC;
   53::307     1e-22  30%  315 aa  XERC_CHLTB RecName: Full=Tyrosine recombinase xerC;
   53::307     1e-22  30%  315 aa  XERC_CHLTA RecName: Full=Tyrosine recombinase xerC;
   53::307     1e-22  30%  315 aa  XERC_CHLT2 RecName: Full=Tyrosine recombinase xerC;
   50::295     2e-22  31%  300 aa  XERC_LISIN RecName: Full=Tyrosine recombinase xerC;
   50::295     3e-22  31%  300 aa  XERC_LISMO RecName: Full=Tyrosine recombinase xerC;
   16::292     4e-22  31%  301 aa  XERC_THEYD RecName: Full=Tyrosine recombinase xerC;
    8::282     4e-22  30%  297 aa  XERC_STAHJ RecName: Full=Tyrosine recombinase xerC;
   50::295     4e-22  30%  300 aa  XERC_LISW6 RecName: Full=Tyrosine recombinase xerC;
    2::282     7e-22  28%  296 aa  XERC_STAES RecName: Full=Tyrosine recombinase xerC;
    2::282     7e-22  28%  296 aa  XERC_STAEQ RecName: Full=Tyrosine recombinase xerC;
   50::295     7e-22  31%  300 aa  XERC_LISMF RecName: Full=Tyrosine recombinase xerC;
   50::295     7e-22  31%  300 aa  XERC_LISMC RecName: Full=Tyrosine recombinase xerC;
   46::295     1e-21  31%  300 aa  XERC_LISMH RecName: Full=Tyrosine recombinase xerC;
  144::307     2e-21  36%  315 aa  XERC_CHLMU RecName: Full=Tyrosine recombinase xerC;
    5::295     2e-21  28%  299 aa  XERD_BACHD RecName: Full=Tyrosine recombinase xerD;
   19::272     2e-21  30%  299 aa  XERC_PSE14 RecName: Full=Tyrosine recombinase xerC;
   38::299     2e-21  31%  310 aa  XERC_COREF RecName: Full=Tyrosine recombinase xerC;
  155::307     2e-21  38%  311 aa  XERCL_METTH RecName: Full=Probable tyrosine recombinase xerC-like;
    4::294     4e-21  29%  298 aa  XERD_LEPIN RecName: Full=Tyrosine recombinase xerD;
    4::294     4e-21  29%  298 aa  XERD_LEPIC RecName: Full=Tyrosine recombinase xerD;
   19::272     4e-21  30%  299 aa  XERC_PSESM RecName: Full=Tyrosine recombinase xerC;
   66::307     4e-21  31%  312 aa  XERC_CHLAB RecName: Full=Tyrosine recombinase xerC;
   19::272     5e-21  30%  299 aa  XERC_PSEU2 RecName: Full=Tyrosine recombinase xerC;
   67::307     8e-21  30%  312 aa  XERC_CHLCV RecName: Full=Tyrosine recombinase xerC;
   19::276     1e-20  32%  295 aa  XERC_PASMU RecName: Full=Tyrosine recombinase xerC;
  119::293     1e-20  37%  297 aa  XERD_OCEIH RecName: Full=Tyrosine recombinase xerD;
   19::276     1e-20  31%  295 aa  XERC_MANSM RecName: Full=Tyrosine recombinase xerC;
  149::307     1e-20  37%  312 aa  XERC_CHLFF RecName: Full=Tyrosine recombinase xerC;
    2::282     2e-20  29%  296 aa  XERC_STACT RecName: Full=Tyrosine recombinase xerC;
  125::281     2e-20  38%  302 aa  XERC_SHESW RecName: Full=Tyrosine recombinase xerC;
  125::281     2e-20  38%  302 aa  XERC_SHEPC RecName: Full=Tyrosine recombinase xerC;
    5::272     2e-20  36%  282 aa  XERCL_THEON RecName: Full=Probable tyrosine recombinase xerC-like;
  111::290     4e-20  33%  295 aa  XERC_LACLE RecName: Full=Tyrosine recombinase xerC;
  122::278     5e-20  37%  299 aa  XERC_SHEON RecName: Full=Tyrosine recombinase xerC;
  111::284     5e-20  34%  295 aa  XERC_LACDB RecName: Full=Tyrosine recombinase xerC;
  111::284     5e-20  34%  295 aa  XERC_LACDA RecName: Full=Tyrosine recombinase xerC;
  136::279     9e-20  36%  306 aa  XERC_ACTP7 RecName: Full=Tyrosine recombinase xerC;
    8::292     1e-19  28%  296 aa  XERD_BACSU RecName: Full=Tyrosine recombinase xerD;
    6::293     1e-19  29%  304 aa  XERC_BACLD RecName: Full=Tyrosine recombinase xerC;
    5::272     1e-19  30%  282 aa  XERCL_PYRKO RecName: Full=Probable tyrosine recombinase xerC-like;
    2::291     2e-19  29%  295 aa  XERD_STAEQ RecName: Full=Tyrosine recombinase xerD;
    2::293     2e-19  28%  297 aa  XERD_LISIN RecName: Full=Tyrosine recombinase xerD;
    2::291     2e-19  29%  295 aa  XERD_STAES RecName: Full=Tyrosine recombinase xerD;
  179::348     2e-19  38%  355 aa  XERC_BIFLI RecName: Full=Tyrosine recombinase xerC;
  179::348     2e-19  38%  355 aa  XERC_BIFLD RecName: Full=Tyrosine recombinase xerC;
  121::299     3e-19  31%  310 aa  XERC_VIBPA RecName: Full=Tyrosine recombinase xerC;
  132::285     3e-19  37%  311 aa  XERC_VIBCM RecName: Full=Tyrosine recombinase xerC;
  132::285     3e-19  37%  311 aa  XERC_VIBCH RecName: Full=Tyrosine recombinase xerC;
  132::285     3e-19  37%  311 aa  XERC_VIBC3 RecName: Full=Tyrosine recombinase xerC;
  132::278     3e-19  38%  299 aa  XERC_SHESR RecName: Full=Tyrosine recombinase xerC;
  132::278     3e-19  38%  299 aa  XERC_SHESM RecName: Full=Tyrosine recombinase xerC;
  132::278     3e-19  38%  299 aa  XERC_SHESA RecName: Full=Tyrosine recombinase xerC;
    3::295     3e-19  29%  299 aa  XERC_NATTJ RecName: Full=Tyrosine recombinase xerC;
    5::272     3e-19  29%  299 aa  XERC_CHRVO RecName: Full=Tyrosine recombinase xerC;
  149::307     3e-19  34%  312 aa  XERC_CHLPN RecName: Full=Tyrosine recombinase xerC;
  121::299     3e-19  31%  313 aa  XERC_VIBHB RecName: Full=Tyrosine recombinase xerC;
  130::292     3e-19  35%  314 aa  XERC_ROSCS RecName: Full=Tyrosine recombinase xerC;
  114::286     4e-19  33%  295 aa  XERC_HAES2 RecName: Full=Tyrosine recombinase xerC;
  121::285     6e-19  34%  316 aa  XERC_VIBVY RecName: Full=Tyrosine recombinase xerC;
  121::285     6e-19  34%  316 aa  XERC_VIBVU RecName: Full=Tyrosine recombinase xerC;
  132::293     6e-19  33%  298 aa  XERC_LACCB RecName: Full=Tyrosine recombinase xerC;
  132::293     6e-19  33%  298 aa  XERC_LACC3 RecName: Full=Tyrosine recombinase xerC;
    2::293     8e-19  29%  297 aa  XERD_LISMO RecName: Full=Tyrosine recombinase xerD;
    2::293     1e-18  28%  297 aa  XERD_LISMF RecName: Full=Tyrosine recombinase xerD;
  132::302     1e-18  43%  305 aa  XERC_TREDE RecName: Full=Tyrosine recombinase xerC;
  132::272     1e-18  37%  298 aa  XERC_PSEF5 RecName: Full=Tyrosine recombinase xerC;
  129::276     1e-18  37%  295 aa  XERC_HAEIN RecName: Full=Tyrosine recombinase xerC;
  129::276     1e-18  37%  295 aa  XERC_HAEIE RecName: Full=Tyrosine recombinase xerC;
  129::276     1e-18  37%  295 aa  XERC_HAEI8 RecName: Full=Tyrosine recombinase xerC;
  113::272     2e-18  35%  299 aa  XERC_PSEPF RecName: Full=Tyrosine recombinase xerC;
  113::272     2e-18  35%  299 aa  XERC_PSEFL RecName: Full=Tyrosine recombinase xerC;
  132::291     3e-18  35%  295 aa  XERD_STAHJ RecName: Full=Tyrosine recombinase xerD;
   22::276     3e-18  29%  296 aa  XERC_SHEAM RecName: Full=Tyrosine recombinase xerC;
   26::280     3e-18  32%  307 aa  XERC_ALCBS RecName: Full=Tyrosine recombinase xerC;
  124::279     3e-18  34%  284 aa  TNRI_BACTU RecName: Full=TnP I resolvase;
   21::288     5e-18  34%  311 aa  XERD_RHIME RecName: Full=Tyrosine recombinase xerD;
   84::295     5e-18  31%  310 aa  XERC_SYNAS RecName: Full=Tyrosine recombinase xerC;
  113::290     5e-18  31%  299 aa  XERC_PSEU5 RecName: Full=Tyrosine recombinase xerC;
   22::283     5e-18  26%  289 aa  VINT_BPL2 RecName: Full=Probable integrase/recombinase;AltName:
    2::291     8e-18  26%  295 aa  XERD_STAS1 RecName: Full=Tyrosine recombinase xerD;
  113::272     8e-18  35%  299 aa  XERC_PSEFS RecName: Full=Tyrosine recombinase xerC;
   29::283     8e-18  29%  307 aa  XERC_PROMI RecName: Full=Tyrosine recombinase xerC;
   25::275     1e-17  27%  298 aa  XERC_SHIF8 RecName: Full=Tyrosine recombinase xerC;
  133::275     1e-17  35%  298 aa  XERC_ECO27 RecName: Full=Tyrosine recombinase xerC;
  132::299     1e-17  31%  310 aa  XERC_VIBSL RecName: Full=Tyrosine recombinase xerC;
  133::275     1e-17  35%  298 aa  XERC_SHISS RecName: Full=Tyrosine recombinase xerC;
  133::275     1e-17  35%  298 aa  XERC_SHIFL RecName: Full=Tyrosine recombinase xerC;
  133::275     1e-17  35%  298 aa  XERC_SHIDS RecName: Full=Tyrosine recombinase xerC;
  133::275     1e-17  35%  298 aa  XERC_SHIBS RecName: Full=Tyrosine recombinase xerC;
  133::275     1e-17  35%  298 aa  XERC_SHIB3 RecName: Full=Tyrosine recombinase xerC;
  133::275     1e-17  35%  298 aa  XERC_ESCF3 RecName: Full=Tyrosine recombinase xerC;
  133::275     1e-17  35%  298 aa  XERC_ECOUT RecName: Full=Tyrosine recombinase xerC;
  133::275     1e-17  35%  298 aa  XERC_ECOSM RecName: Full=Tyrosine recombinase xerC;
  133::275     1e-17  35%  298 aa  XERC_ECOSE RecName: Full=Tyrosine recombinase xerC;
  133::275     1e-17  35%  298 aa  XERC_ECOLU RecName: Full=Tyrosine recombinase xerC;
  133::275     1e-17  35%  298 aa  XERC_ECOLI RecName: Full=Tyrosine recombinase xerC;
  133::275     1e-17  35%  298 aa  XERC_ECOLC RecName: Full=Tyrosine recombinase xerC;
  133::275     1e-17  35%  298 aa  XERC_ECOL6 RecName: Full=Tyrosine recombinase xerC;
  133::275     1e-17  35%  298 aa  XERC_ECOL5 RecName: Full=Tyrosine recombinase xerC;
  133::275     1e-17  35%  298 aa  XERC_ECOK1 RecName: Full=Tyrosine recombinase xerC;
  133::275     1e-17  35%  298 aa  XERC_ECOHS RecName: Full=Tyrosine recombinase xerC;
  133::275     1e-17  35%  298 aa  XERC_ECODH RecName: Full=Tyrosine recombinase xerC;
  133::275     1e-17  35%  298 aa  XERC_ECOBW RecName: Full=Tyrosine recombinase xerC;
  133::275     1e-17  35%  298 aa  XERC_ECO8A RecName: Full=Tyrosine recombinase xerC;
  133::275     1e-17  35%  298 aa  XERC_ECO81 RecName: Full=Tyrosine recombinase xerC;
  133::275     1e-17  35%  298 aa  XERC_ECO7I RecName: Full=Tyrosine recombinase xerC;
  133::275     1e-17  35%  298 aa  XERC_ECO55 RecName: Full=Tyrosine recombinase xerC;
  133::275     1e-17  35%  298 aa  XERC_ECO45 RecName: Full=Tyrosine recombinase xerC;
  133::275     1e-17  35%  298 aa  XERC_ECO24 RecName: Full=Tyrosine recombinase xerC;
    4::291     2e-17  28%  295 aa  XERD_STAAW RecName: Full=Tyrosine recombinase xerD;
    4::291     2e-17  28%  295 aa  XERD_STAAU RecName: Full=Tyrosine recombinase xerD;
    4::291     2e-17  28%  295 aa  XERD_STAAS RecName: Full=Tyrosine recombinase xerD;
    4::291     2e-17  28%  295 aa  XERD_STAAR RecName: Full=Tyrosine recombinase xerD;
    4::291     2e-17  28%  295 aa  XERD_STAAN RecName: Full=Tyrosine recombinase xerD;
    4::291     2e-17  28%  295 aa  XERD_STAAM RecName: Full=Tyrosine recombinase xerD;
    4::291     2e-17  28%  295 aa  XERD_STAAC RecName: Full=Tyrosine recombinase xerD;
  133::292     2e-17  36%  297 aa  XERC_MYCLE RecName: Full=Tyrosine recombinase xerC;
  133::275     2e-17  35%  298 aa  XERC_ECO5E RecName: Full=Tyrosine recombinase xerC;
  133::275     2e-17  35%  298 aa  XERC_ECO57 RecName: Full=Tyrosine recombinase xerC;
    8::293     2e-17  29%  298 aa  XERD_SALTY RecName: Full=Tyrosine recombinase xerD;
    8::293     2e-17  29%  298 aa  XERD_SALTI RecName: Full=Tyrosine recombinase xerD;
    6::293     2e-17  28%  297 aa  XERD_PASMU RecName: Full=Tyrosine recombinase xerD;
    8::293     2e-17  30%  298 aa  XERD_ECO57 RecName: Full=Tyrosine recombinase xerD;
  137::279     2e-17  35%  303 aa  XERC_YERPE RecName: Full=Tyrosine recombinase xerC;
  130::282     2e-17  34%  313 aa  XERC_ROSS1 RecName: Full=Tyrosine recombinase xerC;
   34::308     3e-17  31%  313 aa  XERD_PROMI RecName: Full=Tyrosine recombinase xerD;
  140::300     3e-17  34%  304 aa  XERD_CHLTE RecName: Full=Tyrosine recombinase xerD;
  135::277     3e-17  35%  300 aa  XERC_SALTY RecName: Full=Tyrosine recombinase xerC;
  135::277     3e-17  35%  300 aa  XERC_SALTI RecName: Full=Tyrosine recombinase xerC;
    8::293     4e-17  30%  298 aa  XERD_SHIFL RecName: Full=Tyrosine recombinase xerD;
    8::293     4e-17  30%  298 aa  XERD_ECOLI RecName: Full=Tyrosine recombinase xerD;
    8::293     4e-17  30%  298 aa  XERD_ECOL6 RecName: Full=Tyrosine recombinase xerD;
   34::296     5e-17  32%  322 aa  XERC_XANCP RecName: Full=Tyrosine recombinase xerC;
   34::296     5e-17  32%  322 aa  XERC_XANCB RecName: Full=Tyrosine recombinase xerC;
   34::296     5e-17  32%  322 aa  XERC_XANC8 RecName: Full=Tyrosine recombinase xerC;
    2::294     1e-16  28%  299 aa  XERD_YERPE RecName: Full=Tyrosine recombinase xerD;
  129::279     1e-16  36%  305 aa  XERC_XANAC RecName: Full=Tyrosine recombinase xerC;
   20::290     2e-16  26%  291 aa  XERD_NEIMB RecName: Full=Tyrosine recombinase xerD;
   20::290     2e-16  26%  291 aa  XERD_NEIMA RecName: Full=Tyrosine recombinase xerD;
   15::270     2e-16  29%  286 aa  XERC_THELT RecName: Full=Tyrosine recombinase xerC;
  129::284     2e-16  33%  298 aa  XERC_CHRSD RecName: Full=Tyrosine recombinase xerC;
   19::293     4e-16  27%  297 aa  XERD_HAEDU RecName: Full=Tyrosine recombinase xerD;
  116::279     4e-16  32%  303 aa  XERC_SERMA RecName: Full=Tyrosine recombinase xerC;
  123::276     4e-16  33%  299 aa  XERC_PSYIN RecName: Full=Tyrosine recombinase xerC;
  133::284     4e-16  37%  300 aa  XERC_MYXXD RecName: Full=Tyrosine recombinase xerC;
  133::284     4e-16  37%  300 aa  XERC_MYXXA RecName: Full=Tyrosine recombinase xerC;
    3::272     4e-16  28%  295 aa  XERC_ACTSZ RecName: Full=Tyrosine recombinase xerC;
   20::289     8e-16  28%  305 aa  XERC_NEIMA RecName: Full=Tyrosine recombinase xerC;
    2::287     1e-15  27%  292 aa  XERD_CLOAB RecName: Full=Tyrosine recombinase xerD;
  138::292     1e-15  36%  308 aa  XERD_BIFLO RecName: Full=Tyrosine recombinase xerD;
  113::272     1e-15  31%  299 aa  XERC_PSEPW RecName: Full=Tyrosine recombinase xerC;
   18::295     1e-15  26%  306 aa  XERD_RICCN RecName: Full=Tyrosine recombinase xerD;
    3::293     1e-15  26%  297 aa  XERD_HAEIN RecName: Full=Tyrosine recombinase xerD;
  166::331     1e-15  33%  336 aa  XERC_CHLTE RecName: Full=Tyrosine recombinase xerC;
   20::289     2e-15  28%  305 aa  XERC_NEIMF RecName: Full=Tyrosine recombinase xerC;
  136::295     2e-15  33%  300 aa  XERC_MYCGI RecName: Full=Tyrosine recombinase xerC;
  135::290     3e-15  31%  302 aa  XERC_PELPD RecName: Full=Tyrosine recombinase xerC;
   20::289     3e-15  26%  305 aa  XERC_NEIG2 RecName: Full=Tyrosine recombinase xerC;
   20::289     3e-15  26%  305 aa  XERC_NEIG1 RecName: Full=Tyrosine recombinase xerC;
   18::294     4e-15  27%  305 aa  XERD_RICBR RecName: Full=Tyrosine recombinase xerD;
  140::286     4e-15  36%  306 aa  XERC_EUBR3 RecName: Full=Tyrosine recombinase xerC;
   18::295     5e-15  26%  306 aa  XERD_RICFE RecName: Full=Tyrosine recombinase xerD;
  142::310     5e-15  37%  328 aa  XERC_RALPJ RecName: Full=Tyrosine recombinase xerC;
   20::289     5e-15  27%  305 aa  XERC_NEIM0 RecName: Full=Tyrosine recombinase xerC;
  129::288     7e-15  37%  293 aa  XERD_LACCA RecName: Full=Tyrosine recombinase xerD;
    2::270     7e-15  26%  294 aa  XERC_XYLFA RecName: Full=Tyrosine recombinase xerC;
  160::306     7e-15  36%  328 aa  XERC_SYNFM RecName: Full=Tyrosine recombinase xerC;
   22::301     7e-15  28%  317 aa  XERC_GEOLS RecName: Full=Tyrosine recombinase xerC;
  132::272     7e-15  31%  299 aa  XERC_AZOVD RecName: Full=Tyrosine recombinase xerC;
  166::331     9e-15  33%  336 aa  XERC_PELPB RecName: Full=Tyrosine recombinase xerC;
  166::331     9e-15  31%  336 aa  XERC_CHLP8 RecName: Full=Tyrosine recombinase xerC;
   18::295     1e-14  26%  311 aa  XERD_RICPR RecName: Full=Tyrosine recombinase xerD;
  191::347     1e-14  37%  353 aa  XERC_THETN RecName: Full=Tyrosine recombinase xerC;
   20::285     1e-14  25%  301 aa  XERC_NEIMB RecName: Full=Tyrosine recombinase xerC;
  140::294     1e-14  32%  304 aa  XERD_CORGL RecName: Full=Tyrosine recombinase xerD;
   22::295     2e-14  25%  300 aa  XERD_SHEON RecName: Full=Tyrosine recombinase xerD;
    2::270     2e-14  26%  294 aa  XERC_XYLFT RecName: Full=Tyrosine recombinase xerC;
    2::270     2e-14  26%  294 aa  XERC_XYLF2 RecName: Full=Tyrosine recombinase xerC;
  132::272     2e-14  31%  303 aa  XERC_PSEAE RecName: Full=Tyrosine recombinase xerC;
  132::272     2e-14  32%  303 aa  XERC_PSEA7 RecName: Full=Tyrosine recombinase xerC;
  132::272     3e-14  31%  303 aa  XERC_PSEAB RecName: Full=Tyrosine recombinase xerC;
  132::272     3e-14  31%  303 aa  XERC_PSEA8 RecName: Full=Tyrosine recombinase xerC;
   14::301     3e-14  28%  308 aa  XERD_RALSO RecName: Full=Tyrosine recombinase xerD;
  175::352     4e-14  33%  356 aa  XERS_STRPI RecName: Full=Tyrosine recombinase xerS;
    8::297     4e-14  25%  302 aa  XERD_VIBCH RecName: Full=Tyrosine recombinase xerD;
   19::271     4e-14  30%  283 aa  XERC_THEAB RecName: Full=Tyrosine recombinase xerC;
   17::295     4e-14  26%  300 aa  XERC_MYCS2 RecName: Full=Tyrosine recombinase xerC;
  196::352     6e-14  35%  356 aa  XERS_STRZT RecName: Full=Tyrosine recombinase xerS;
  196::352     6e-14  35%  356 aa  XERS_STRZP RecName: Full=Tyrosine recombinase xerS;
  196::352     6e-14  35%  356 aa  XERS_STRZJ RecName: Full=Tyrosine recombinase xerS;
  196::352     6e-14  35%  356 aa  XERS_STRR6 RecName: Full=Tyrosine recombinase xerS;
  196::352     6e-14  35%  356 aa  XERS_STRPS RecName: Full=Tyrosine recombinase xerS;
  196::352     6e-14  35%  356 aa  XERS_STRPJ RecName: Full=Tyrosine recombinase xerS;
  196::352     6e-14  35%  356 aa  XERS_STRP7 RecName: Full=Tyrosine recombinase xerS;
  196::352     6e-14  35%  356 aa  XERS_STRP4 RecName: Full=Tyrosine recombinase xerS;
  196::352     6e-14  35%  356 aa  XERS_STRP2 RecName: Full=Tyrosine recombinase xerS;
  196::352     7e-14  35%  356 aa  XERS_STRPN RecName: Full=Tyrosine recombinase xerS;
   15::300     1e-13  27%  305 aa  XERD_VIBVY RecName: Full=Tyrosine recombinase xerD;
   15::300     1e-13  27%  305 aa  XERD_VIBVU RecName: Full=Tyrosine recombinase xerD;
  145::294     1e-13  36%  311 aa  XERD_MYCTU RecName: Full=Tyrosine recombinase xerD;
  145::294     1e-13  36%  311 aa  XERD_MYCBO RecName: Full=Tyrosine recombinase xerD;
   66::293     1e-13  25%  303 aa  XERC_BACHD RecName: Full=Tyrosine recombinase xerC;
  196::355     2e-13  35%  356 aa  XERS_STRA5 RecName: Full=Tyrosine recombinase xerS;
  196::355     2e-13  35%  356 aa  XERS_STRA3 RecName: Full=Tyrosine recombinase xerS;
  196::355     2e-13  35%  356 aa  XERS_STRA1 RecName: Full=Tyrosine recombinase xerS;
  136::295     2e-13  30%  300 aa  XERC_MYCSS RecName: Full=Tyrosine recombinase xerC;
  136::295     2e-13  30%  300 aa  XERC_MYCSK RecName: Full=Tyrosine recombinase xerC;
  136::295     2e-13  30%  300 aa  XERC_MYCSJ RecName: Full=Tyrosine recombinase xerC;
  134::293     3e-13  34%  298 aa  XERC_MYCTU RecName: Full=Tyrosine recombinase xerC;
  134::293     3e-13  34%  298 aa  XERC_MYCTA RecName: Full=Tyrosine recombinase xerC;
  134::293     3e-13  34%  298 aa  XERC_MYCBT RecName: Full=Tyrosine recombinase xerC;
  134::293     3e-13  34%  298 aa  XERC_MYCBP RecName: Full=Tyrosine recombinase xerC;
  134::293     3e-13  34%  298 aa  XERC_MYCBO RecName: Full=Tyrosine recombinase xerC;
  155::312     3e-13  35%  347 aa  XERC2_RALSO RecName: Full=Tyrosine recombinase xerC 2;
  143::311     3e-13  36%  329 aa  XERC1_RALSO RecName: Full=Tyrosine recombinase xerC 1;
  134::288     4e-13  36%  305 aa  XERD_RHILO RecName: Full=Tyrosine recombinase xerD;
  113::272     4e-13  30%  299 aa  XERC_PSEPG RecName: Full=Tyrosine recombinase xerC;
    2::275     4e-13  30%  286 aa  XERCL_PYRAB RecName: Full=Probable tyrosine recombinase xerC-like;
  196::352     5e-13  34%  356 aa  XERS_STRT2 RecName: Full=Tyrosine recombinase xerS;
  196::352     5e-13  34%  356 aa  XERS_STRT1 RecName: Full=Tyrosine recombinase xerS;
  196::355     5e-13  34%  356 aa  XERS_STRGC RecName: Full=Tyrosine recombinase xerS;
  258::408     6e-13  38%  425 aa  Y4RF_RHISN RecName: Full=Putative integrase/recombinase y4rF;
  113::272     6e-13  29%  299 aa  XERC_PSEP1 RecName: Full=Tyrosine recombinase xerC;
  196::355     8e-13  34%  356 aa  XERS_STRSV RecName: Full=Tyrosine recombinase xerS;
  135::291     8e-13  30%  298 aa  XERD_PSEPK RecName: Full=Tyrosine recombinase xerD;
  129::293     8e-13  30%  298 aa  XERD_PSEAE RecName: Full=Tyrosine recombinase xerD;
  113::272     8e-13  29%  299 aa  XERC_PSEPK RecName: Full=Tyrosine recombinase xerC;
  196::352     1e-12  34%  356 aa  XERS_STRTD RecName: Full=Tyrosine recombinase xerS;
  187::355     1e-12  33%  356 aa  XERS_STRMU RecName: Full=Tyrosine recombinase xerS;
  146::306     1e-12  36%  318 aa  XERD_BRAJA RecName: Full=Tyrosine recombinase xerD;
  152::318     1e-12  32%  323 aa  XERD_XANCP RecName: Full=Tyrosine recombinase xerD;
  141::294     2e-12  32%  332 aa  Y4RC_RHISN RecName: Full=Putative integrase/recombinase y4rC;
  135::298     2e-12  31%  305 aa  XERD_XANAC RecName: Full=Tyrosine recombinase xerD;
    5::294     2e-12  24%  304 aa  XERD_COREF RecName: Full=Tyrosine recombinase xerD;
  196::355     3e-12  33%  356 aa  XERS_STRU0 RecName: Full=Tyrosine recombinase xerS;
  196::352     3e-12  33%  356 aa  XERS_STRPG RecName: Full=Tyrosine recombinase xerS;
  196::352     3e-12  33%  356 aa  XERS_STRP6 RecName: Full=Tyrosine recombinase xerS;
  131::274     3e-12  32%  306 aa  XERC_ERYLH RecName: Full=Tyrosine recombinase xerC;
  196::352     5e-12  33%  356 aa  XERS_STRPZ RecName: Full=Tyrosine recombinase xerS;
  196::352     5e-12  33%  356 aa  XERS_STRPM RecName: Full=Tyrosine recombinase xerS;
  196::352     5e-12  33%  356 aa  XERS_STRPF RecName: Full=Tyrosine recombinase xerS;
  196::352     5e-12  33%  356 aa  XERS_STRPD RecName: Full=Tyrosine recombinase xerS;
  196::352     5e-12  33%  356 aa  XERS_STRPB RecName: Full=Tyrosine recombinase xerS;
  196::352     5e-12  33%  356 aa  XERS_STRP8 RecName: Full=Tyrosine recombinase xerS;
  196::352     5e-12  33%  356 aa  XERS_STRP3 RecName: Full=Tyrosine recombinase xerS;
  196::352     5e-12  33%  356 aa  XERS_STRP1 RecName: Full=Tyrosine recombinase xerS;
   39::308     5e-12  27%  324 aa  XERD_XYLFT RecName: Full=Tyrosine recombinase xerD;
  113::272     7e-12  27%  299 aa  XERC_PSEE4 RecName: Full=Tyrosine recombinase xerC;
    8::299     7e-12  27%  306 aa  XERC_PELTS RecName: Full=Tyrosine recombinase xerC;
  196::350     9e-12  34%  356 aa  XERS_STRPC RecName: Full=Tyrosine recombinase xerS;
   20::292     9e-12  25%  305 aa  XERC_RICPR RecName: Full=Tyrosine recombinase xerC;
  128::292     1e-11  33%  305 aa  XERD_CAUCR RecName: Full=Tyrosine recombinase xerD;
   43::292     1e-11  25%  305 aa  XERC_RICAE RecName: Full=Tyrosine recombinase xerC;
   43::292     2e-11  25%  305 aa  XERC_RICPU RecName: Full=Tyrosine recombinase xerC;
   43::292     2e-11  25%  305 aa  XERC_RICFE RecName: Full=Tyrosine recombinase xerC;
  162::311     2e-11  35%  330 aa  Y367_METJA RecName: Full=Probable integrase/recombinase protein
  139::284     2e-11  33%  301 aa  XERD_CHLPN RecName: Full=Tyrosine recombinase xerD;
   14::286     3e-11  23%  290 aa  XERDL_THETN RecName: Full=Tyrosine recombinase xerD-like protein;
   43::292     3e-11  25%  305 aa  XERC_RICCN RecName: Full=Tyrosine recombinase xerC;
   39::308     3e-11  27%  324 aa  XERD_XYLFA RecName: Full=Tyrosine recombinase xerD;
   43::292     3e-11  25%  305 aa  XERC_RICM5 RecName: Full=Tyrosine recombinase xerC;
  159::310     3e-11  29%  321 aa  XERC_BRAJA RecName: Full=Tyrosine recombinase xerC;
  196::355     5e-11  31%  356 aa  XERS_STRS7 RecName: Full=Tyrosine recombinase xerS;
  196::355     5e-11  31%  356 aa  XERS_STREM RecName: Full=Tyrosine recombinase xerS;
  138::283     6e-11  34%  300 aa  XERD_CHLTR RecName: Full=Tyrosine recombinase xerD;
  196::355     8e-11  31%  356 aa  XERS_STRE4 RecName: Full=Tyrosine recombinase xerS;
  158::299     8e-11  34%  316 aa  XERD_MYCLE RecName: Full=Tyrosine recombinase xerD;
   43::292     8e-11  25%  305 aa  XERC_RICRS RecName: Full=Tyrosine recombinase xerC;
   43::292     8e-11  25%  305 aa  XERC_RICRO RecName: Full=Tyrosine recombinase xerC;
  154::304     1e-10  30%  341 aa  XERC_RHOCS RecName: Full=Tyrosine recombinase xerC;
  260::515     1e-10  28%  630 aa  TNPE_STAAU RecName: Full=Transposase B from transposon PsiTn554;
  356::515     1e-10  35%  630 aa  TNPB_STAAU RecName: Full=Transposase B from transposon Tn554;
  356::515     1e-10  35%  630 aa  TNPB_STAAN RecName: Full=Transposase B from transposon Tn554;
  356::515     1e-10  35%  630 aa  TNPB_STAAM RecName: Full=Transposase B from transposon Tn554;
   36::310     2e-10  28%  321 aa  XERC_NITWN RecName: Full=Tyrosine recombinase xerC;
  180::367     2e-10  33%  391 aa  XERCL_THETN RecName: Full=Tyrosine recombinase xerC-like;
  196::352     3e-10  30%  356 aa  XERS_STRSY RecName: Full=Tyrosine recombinase xerS;
  196::352     3e-10  30%  356 aa  XERS_STRS2 RecName: Full=Tyrosine recombinase xerS;
  143::292     3e-10  31%  309 aa  XERD_BRUSU RecName: Full=Tyrosine recombinase xerD;
  143::292     3e-10  31%  309 aa  XERD_BRUME RecName: Full=Tyrosine recombinase xerD;
  146::306     5e-10  32%  320 aa  XERC_SYNE7 RecName: Full=Tyrosine recombinase xerC;
  138::288     8e-10  32%  301 aa  XERD_CHLMU RecName: Full=Tyrosine recombinase xerD;
   45::292     8e-10  26%  305 aa  XERC_RICCK RecName: Full=Tyrosine recombinase xerC;
  167::354     8e-10  30%  361 aa  TNPA_STAAU RecName: Full=Transposase A from transposon Tn554;
  167::354     8e-10  30%  361 aa  TNPA_STAAN RecName: Full=Transposase A from transposon Tn554;
  167::354     8e-10  30%  361 aa  TNPA_STAAM RecName: Full=Transposase A from transposon Tn554;
  237::393     1e-09  33%  409 aa  Y4RA_RHISN RecName: Full=Putative integrase/recombinase y4rA;
  144::292     1e-09  29%  305 aa  XERC_RICTY RecName: Full=Tyrosine recombinase xerC;
  143::292     2e-09  30%  309 aa  XERD_BRUAB RecName: Full=Tyrosine recombinase xerD;
  143::292     2e-09  30%  309 aa  XERD_BRUA2 RecName: Full=Tyrosine recombinase xerD;
  155::300     3e-09  30%  315 aa  XERC_AGRT5 RecName: Full=Tyrosine recombinase xerC;
  144::301     3e-09  31%  427 aa  XERCL_PSEAE RecName: Full=Tyrosine recombinase xerC-like;
  134::283     6e-09  35%  308 aa  Y4QK_RHISN RecName: Full=Putative integrase/recombinase y4qK;
   43::285     6e-09  23%  305 aa  XERC_RICAH RecName: Full=Tyrosine recombinase xerC;
  151::314     7e-09  32%  331 aa  XERD_AGRT5 RecName: Full=Tyrosine recombinase xerD;
  158::303     7e-09  30%  318 aa  XERC_RHIME RecName: Full=Tyrosine recombinase xerC;
  139::315     1e-08  39%  337 aa  INT2_SALTI RecName: Full=Integrase/recombinase;AltName: Full=E2
  139::315     1e-08  39%  337 aa  INT2_PSEAE RecName: Full=Integrase/recombinase;AltName: Full=E2
  139::315     1e-08  39%  337 aa  INT2_ECOLX RecName: Full=Integrase/recombinase;AltName: Full=E2
  106::244     2e-08  32%  250 aa  XERC_UREPA RecName: Full=Tyrosine recombinase xerC;
  154::310     2e-08  27%  315 aa  XERC_BRUME RecName: Full=Tyrosine recombinase xerC;
  154::310     4e-08  28%  315 aa  XERC_BRUSU RecName: Full=Tyrosine recombinase xerC;
   23::178     8e-08  21%  181 aa  YOEC_BACSU RecName: Full=Probable integrase/recombinase yoeC;
   82::226     8e-08  34%  251 aa  Y4EF_RHISN RecName: Full=Putative integrase/recombinase y4eF;
  196::352     8e-08  29%  356 aa  XERS_LACLS RecName: Full=Tyrosine recombinase xerS;
  196::352     8e-08  29%  356 aa  XERS_LACLM RecName: Full=Tyrosine recombinase xerS;
  138::252     1e-07  37%  310 aa  Y4RE_RHISN RecName: Full=Putative integrase/recombinase y4rE;
  151::297     1e-07  32%  312 aa  XERC_RHILO RecName: Full=Tyrosine recombinase xerC;
  196::352     7e-07  28%  356 aa  XERS_LACLA RecName: Full=Tyrosine recombinase xerS;
   26::170     1e-06  32%  192 aa  Y4GC_RHISN RecName: Full=Putative integrase/recombinase y4gC;
  144::296     1e-06  33%  315 aa  YZ09_AQUAE RecName: Full=Probable integrase/recombinase aq_aa09;
   27::175     1e-06  30%  198 aa  FIME_SHIFL RecName: Full=Type 1 fimbriae regulatory protein fimE;
   27::175     1e-06  30%  198 aa  FIME_ECOLI RecName: Full=Type 1 fimbriae regulatory protein fimE;
   27::175     1e-06  30%  198 aa  FIME_ECOL6 RecName: Full=Type 1 fimbriae regulatory protein fimE;
  170::302     3e-06  29%  320 aa  XERC_METS4 RecName: Full=Tyrosine recombinase xerC;
  139::306     7e-06  29%  313 aa  XERC_SYNY3 RecName: Full=Tyrosine recombinase xerC;
  137::291     1e-05  31%  314 aa  Y4RB_RHISN RecName: Full=Putative integrase/recombinase y4rB;
  170::302     1e-05  27%  322 aa  XERC_METNO RecName: Full=Tyrosine recombinase xerC;
  178::319     3e-05  30%  335 aa  GP8D_CHLPS RecName: Full=Virulence plasmid integrase pGP8-D;
  174::354     6e-05  27%  371 aa  VINT_BPML5 RecName: Full=Integrase;
  135::314     6e-05  25%  333 aa  VINT_BPMD2 RecName: Full=Integrase;
  135::314     1e-04  25%  333 aa  VINT_BPMFR RecName: Full=Integrase;
  190::241     1e-04  35%  260 aa  REDM_ECOLX RecName: Full=Resolvase;AltName: Full=Protein D;
  199::250     1e-04  35%  268 aa  REDF_ECOLI RecName: Full=Resolvase;AltName: Full=Protein D;
  144::292     2e-04  30%  473 aa  XERC_PSESX RecName: Full=Putative tyrosine recombinase xerC;
  204::363     2e-04  21%  387 aa  VINT_BPP22 RecName: Full=Integrase;
  204::363     2e-04  21%  387 aa  INTD_ECOLI RecName: Full=Prophage DLP12 integrase;AltName:
  173::314     3e-04  26%  330 aa  GP8D_CHLTR RecName: Full=Virulence plasmid integrase
  226::373     4e-04  28%  402 aa  VINT_BPPH8 RecName: Full=Integrase;
   45::180     4e-04  28%  200 aa  FIMB_ECOLI RecName: Full=Type 1 fimbriae regulatory protein fimB;
   45::180     4e-04  28%  200 aa  FIMB_ECO57 RecName: Full=Type 1 fimbriae regulatory protein fimB;
  195::335     5e-04  25%  374 aa  VLF1_NPVOP RecName: Full=Very late expression factor 1;
  173::314     5e-04  26%  330 aa  GP8D_CHLMU RecName: Full=Virulence plasmid integrase pGP8-D;
   91::224     7e-04  26%  356 aa  VINT_BP434 RecName: Full=Integrase;
  283::354     7e-04  33%  388 aa  INTR_STRAM RecName: Full=Integrase;
    1::321

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKKQQKYSNNNLLQLFITAKQVEGCSSKTIRYYQRT
XERC_STAAB      -------------------------------------------NHIQEAFLNTLKVENFSEHTLKSYQDD
XERC_OCEIH      ----------------------------------------------IDTFVEYLQIENASPYTVKYYRND
XERC_STAAN      -------------------------------------------NHIQEAFLNTLKVENFSEHTLKSYQDD
XERC_STAAM      -------------------------------------------NHIQEAFLNTLKVENFSEHTLKSYQDD
XERC_STAA9      -------------------------------------------NHIQEAFLNTLKVENFSEHTLKSYQDD
XERC_STAA2      -------------------------------------------NHIQEAFLNTLKVENFSEHTLKSYQDD
XERC_STAA1      -------------------------------------------NHIQEAFLNTLKVENFSEHTLKSYQDD
XERC_STAAT      -------------------------------------------NHIQDAFLNTLKVENFSEHTLKSYQDD
XERC_STAAR      -------------------------------------------NHIQEAFLNTLKVENFSEHTLKSYQDD
XERC_STAAE      -------------------------------------------NHIQDAFLNTLKVENFSEHTLKSYQDD
XERC_STAAC      -------------------------------------------NHIQDAFLNTLKVENFSEHTLKSYQDD
XERC_STAA8      -------------------------------------------NHIQDAFLNTLKVENFSEHTLKSYQDD
XERC_STAA3      -------------------------------------------NHIQDAFLNTLKVENFSEHTLKSYQDD
XERC_LEPIN      -----------------------------------------SLNETAKKFINYLKIENYSQNTINAYSID
XERC_LEPIC      -----------------------------------------SLNETAKKFINYLKIENYSQNTINAYSID
XERC_STAAW      -------------------------------------------NHIQEAFLNTLKVENFSEHTLKSYQDD
XERC_STAAS      -------------------------------------------NHIQEAFLNTLKVENFSEHTLKSYQDD
XERC_STAAU      -------------------------------------------NHIQEAFLNTLKVENFSEHTLKSYQDD
XERC_CORGL      -------------------------------------------------------VVGRSAATIRGYRSD
XERCL_PYRHO     -----------------------------------KEREEIVNSDILEEFATYLELEGKSKNTIRMYTYY
XERC_PYRFU      -------------------------------------REKTLRSEVLEEFATYLELEGKSKNTIRMYTYF
XERC_HERA2      ----------------------------------------------LEQFLAYLTVEGLTGNTIAAYRTD
XERC_STAS1      -----------------------------------------------------------SEHTLKSYHDD
XERC_PEDPA      ----------------------------------------------------------------------
XERC_ANOFW      -------------------------------------------NFTLNLFIEYLQIENYSEYTIACYKHD
XERC_BACSU      --------------------------------------------NFVKLFVEYLQIEK------NYSQYT
XERC_HAEDU      -----------------------------------------------------------SPHTLTNYQRQ
XERC_BACP2      -----------------------------------------NKQRLVHLFIEYLQIENYSALTISGYTEA
XERC_CHLTR      ----------------------------------------------------------------------
XERC_CHLTB      ----------------------------------------------------------------------
XERC_CHLTA      ----------------------------------------------------------------------
XERC_CHLT2      ----------------------------------------------------------------------
XERC_LISIN      ----------------------------------------------------------------------
XERC_LISMO      ----------------------------------------------------------------------
XERC_THEYD      -----------------------------------------------------KLQKGDSSHTLRAYKND
XERC_STAHJ      -------------------------------------------------FLNMLKVENFSAHTLKSYHDD
XERC_LISW6      ----------------------------------------------------------------------
XERC_STAES      -------------------------------------------DKIQETFLYMLKVENFSEYTLKSYHDD
XERC_STAEQ      -------------------------------------------DKIQETFLYMLKVENFSEYTLKSYHDD
XERC_LISMF      ----------------------------------------------------------------------
XERC_LISMC      ----------------------------------------------------------------------
XERC_LISMH      ----------------------------------------------------------------------
XERC_CHLMU      ----------------------------------------------------------------------
XERD_BACHD      ------------------------------------------NNNLQQFLHFQKVERGLSNNTIQSYGRD
XERC_PSE14      -----------------------------------------------------------SPHTLEAYRRD
XERC_COREF      -------------------------------------------------------VVGRSDATVRGYRSD
XERCL_METTH     ----------------------------------------------------------------------
XERD_LEPIN      -----------------------------------------SHNNLLQNFQEYLSVEGLSDNSIYSYGYD
XERD_LEPIC      -----------------------------------------SHNNLLQNFQEYLSVEGLSDNSIYSYGYD
XERC_PSESM      -----------------------------------------------------------SPHTLEAYRRD
XERC_CHLAB      ----------------------------------------------------------------------
XERC_PSEU2      -----------------------------------------------------------SPHTLEAYRRD
XERC_CHLCV      ----------------------------------------------------------------------
XERC_PASMU      -----------------------------------------------------------SPHTLTNYQRQ
XERD_OCEIH      ----------------------------------------------------------------------
XERC_MANSM      -----------------------------------------------------------SSYTLTNYQRQ
XERC_CHLFF      ----------------------------------------------------------------------
XERC_STACT      -------------------------------------------NKIQESFLYMLKVERFFSKTLKSYHDD
XERC_SHESW      ----------------------------------------------------------------------
XERC_SHEPC      ----------------------------------------------------------------------
XERCL_THEON     -------------------------------------------NEVIEEYETYLDLEGKSPNTIRMYSYY
XERC_LACLE      ----------------------------------------------------------------------
XERC_SHEON      ----------------------------------------------------------------------
XERC_LACDB      ----------------------------------------------------------------------
XERC_LACDA      ----------------------------------------------------------------------
XERC_ACTP7      ----------------------------------------------------------------------
XERD_BACSU      -------------------------------------------------FIHYVMVEGLSQNTIVSYERD
XERC_BACLD      --------------------------------------------NFLTLFIEYLQIEKNYSKTIVGYISS
XERCL_PYRKO     -------------------------------------------NEVIEEFETYLDLEGKSPHTIRMYTYY
XERD_STAEQ      -------------------------------------------NTIIEEYLNFIQIEGLSNNTIGAYRRD
XERD_LISIN      -------------------------------------------NDLIDDFLHFLIVEGLSANTIKAYERD
XERD_STAES      -------------------------------------------NTIIEEYLNFIQIEGLSNNTIGAYRRD
XERC_BIFLI      ----------------------------------------------------------------------
XERC_BIFLD      ----------------------------------------------------------------------
XERC_VIBPA      ----------------------------------------------------------------------
XERC_VIBCM      ----------------------------------------------------------------------
XERC_VIBCH      ----------------------------------------------------------------------
XERC_VIBC3      ----------------------------------------------------------------------
XERC_SHESR      ----------------------------------------------------------------------
XERC_SHESM      ----------------------------------------------------------------------
XERC_SHESA      ----------------------------------------------------------------------
XERC_NATTJ      -------------------------------------------NELLDFLEFLKGEKNLSHYTVDNYYKD
XERC_CHRVO      ----------------------------------------------IRRFIEHLAVAGRSPHTLAAYRAD
XERC_CHLPN      ----------------------------------------------------------------------
XERC_VIBHB      ----------------------------------------------------------------------
XERC_ROSCS      ----------------------------------------------------------------------
XERC_HAES2      ----------------------------------------------------------------------
XERC_VIBVY      ----------------------------------------------------------------------
XERC_VIBVU      ----------------------------------------------------------------------
XERC_LACCB      ----------------------------------------------------------------------
XERC_LACC3      ----------------------------------------------------------------------
XERD_LISMO      -------------------------------------------NDLIEDFLHFLIVEGLSANTIKAYERD
XERD_LISMF      -------------------------------------------NDLIEDFLHFLIVEGLSANTIKAYERD
XERC_TREDE      ----------------------------------------------------------------------
XERC_PSEF5      ----------------------------------------------------------------------
XERC_HAEIN      ----------------------------------------------------------------------
XERC_HAEIE      ----------------------------------------------------------------------
XERC_HAEI8      ----------------------------------------------------------------------
XERC_PSEPF      ----------------------------------------------------------------------
XERC_PSEFL      ----------------------------------------------------------------------
XERD_STAHJ      ----------------------------------------------------------------------
XERC_SHEAM      -----------------------------------------------------------SPMTVRNYRFE
XERC_ALCBS      -----------------------------------------------------------SPHTVNGYQRD
TNRI_BACTU      ----------------------------------------------------------------------
XERD_RHIME      ---------------------------------------------------------GAAANTLQSYERD
XERC_SYNAS      ----------------------------------------------------------------------
XERC_PSEU5      ----------------------------------------------------------------------
VINT_BPL2       --------------------------------------------------------------TNRYHYRI
XERD_STAS1      -------------------------------------------DTIIEEYLKFIQLEGLSSNTIGAYRRD
XERC_PSEFS      ----------------------------------------------------------------------
XERC_PROMI      -----------------------------------------------------------SPVTVENYQRT
XERC_SHIF8      --------------------------------------------------------------TLLNYQRQ
XERC_ECO27      ----------------------------------------------------------------------
XERC_VIBSL      ----------------------------------------------------------------------
XERC_SHISS      ----------------------------------------------------------------------
XERC_SHIFL      ----------------------------------------------------------------------
XERC_SHIDS      ----------------------------------------------------------------------
XERC_SHIBS      ----------------------------------------------------------------------
XERC_SHIB3      ----------------------------------------------------------------------
XERC_ESCF3      ----------------------------------------------------------------------
XERC_ECOUT      ----------------------------------------------------------------------
XERC_ECOSM      ----------------------------------------------------------------------
XERC_ECOSE      ----------------------------------------------------------------------
XERC_ECOLU      ----------------------------------------------------------------------
XERC_ECOLI      ----------------------------------------------------------------------
XERC_ECOLC      ----------------------------------------------------------------------
XERC_ECOL6      ----------------------------------------------------------------------
XERC_ECOL5      ----------------------------------------------------------------------
XERC_ECOK1      ----------------------------------------------------------------------
XERC_ECOHS      ----------------------------------------------------------------------
XERC_ECODH      ----------------------------------------------------------------------
XERC_ECOBW      ----------------------------------------------------------------------
XERC_ECO8A      ----------------------------------------------------------------------
XERC_ECO81      ----------------------------------------------------------------------
XERC_ECO7I      ----------------------------------------------------------------------
XERC_ECO55      ----------------------------------------------------------------------
XERC_ECO45      ----------------------------------------------------------------------
XERC_ECO24      ----------------------------------------------------------------------
XERD_STAAW      ---------------------------------------------IIEEYLRFIQIEGLSSNTIGAYRRD
XERD_STAAU      ---------------------------------------------IIEEYLRFIQIEGLSSNTIGAYRRD
XERD_STAAS      ---------------------------------------------IIEEYLRFIQIEGLSSNTIGAYRRD
XERD_STAAR      ---------------------------------------------IIEEYLRFIQIEGLSSNTIGAYRRD
XERD_STAAN      ---------------------------------------------IIEEYLRFIQIEGLSSNTIGAYRRD
XERD_STAAM      ---------------------------------------------IIEEYLRFIQIEGLSSNTIGAYRRD
XERD_STAAC      ---------------------------------------------IIEEYLRFIQIEGLSSNTIGAYRRD
XERC_MYCLE      ----------------------------------------------------------------------
XERC_ECO5E      ----------------------------------------------------------------------
XERC_ECO57      ----------------------------------------------------------------------
XERD_SALTY      ----------------------------------------------IEQFLDALWLENLAENTLSAYRRD
XERD_SALTI      ----------------------------------------------IEQFLDALWLENLAENTLSAYRRD
XERD_PASMU      ---------------------------------------------LIELFLNEIWIEKLSQNTIASYRLD
XERD_ECO57      ----------------------------------------------IEQFLDALWLENLAENTLNAYRRD
XERC_YERPE      ----------------------------------------------------------------------
XERC_ROSS1      ----------------------------------------------------------------------
XERD_PROMI      --------------------------------------------------------QGLSANTLSAYRLD
XERD_CHLTE      ----------------------------------------------------------------------
XERC_SALTY      ----------------------------------------------------------------------
XERC_SALTI      ----------------------------------------------------------------------
XERD_SHIFL      ----------------------------------------------IEQFLDALWLENLAENTLNAYRRD
XERD_ECOLI      ----------------------------------------------IEQFLDALWLENLAENTLNAYRRD
XERD_ECOL6      ----------------------------------------------IEQFLDALWLENLAENTLNAYRRD
XERC_XANCP      -------------------------------------------------FLAHLQIERVSAHTLDAYRRD
XERC_XANCB      -------------------------------------------------FLAHLQIERVSAHTLDAYRRD
XERC_XANC8      -------------------------------------------------FLAHLQIERVSAHTLDAYRRD
XERD_YERPE      ---------------------------------------KQQDNPLIEQFLDALWLENLAENTLASYRLD
XERC_XANAC      ----------------------------------------------------------------------
XERD_NEIMB      -----------------------------------------------------------SQNTLNGYRRD
XERD_NEIMA      -----------------------------------------------------------NQNTLNGYRRD
XERC_THELT      -------------------------------------------------------VRRLSDHTVVAYVGD
XERC_CHRSD      ----------------------------------------------------------------------
XERD_HAEDU      --------------------------------------------------------QSLSHNTLLSYRLD
XERC_SERMA      ----------------------------------------------------------------------
XERC_PSYIN      ----------------------------------------------------------------------
XERC_MYXXD      ----------------------------------------------------------------------
XERC_MYXXA      ----------------------------------------------------------------------
XERC_ACTSZ      --------------------------------------------NALQKYYDFLRIERLSPYTLTNYRRQ
XERC_NEIMA      --------------------------------------------------------EGKSEHTVAAYRRD
XERD_CLOAB      -------------------------------------------DNLIEQYFAEIRKKNLSLNTIDAYRRD
XERD_BIFLO      ----------------------------------------------------------------------
XERC_PSEPW      ----------------------------------------------------------------------
XERD_RICCN      -----------------------------------------------------------SKNSILSYKRD
XERD_HAEIN      ------------------------------------------NLALIDLFLNEYWIEGLSENTVQSYRLD
XERC_CHLTE      ----------------------------------------------------------------------
XERC_NEIMF      --------------------------------------------------------EGKSEHTVAAYRRD
XERC_MYCGI      ----------------------------------------------------------------------
XERC_PELPD      ----------------------------------------------------------------------
XERC_NEIG2      --------------------------------------------------------EGKSEHTVAAYRRD
XERC_NEIG1      --------------------------------------------------------EGKSEHTVAAYRRD
XERD_RICBR      -----------------------------------------------------------SKNSILSYKRD
XERC_EUBR3      ----------------------------------------------------------------------
XERD_RICFE      -----------------------------------------------------------SKNSILSYKRD
XERC_RALPJ      ----------------------------------------------------------------------
XERC_NEIM0      --------------------------------------------------------EGKSEHTVAAYRRD
XERD_LACCA      ----------------------------------------------------------------------
XERC_XYLFA      -------------------------------------------SRLVDDFFAFLHVEGMSAHTLDAYRRD
XERC_SYNFM      ----------------------------------------------------------------------
XERC_GEOLS      -----------------------------------------------------------SPHTIAAYRND
XERC_AZOVD      ----------------------------------------------------------------------
XERC_PELPB      ----------------------------------------------------------------------
XERC_CHLP8      ----------------------------------------------------------------------
XERD_RICPR      -----------------------------------------------------------SKNSILSYKRD
XERC_THETN      ----------------------------------------------------------------------
XERC_NEIMB      --------------------------------------------------------EGKSEHTVAAYRRD
XERD_CORGL      ----------------------------------------------------------------------
XERD_SHEON      --------------------------------------------------------KGLSDNTLSAYRTD
XERC_XYLFT      -------------------------------------------SRLVEDFFAFLHVEGMSSHTLDAYRRD
XERC_XYLF2      -------------------------------------------SRLVEDFFAFLHVEGMSSHTLDAYRRD
XERC_PSEAE      ----------------------------------------------------------------------
XERC_PSEA7      ----------------------------------------------------------------------
XERC_PSEAB      ----------------------------------------------------------------------
XERC_PSEA8      ----------------------------------------------------------------------
XERD_RALSO      -----------------------------------------SSTEAIQRFCDALWLEGLARNTLDAYRRT
XERS_STRPI      ----------------------------------------------------------------------
XERD_VIBCH      ------------------------------------------DQGLVEQFLDTMWFEGLAENTVASYRND
XERC_THEAB      -----------------------------------------------------------SENTLKAYKKD
XERC_MYCS2      ---------------------------------------------------------GHSDHTRRAYRGD
XERS_STRZT      ----------------------------------------------------------------------
XERS_STRZP      ----------------------------------------------------------------------
XERS_STRZJ      ----------------------------------------------------------------------
XERS_STRR6      ----------------------------------------------------------------------
XERS_STRPS      ----------------------------------------------------------------------
XERS_STRPJ      ----------------------------------------------------------------------
XERS_STRP7      ----------------------------------------------------------------------
XERS_STRP4      ----------------------------------------------------------------------
XERS_STRP2      ----------------------------------------------------------------------
XERS_STRPN      ----------------------------------------------------------------------
XERD_VIBVY      ----------------------------------------------VEQFLDAMWMEGLAENTLASYRND
XERD_VIBVU      ----------------------------------------------VEQFLDAMWMEGLAENTLASYRND
XERD_MYCTU      ----------------------------------------------------------------------
XERD_MYCBO      ----------------------------------------------------------------------
XERC_BACHD      ----------------------------------------------------------------------
XERS_STRA5      ----------------------------------------------------------------------
XERS_STRA3      ----------------------------------------------------------------------
XERS_STRA1      ----------------------------------------------------------------------
XERC_MYCSS      ----------------------------------------------------------------------
XERC_MYCSK      ----------------------------------------------------------------------
XERC_MYCSJ      ----------------------------------------------------------------------
XERC_MYCTU      ----------------------------------------------------------------------
XERC_MYCTA      ----------------------------------------------------------------------
XERC_MYCBT      ----------------------------------------------------------------------
XERC_MYCBP      ----------------------------------------------------------------------
XERC_MYCBO      ----------------------------------------------------------------------
XERC2_RALSO     ----------------------------------------------------------------------
XERC1_RALSO     ----------------------------------------------------------------------
XERD_RHILO      ----------------------------------------------------------------------
XERC_PSEPG      ----------------------------------------------------------------------
XERCL_PYRAB     -----------------------------------EEREERVRDDTIEEFATYLELEGKSRNTVRMYTYY
XERS_STRT2      ----------------------------------------------------------------------
XERS_STRT1      ----------------------------------------------------------------------
XERS_STRGC      ----------------------------------------------------------------------
Y4RF_RHISN      ----------------------------------------------------------------------
XERC_PSEP1      ----------------------------------------------------------------------
XERS_STRSV      ----------------------------------------------------------------------
XERD_PSEPK      ----------------------------------------------------------------------
XERD_PSEAE      ----------------------------------------------------------------------
XERC_PSEPK      ----------------------------------------------------------------------
XERS_STRTD      ----------------------------------------------------------------------
XERS_STRMU      ----------------------------------------------------------------------
XERD_BRAJA      ----------------------------------------------------------------------
XERD_XANCP      ----------------------------------------------------------------------
Y4RC_RHISN      ----------------------------------------------------------------------
XERD_XANAC      ----------------------------------------------------------------------
XERD_COREF      --------------------------------------------DLARTWLTHLAVEGLSSNTLSSYRRD
XERS_STRU0      ----------------------------------------------------------------------
XERS_STRPG      ----------------------------------------------------------------------
XERS_STRP6      ----------------------------------------------------------------------
XERC_ERYLH      ----------------------------------------------------------------------
XERS_STRPZ      ----------------------------------------------------------------------
XERS_STRPM      ----------------------------------------------------------------------
XERS_STRPF      ----------------------------------------------------------------------
XERS_STRPD      ----------------------------------------------------------------------
XERS_STRPB      ----------------------------------------------------------------------
XERS_STRP8      ----------------------------------------------------------------------
XERS_STRP3      ----------------------------------------------------------------------
XERS_STRP1      ----------------------------------------------------------------------
XERD_XYLFT      ---------------------------------------------------------GLSRHTLNSYRRD
XERC_PSEE4      ----------------------------------------------------------------------
XERC_PELTS      -------------------------------------------------FLVYLRVENASPRTTESYQK-
XERS_STRPC      ----------------------------------------------------------------------
XERC_RICPR      -------------------------------------QKNYSNNTVIAY-----------NNDLKHFLEF
XERD_CAUCR      ----------------------------------------------------------------------
XERC_RICAE      ----------------------------------------------------------------------
XERC_RICPU      ----------------------------------------------------------------------
XERC_RICFE      ----------------------------------------------------------------------
Y367_METJA      ----------------------------------------------------------------------
XERD_CHLPN      ----------------------------------------------------------------------
XERDL_THETN     -----------------------------------------------------KKNKRLSKNTLESYSRD
XERC_RICCN      ----------------------------------------------------------------------
XERD_XYLFA      ---------------------------------------------------------GLSQHTLNSYRRD
XERC_RICM5      ----------------------------------------------------------------------
XERC_BRAJA      ----------------------------------------------------------------------
XERS_STRS7      ----------------------------------------------------------------------
XERS_STREM      ----------------------------------------------------------------------
XERD_CHLTR      ----------------------------------------------------------------------
XERS_STRE4      ----------------------------------------------------------------------
XERD_MYCLE      ----------------------------------------------------------------------
XERC_RICRS      ----------------------------------------------------------------------
XERC_RICRO      ----------------------------------------------------------------------
XERC_RHOCS      ----------------------------------------------------------------------
TNPE_STAAU      ----------------------------------------------------------------------
TNPB_STAAU      ----------------------------------------------------------------------
TNPB_STAAN      ----------------------------------------------------------------------
TNPB_STAAM      ----------------------------------------------------------------------
XERC_NITWN      -----------------------------------------------------------SPKTLEAYARD
XERCL_THETN     ----------------------------------------------------------------------
XERS_STRSY      ----------------------------------------------------------------------
XERS_STRS2      ----------------------------------------------------------------------
XERD_BRUSU      ----------------------------------------------------------------------
XERD_BRUME      ----------------------------------------------------------------------
XERC_SYNE7      ----------------------------------------------------------------------
XERD_CHLMU      ----------------------------------------------------------------------
XERC_RICCK      ----------------------------------------------------------------------
TNPA_STAAU      ----------------------------------------------------------------------
TNPA_STAAN      ----------------------------------------------------------------------
TNPA_STAAM      ----------------------------------------------------------------------
Y4RA_RHISN      ----------------------------------------------------------------------
XERC_RICTY      ----------------------------------------------------------------------
XERD_BRUAB      ----------------------------------------------------------------------
XERD_BRUA2      ----------------------------------------------------------------------
XERC_AGRT5      ----------------------------------------------------------------------
XERCL_PSEAE     ----------------------------------------------------------------------
Y4QK_RHISN      ----------------------------------------------------------------------
XERC_RICAH      ----------------------------------------------------------------------
XERD_AGRT5      ----------------------------------------------------------------------
XERC_RHIME      ----------------------------------------------------------------------
INT2_SALTI      ----------------------------------------------------------------------
INT2_PSEAE      ----------------------------------------------------------------------
INT2_ECOLX      ----------------------------------------------------------------------
XERC_UREPA      ----------------------------------------------------------------------
XERC_BRUME      ----------------------------------------------------------------------
XERC_BRUSU      ----------------------------------------------------------------------
YOEC_BACSU      ----------------------------------------------------------------------
Y4EF_RHISN      ----------------------------------------------------------------------
XERS_LACLS      ----------------------------------------------------------------------
XERS_LACLM      ----------------------------------------------------------------------
Y4RE_RHISN      ----------------------------------------------------------------------
XERC_RHILO      ----------------------------------------------------------------------
XERS_LACLA      ----------------------------------------------------------------------
Y4GC_RHISN      ----------------------------------------------------------------------
YZ09_AQUAE      ----------------------------------------------------------------------
FIME_SHIFL      ----------------------------------------------------------------------
FIME_ECOLI      ----------------------------------------------------------------------
FIME_ECOL6      ----------------------------------------------------------------------
XERC_METS4      ----------------------------------------------------------------------
XERC_SYNY3      ----------------------------------------------------------------------
Y4RB_RHISN      ----------------------------------------------------------------------
XERC_METNO      ----------------------------------------------------------------------
GP8D_CHLPS      ----------------------------------------------------------------------
VINT_BPML5      ----------------------------------------------------------------------
VINT_BPMD2      ----------------------------------------------------------------------
VINT_BPMFR      ----------------------------------------------------------------------
REDM_ECOLX      ----------------------------------------------------------------------
REDF_ECOLI      ----------------------------------------------------------------------
XERC_PSESX      ----------------------------------------------------------------------
VINT_BPP22      ----------------------------------------------------------------------
INTD_ECOLI      ----------------------------------------------------------------------
GP8D_CHLTR      ----------------------------------------------------------------------
VINT_BPPH8      ----------------------------------------------------------------------
FIMB_ECOLI      ----------------------------------------------------------------------
FIMB_ECO57      ----------------------------------------------------------------------
VLF1_NPVOP      ----------------------------------------------------------------------
GP8D_CHLMU      ----------------------------------------------------------------------
VINT_BP434      ---------------------------------------------------------GIKQKTLINYMSK
INTR_STRAM      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           IENLFNAIKESVTQLTTDDLRSYLANYQSEKDCSKANLDNIRRILSSFFAWLEQEEYXXXXXXXXXXXXX
XERC_STAAB      LIQFNQFLEQEHLQLNTRDARNYLS-YLYSNHLKRTSVSRKISTLRTFYEYWMTLDENIINPFVQLVHPK
XERC_OCEIH      LEIFADFLRSEIANVTYKDVRIFLTSLY-EQELSRRSVSRKISTLRSFYRFLEREGYVEGNPFVQLHLPK
XERC_STAAN      LIQFNQFLEQEHLQLKTRDARNYLS-YLYSNHLKRTSVSRKISTLRTFYEYWMTLDENIINPFVQLVHPK
XERC_STAAM      LIQFNQFLEQEHLQLKTRDARNYLS-YLYSNHLKRTSVSRKISTLRTFYEYWMTLDENIINPFVQLVHPK
XERC_STAA9      LIQFNQFLEQEHLQLKTRDARNYLS-YLYSNHLKRTSVSRKISTLRTFYEYWMTLDENIINPFVQLVHPK
XERC_STAA2      LIQFNQFLEQEHLQLKTRDARNYLS-YLYSNHLKRTSVSRKISTLRTFYEYWMTLDENIINPFVQLVHPK
XERC_STAA1      LIQFNQFLEQEHLQLKTRDARNYLS-YLYSNHLKRTSVSRKISTLRTFYEYWMTLDENIINPFVQLVHPK
XERC_STAAT      LIQFNQFLEQEHLELNTRDARNYLS-YLYSNHLKRTSVSRKISTLRTFYEYWMTLDENIINPFVQLVHPK
XERC_STAAR      LIQFNQFLEQEHLQLNTRDARNYLS-YLYSNHLKRTSVSRKISTLRTFYEYWMTLDENIINPFVQLVHPK
XERC_STAAE      LIQFNQFLEQEHLELNTRDARNYLS-YLYSNHLKRTSVSRKISTLRTFYEYWMTLDENIINPFVQLVHPK
XERC_STAAC      LIQFNQFLEQEHLELNTRDARNYLS-YLYSNHLKRTSVSRKISTLRTFYEYWMTLDENIINPFVQLVHPK
XERC_STAA8      LIQFNQFLEQEHLELNTRDARNYLS-YLYSNHLKRTSVSRKISTLRTFYEYWMTLDENIINPFVQLVHPK
XERC_STAA3      LIQFNQFLEQEHLELNTRDARNYLS-YLYSNHLKRTSVSRKISTLRTFYEYWMTLDENIINPFVQLVHPK
XERC_LEPIN      LKFFFEFCEKEIFQIEPVDIRSYFAYLAKKHEIDXXXXXXXXXXXXTFYKVLLREDLVKSNPATQLSFPK
XERC_LEPIC      LKFFFEFCEKEIFQIEPVDIRSYFAYLAKKHEIDXXXXXXXXXXXXTFYKVLLREDLVKSNPATQLSFPK
XERC_STAAW      LIQFNQFLEQEHLQLKTRDARNYLS-YLYSNHLKRTSVSRKISTLRTFYEYWMTLDENIINPFVQLVHPK
XERC_STAAS      LIQFNQFLEQEHLQLKTRDARNYLS-YLYSNHLKRTSVSRKISTLRTFYEYWMTLDENIINPFVQLVHPK
XERC_STAAU      LIQFNQFLEQEHLQLNTFEYRD-ARNYLSYLYLNHLKRTSVSRKISTYEYWMTLDE-NIINPFVHLVHPK
XERC_CORGL      LYAMADTI-EDIDNFSLPTLRQWLGIAVDEGK-SRATLARRTASVKAFSSWAQKNGHLKADEAARLISPK
XERCL_PYRHO     LSKFF----EEGYSPTARDALKFLAKLR-KSGYSIRSLNLVIQALKSYFKFLDSEA-------EKLKNPK
XERC_PYRFU      LSKF---LEEGYSPTARDALR-FLAKLRA-KGYSIRSINLVVQALKAYFKFEEAERLRNPKIPKTLPKSL
XERC_HERA2      LDQFVNFIVESWSNVSRDDLLAFLL-FLKEKRYXXXXXXXXXXXXKSFFEYLQGQHSITTNPTENLDSPK
XERC_STAS1      LENVFLAQEHDLNAFEYKDARNYLS-YLYSKNLKRTSVSRKISTLRSFYEWMTQDE-AVVNPFIQLVHPK
XERC_PEDPA      ------------------DVNVYMS-YLFDRHLARTSISRKVSALRSFYRFLVKNDLVDKNPFELVQLKK
XERC_ANOFW      IGEFFEFMEKQLQQVSYSDVRLFLTELHQRKQSSRSIARKMSS-LRSFYKFLLREKIVSENPFALASLPK
XERC_BACSU      IVNYVDSIEEFETFLRVQGINGFEAAYQDEKGLSRRTISKKISALRSFYKFLMREKLIEENPFQLVHLPK
XERC_HAEDU      LL----AISEMLIAAQIDDWQAVDASVQSHKQGLGAKSIGLRLVLRQWFAYLVQRHYVKVNPAVGIKAPK
XERC_BACP2      IEEFVRFMNDGFEEVSYQDTRIYLTEAY-EKGLTRRTISKKVSALRSFYKFLLREQLVKENPFLLVSLPK
XERC_CHLTR      -DNTYDYPPLSFSLFTKDNIRLYLLE-QIQTHHSKRTVRRRLSAIKSFARFCVKNQLIPENPAEMIRGPR
XERC_CHLTB      -DNTYDYPPLSFSLFTKDNIRLYLLE-QIQTHHSKRTVRRRLSAIKSFARFCVKNQLIPENPAEMIRGPR
XERC_CHLTA      -DNTYDYPPLSFSLFTKDNIRLYLLE-QIQTHHSKRTVRRRLSAIKSFARFCVKNQLIPENPAEMIRGPR
XERC_CHLT2      -DNTYDYPPLSFSLFTKDNIRLYLLE-QIQTHHSKRTVRRRLSAIKSFARFCVKNQLIPENPAEMIRGPR
XERC_LISIN      -------------QVTFLDVRIYLTELK-QKSFSRTTVARKISSLRSFYTFLLRENVITENPFTYVSHAK
XERC_LISMO      -------------QVTFLDVRIYLTELK-QKSFSRTTVARKISSLRSFYTFLLRENVINENPFTYVSHAK
XERC_THEYD      LEEFFNFAKVEPEKVEPIVIRGFISE-QILKGKSKTTVARKLSTLRSFFSYLYSEGFIKINPARVVSSVK
XERC_STAHJ      LVQFNHFLEQELINLRTKDARNYLS-YLYSQNLKRTTVSRKISTLRTFYEWMTQDE-TIINPFVQLVHPK
XERC_LISW6      -------------QVTFLDVRIYLTELK-QKSFSRTTVARKISSLRSFYTFLLRENVISENPFTYVSHAK
XERC_STAES      LVQFNNFLEREHLQLETKDARNYLAFLYSNQ-LKRTTVSRKISTLRTFYEFWMTQDNSIINPFVQLVHPK
XERC_STAEQ      LVQFNNFLEREHLQLETKDARNYLAFLYSNQ-LKRTTVSRKISTLRTFYEFWMTQDNSIINPFVQLVHPK
XERC_LISMF      -------------QVTFLDVRIYLTELK-QKSFSRTTVARKISSLRSFYTFLLRENVINENPFTYVSHAK
XERC_LISMC      -------------QVTFLDVRIYLTELK-QKSFSRTTVARKISSLRSFYTFLLRENVINENPFTYVSHAK
XERC_LISMH      ---------ETYQQVTFLDVRIYLTELK-QKSFSRTTVARKISSLRSFYTFLLRENVIAENPFTYVSHAK
XERC_CHLMU      ----------------------------------------------------------------------
XERD_BACHD      LKQYIQYVERSARNITRETILHYLYHLR-EQGRAETSIARAVAAIRSFHQFLLREKLSDSDPTVHVEIPK
XERC_PSE14      LSKVLKAQRSSWNDLDIQHLRSFTAR-QHQQGQSSRSLARMLSAVRGFYKYLNREGICQHDPANGLSPPK
XERC_COREF      LRHMAATIPD-LTEFTLPNLRAWLGR-AVEEGKSRATLARRTASVKSFSTWAVKNGLISGDEAARLVSPK
XERCL_METTH     ----------------------------------------------------------------------
XERD_LEPIN      LNKFKNFLEKEFLKVQADDIMRFLNEEKDRKISSKTIAREVVAI-RQFYKFLKDEKKLDTNPTEKIETPE
XERD_LEPIC      LNKFKNFLEKEFLKVQADDIMRFLNEEKDRKISSKTIAREVVAI-RQFYKFLKDEKKLDTNPTEKIETPE
XERC_PSESM      LSKVLKARLSSWNDLDIQHLRSFTAR-QHQQGQSSRSLARMLSAVRGFYKYLNREGLCQHDPANGLSPPK
XERC_CHLAB      --------------LTKDTVRLYILKLMQENKAKRT----IKRRLSSFSQYCVKQRILPDDPTETIQGPR
XERC_PSEU2      LGKVLKAQVSSWSDLDIQHLRSFTAR-QHQQGQSSRSLARMLSAVRGFYKYLNREGICQHDPANGLSPPK
XERC_CHLCV      ---------------TKDSVRLYVLELMQENKAKRT----IKRRLSSFSQYCIKNRIIFEDPTETIHGPR
XERC_PASMU      LYRIVDILAESWQAVTPSIVRFILA--QSNKDGLKEXXXXXXXXXXXFFTYLVQQQDINVNPATGVSAPK
XERD_OCEIH      ----------------------------------------------------------------------
XERC_MANSM      MDAVMKILQENDIQVSPSVVRFILA--QSKKSLHEKSLALRLSALRQFLAFLVLQGELKVNPAIGISAPK
XERC_CHLFF      ----------------------------------------------------------------------
XERC_STACT      LVQ-FNAFLEKLKSFEYKDARNYLSFLYS-KGLKRTTVSRKISTLRSFYEFWMTQDDTVVNPFVQLVHPK
XERC_SHESW      ----------------------------------------------------------------------
XERC_SHEPC      ----------------------------------------------------------------------
XERCL_THEON     VRRYL----EGGGELKARSALRFLAKLRREGYSNKS-LNLVVQALRSYFRFEEAEXXXXXXXXXXXXXXX
XERC_LACLE      ----------------------------------------------------------------------
XERC_SHEON      ----------------------------------------------------------------------
XERC_LACDB      ----------------------------------------------------------------------
XERC_LACDA      ----------------------------------------------------------------------
XERC_ACTP7      ----------------------------------------------------------------------
XERD_BACSU      LKSYSLYLTETLHVTDWNHVRIHIIQYLKHKDSGKSGKTSARHLASSFHQFLLREKVTDKDPSVHIETQK
XERC_BACLD      IEDFERFLHKGFEDVTYPDVRIFLTEAH-EKGLTRRTISKKISALRSFYKFLLREKLVKENPFLLVSLPK
XERCL_PYRKO     VRRYL----EWGGDLNAHSALRFLAHLR-KNGYSNRSLNLVVQALRAYFRFEEAERLKPPKVPRSLPKAL
XERD_STAEQ      LKKYKDYLEDNKIQIIQECLGHLIDMGQSSKSLARF-ISTIR----SFHQFALREKYAAKDPTVLIETPK
XERD_LISIN      LHYFVSYMDTSRTTLERNDIVGFMA-FARKEGKSPRSVARYIASLRSFFHYLMHDGKMSHDPMIQIETPK
XERD_STAES      LKKYKDYLEDNKIQIIQECLGHLIDMGQSSKSLARF-ISTIR----SFHQFALREKYAAKDPTVLIETPK
XERC_BIFLI      ----------------------------------------------------------------------
XERC_BIFLD      ----------------------------------------------------------------------
XERC_VIBPA      ----------------------------------------------------------------------
XERC_VIBCM      ----------------------------------------------------------------------
XERC_VIBCH      ----------------------------------------------------------------------
XERC_VIBC3      ----------------------------------------------------------------------
XERC_SHESR      ----------------------------------------------------------------------
XERC_SHESM      ----------------------------------------------------------------------
XERC_SHESA      ----------------------------------------------------------------------
XERC_NATTJ      LENFFNEQFELYQEVTHKHIRHFLA-YLKDKNYEKSTTARKLSAIRSLFKFLTREEKIRSNTSALLATPK
XERC_CHRVO      IELLENMMQKSARDATAAELRKALAKLHAQ-GXXXXXXXXXXXXWRQFYHWLQRNGEREDNPAAGLYAPK
XERC_CHLPN      ----------------------------------------------------------------------
XERC_VIBHB      ----------------------------------------------------------------------
XERC_ROSCS      ----------------------------------------------------------------------
XERC_HAES2      ----------------------------------------------------------------------
XERC_VIBVY      ----------------------------------------------------------------------
XERC_VIBVU      ----------------------------------------------------------------------
XERC_LACCB      ----------------------------------------------------------------------
XERC_LACC3      ----------------------------------------------------------------------
XERD_LISMO      LHYFVSYM--DVTKELTDDIVGFMA-FARQEGKSPRSVARYIASLRSFFHYLMHDGKMSHDPMIQIETPK
XERD_LISMF      LRYFYMDVAKGLTDPNTSDIVGFMAFARQEGKSARSVARYIAS-LRSFFHYLMHDGKMSHDPMIQIETPK
XERC_TREDE      ----------------------------------------------------------------------
XERC_PSEF5      ----------------------------------------------------------------------
XERC_HAEIN      ----------------------------------------------------------------------
XERC_HAEIE      ----------------------------------------------------------------------
XERC_HAEI8      ----------------------------------------------------------------------
XERC_PSEPF      ----------------------------------------------------------------------
XERC_PSEFL      ----------------------------------------------------------------------
XERD_STAHJ      ----------------------------------------------------------------------
XERC_SHEAM      LERADTLLQRSWQQLSRQDLSGLMARLHRQ-GLSPRSLSLTASALKQFGQFLLKEGLIDTNPAATLSAPK
XERC_ALCBS      LIEARTLLSQPWDTLTVHDMRSLAASLHRQGKSGKT----IQRMLSTFFRYLMREGLARDNPAIDIRAPK
TNRI_BACTU      ----------------------------------------------------------------------
XERD_RHIME      LEDARSFLRSRGTGLTADDLRSYLSHLQGFKASSQA-----RRLLRQFYKFLYAEGLRTDDPTGILDAPK
XERC_SYNAS      --------------------------------------------LRAFFKYLHQKRKIQCNPLEAVSTPR
XERC_PSEU5      ----------------------------------------------------------------------
VINT_BPL2       VQHLIKGLKEKVDITIGYKLIDYLKNHTHNGNNSKKIINYLRKVM---------QHYRITTSIIDLPHLP
XERD_STAS1      LKKYNTFLEQKISHIDFIDRASICLGYLHDNGASAKSLARFISTIRSFHQFALREKYAAKDPTVLIETPK
XERC_PSEFS      ----------------------------------------------------------------------
XERC_PROMI      IAQMMVAIKINQWSLLESQHVRMLLAKSHRSGLQPASLALRFSALRSFLDWQVSQGMLAVNPAKGVRTPK
XERC_SHIF8      LEAIINFASENGLQSWQQCDAAMVRNFSRHKXXXXXXXXXXXXXXXXFFDWLVSQNELKANPAKGVSAPK
XERC_ECO27      ----------------------------------------------------------------------
XERC_VIBSL      ----------------------------------------------------------------------
XERC_SHISS      ----------------------------------------------------------------------
XERC_SHIFL      ----------------------------------------------------------------------
XERC_SHIDS      ----------------------------------------------------------------------
XERC_SHIBS      ----------------------------------------------------------------------
XERC_SHIB3      ----------------------------------------------------------------------
XERC_ESCF3      ----------------------------------------------------------------------
XERC_ECOUT      ----------------------------------------------------------------------
XERC_ECOSM      ----------------------------------------------------------------------
XERC_ECOSE      ----------------------------------------------------------------------
XERC_ECOLU      ----------------------------------------------------------------------
XERC_ECOLI      ----------------------------------------------------------------------
XERC_ECOLC      ----------------------------------------------------------------------
XERC_ECOL6      ----------------------------------------------------------------------
XERC_ECOL5      ----------------------------------------------------------------------
XERC_ECOK1      ----------------------------------------------------------------------
XERC_ECOHS      ----------------------------------------------------------------------
XERC_ECODH      ----------------------------------------------------------------------
XERC_ECOBW      ----------------------------------------------------------------------
XERC_ECO8A      ----------------------------------------------------------------------
XERC_ECO81      ----------------------------------------------------------------------
XERC_ECO7I      ----------------------------------------------------------------------
XERC_ECO55      ----------------------------------------------------------------------
XERC_ECO45      ----------------------------------------------------------------------
XERC_ECO24      ----------------------------------------------------------------------
XERD_STAAW      LKKYQDYMTEHHIQLIQECLGHLIDQGQSAKSIARF-ISTIR----SFHQFAIREKYAAKDPTVLLDSPK
XERD_STAAU      LKKYQDYMTEHHIQLIQECLGHLIDQGQSAKSIARF-ISTIR----SFHQFAIREKYAAKDPTVLLDSPK
XERD_STAAS      LKKYQDYMTEHHIQLIQECLGHLIDQGQSAKSIARF-ISTIR----SFHQFAIREKYAAKDPTVLLDSPK
XERD_STAAR      LKKYQDYMTEHHIQLIQECLGHLIDQGQSAKSIARF-ISTIR----SFHQFAIREKYAAKDPTVLLDSPK
XERD_STAAN      LKKYQDYMTEHHIQLIQECLGHLIDQGQSAKSIARF-ISTIR----SFHQFAIREKYAAKDPTVLLDSPK
XERD_STAAM      LKKYQDYMTEHHIQLIQECLGHLIDQGQSAKSIARF-ISTIR----SFHQFAIREKYAAKDPTVLLDSPK
XERD_STAAC      LKKYQDYMTEHHIQLIQECLGHLIDQGQSAKSIARF-ISTIR----SFHQFAIREKYAAKDPTVLLDSPK
XERC_MYCLE      ----------------------------------------------------------------------
XERC_ECO5E      ----------------------------------------------------------------------
XERC_ECO57      ----------------------------------------------------------------------
XERD_SALTY      LSMVVAWLHHRGKTLATDDLQTLLAE-RVEGGYKATSSARLLSAMRRFFQHLYREKYREDDPSAQLASPK
XERD_SALTI      LSMVVAWLHHRGKTLATDDLQTLLAE-RVEGGYKATSSARLLSAMRRFFQHLYREKYREDDPSAQLASPK
XERD_PASMU      LTALIQWLKQQLTLINLDDLQTFLGERQGYKATSTARLLSAMRKL---FQYLYREKYRTDDPSAVLSSPK
XERD_ECO57      LSMMVEWLHHRGLTLATDDLQALLAERLEGKATSSARLSAVRRL----FQYLYREKFREDDPSAHLASPK
XERC_YERPE      ----------------------------------------------------------------------
XERC_ROSS1      ----------------------------------------------------------------------
XERD_PROMI      LQALSQWLKLNWLSVTTLDLHAFLATRLDEKATSAARLSTLRR----FFQYLYREKLRQDDPSALLSTPK
XERD_CHLTE      ----------------------------------------------------------------------
XERC_SALTY      ----------------------------------------------------------------------
XERC_SALTI      ----------------------------------------------------------------------
XERD_SHIFL      LSMMVEWLHHRGLTLATDDLQALLAERLEGKATSSARLSAVRRL----FQYLYREKFREDDPSAHLASPK
XERD_ECOLI      LSMMVEWLHHRGLTLATDDLQALLAERLEGKATSSARLSAVRRL----FQYLYREKFREDDPSAHLASPK
XERD_ECOL6      LSMMVEWLHHRGLTLATDDLQALLAERLEGKATSSARLSAVRRL----FQYLYREKFREDDPSAHLASPK
XERC_XANCP      LAALIGWASEDVAQLDSAQLRKFVTA-EHRRGLSPKSLQRRLSACRSYYAWLLKHGRIATSXXXXXXXXX
XERC_XANCB      LAALIGWASEDVAQLDSAQLRKFVTA-EHRRGLSPKSLQRRLSACRSYYAWLLKHGRIATSXXXXXXXXX
XERC_XANC8      LAALIGWASEDVAQLDSAQLRKFVTA-EHRRGLSPKSLQRRLSACRSYYAWLLKHGRIATSXXXXXXXXX
XERD_YERPE      LHALVGWLTHHNSDLSPQDLQSFLAERGGYKATSSARLLSAMRRL---FQYLYREKLREDDPTALLSSPK
XERC_XANAC      ----------------------------------------------------------------------
XERD_NEIMB      LEKIARRLSQSGRMLKXXXXXXXXXXVDGEQRSSQARLSACKRL----YIWMEREGIRTDNPTRLLKPPK
XERD_NEIMA      LEKIARRLSQSGRMLKXXXXXXXXXXVDGEQRSSQARLSACKRL----YIWMEREGIRTDNPTRLLKPPK
XERC_THELT      VKQFLCFLIENDIELK-DVSRLHIEEYKLSKQKTKLNSTSLARKISSFFNYLQLTSIKDENPVEGIRNPK
XERC_CHRSD      ----------------------------------------------------------------------
XERD_HAEDU      LE-LFSAWPRAFLTLTHTDLQLFLGD-RLDKGYKSSSSARIISCLRKFFRFLCLEKYRLDDPTSMLISPR
XERC_SERMA      ----------------------------------------------------------------------
XERC_PSYIN      ----------------------------------------------------------------------
XERC_MYXXD      ----------------------------------------------------------------------
XERC_MYXXA      ----------------------------------------------------------------------
XERC_ACTSZ      LSAVTELLTQSWQQVTPSVVRFILAESR-KAGLHEKSLALRLSALRQFLAYLVVQEELKVNPATGISAPK
XERC_NEIMA      LEELFALL----AQMPSEDAGG-VPQGLSQRDFTAANARTLARKLSSYCAWLVKRGLLHTDPTADIKPPK
XERD_CLOAB      IKKFHEFLDEKGEKLREVDVITIMSYVQYLQKNGRANSSIVRNIVSNFFKYLEIKGIMDDNPVTQYEMPK
XERD_BIFLO      ----------------------------------------------------------------------
XERC_PSEPW      ----------------------------------------------------------------------
XERD_RICCN      LFDFQNYLKLSELNITTENIRDWI-EYLASNDLQARSINRKISTIKSYYEFLISENHTAFNPVLNVDLPK
XERD_HAEIN      LTALCDWLDKSLETLDAVDLQGFLGE-RLEKGYKATSTARMLSAMRKLFQYLYREKYRVDDPSAVLSSPK
XERC_CHLTE      ----------------------------------------------------------------------
XERC_NEIMF      LEELFALL----AQMPSEDVGGVPQDL-SRRDFTAANARTLARKLSSYCVWLVERGLLHTDPTADIKPPK
XERC_MYCGI      ----------------------------------------------------------------------
XERC_PELPD      ----------------------------------------------------------------------
XERC_NEIG2      LEELFALLAQMPSELSRRDFTAALRRL-SQRGLDGRTLARKLSAWRQYCAWLVKRGLMRADPTADIKPPK
XERC_NEIG1      LEELFALLAQMPSELSRRDFTAALRRL-SQRGLDGRTLARKLSAWRQYCAWLVKRGLMRADPTADIKPPK
XERD_RICBR      LLDFHNYLKLSELNITTDNIRNWV-EYLAENSLQARSINRKISTIKSYYEFLISENHTNLNPLLNIDLPK
XERC_EUBR3      ----------------------------------------------------------------------
XERD_RICFE      LFDFQNYLAKSELNITTENVRDWI-EYLASNDLQARSINRKISTIKSYYEFLISENHTAFNPVLNVDLPK
XERC_RALPJ      ----------------------------------------------------------------------
XERC_NEIM0      LEELFALLAQMPSELSRRDFTAALRRLSQRG----LNARTLARKLSSYCVWLVERGLLHTDPTADIKPPK
XERD_LACCA      ----------------------------------------------------------------------
XERC_XYLFA      IGALIAGVQQAVGEVVALD-RAQLQAFVAAEHRRGLSAKSLQRRLSAFYAWLVKRGHIAINPAAGLRAPK
XERC_SYNFM      ----------------------------------------------------------------------
XERC_GEOLS      LNGFSSFVRSTVSTKTVDHLRLYLASLQQRAGYAKSSIGRKLAAVRAFFGWLVRTRQLEVNPAELIATPK
XERC_AZOVD      ----------------------------------------------------------------------
XERC_PELPB      ----------------------------------------------------------------------
XERC_CHLP8      ----------------------------------------------------------------------
XERD_RICPR      LQHYLAAQKISELNITTGNIRKWI-EYLASNNLHARSINRKISTIKSYYAFLISENHTKFNPVLNIDLPK
XERC_THETN      ----------------------------------------------------------------------
XERC_NEIMB      LQELLALLEEMPSANPSNCTRGDFVQAXXXXXXXXXXERTLARKLSSYCVWLVKRGLMHADPTADIKPPK
XERD_CORGL      ----------------------------------------------------------------------
XERD_SHEON      LRHFDRYLQSQGLRLRDADVRAYLA-YRVEQQFXXXXXXXXXXXXXXFYNYLLQTKQISGDPMAQIESPK
XERC_XYLFT      IGALIAGGQQAVGEVVALD-RAQLQAFVSAEHRRGLSAKSLQRRLSAFYTWLVKRGHIAVNPAAGLRAPK
XERC_XYLF2      IGALIAGGQQAVGEVVALD-RAQLQAFVSAEHRRGLSAKSLQRRLSAFYTWLVKRGHIAVNPAAGLRAPK
XERC_PSEAE      ----------------------------------------------------------------------
XERC_PSEA7      ----------------------------------------------------------------------
XERC_PSEAB      ----------------------------------------------------------------------
XERC_PSEA8      ----------------------------------------------------------------------
XERD_RALSO      LYAQWLAGRGKALDQTEDDLSDYFAARHEDSLASTAN--RRRTVFKRFFQWALREHLVSADPTRLLSTAK
XERS_STRPI      ----------------------------------------------------------------------
XERD_VIBCH      LSKLLEWMAQNQYRLDLQEYQSWLSE-QNYKPTSKARLSAIRRL----FQYLHREKVRADDPSALLVSPK
XERC_THEAB      VRKFLTYVGKQINNIERKDVEEFLKALSTGESPRETTISRYISSLNSFFNYLELSGMIYENPMEXXXXXX
XERC_MYCS2      LTALFDFVEQSLARVSLPLLRSWLAE-QSASGAARTTLARRTSSVKTFCAWALRRGLIGVDPAARLQVPK
XERS_STRZT      ----------------------------------------------------------------------
XERS_STRZP      ----------------------------------------------------------------------
XERS_STRZJ      ----------------------------------------------------------------------
XERS_STRR6      ----------------------------------------------------------------------
XERS_STRPS      ----------------------------------------------------------------------
XERS_STRPJ      ----------------------------------------------------------------------
XERS_STRP7      ----------------------------------------------------------------------
XERS_STRP4      ----------------------------------------------------------------------
XERS_STRP2      ----------------------------------------------------------------------
XERS_STRPN      ----------------------------------------------------------------------
XERD_VIBVY      LMKLLQWMEANHYRLDFISL-SGLQQYQSDQDYKQTSRARMLSAIRRLFQYLHREKVRADDPSALLVSPK
XERD_VIBVU      LMKLLQWMEANHYRLDFISL-SGLQQYQSDQDYKQTSRARMLSAIRRLFQYLHREKVRADDPSALLVSPK
XERD_MYCTU      ----------------------------------------------------------------------
XERD_MYCBO      ----------------------------------------------------------------------
XERC_BACHD      -----------------------------EQEYARSTVSRKLSTLRSFYQFLVREKWVMENPFLLAHTPK
XERS_STRA5      ----------------------------------------------------------------------
XERS_STRA3      ----------------------------------------------------------------------
XERS_STRA1      ----------------------------------------------------------------------
XERC_MYCSS      ----------------------------------------------------------------------
XERC_MYCSK      ----------------------------------------------------------------------
XERC_MYCSJ      ----------------------------------------------------------------------
XERC_MYCTU      ----------------------------------------------------------------------
XERC_MYCTA      ----------------------------------------------------------------------
XERC_MYCBT      ----------------------------------------------------------------------
XERC_MYCBP      ----------------------------------------------------------------------
XERC_MYCBO      ----------------------------------------------------------------------
XERC2_RALSO     ----------------------------------------------------------------------
XERC1_RALSO     ----------------------------------------------------------------------
XERD_RHILO      ----------------------------------------------------------------------
XERC_PSEPG      ----------------------------------------------------------------------
XERCL_PYRAB     ISKFF---EEGHSPTARDALR-FLAKLK-RKGYSTRSLNLVIQALKAYFKFSEAEXXXXXXXXXXXXXXX
XERS_STRT2      ----------------------------------------------------------------------
XERS_STRT1      ----------------------------------------------------------------------
XERS_STRGC      ----------------------------------------------------------------------
Y4RF_RHISN      ----------------------------------------------------------------------
XERC_PSEP1      ----------------------------------------------------------------------
XERS_STRSV      ----------------------------------------------------------------------
XERD_PSEPK      ----------------------------------------------------------------------
XERD_PSEAE      ----------------------------------------------------------------------
XERC_PSEPK      ----------------------------------------------------------------------
XERS_STRTD      ----------------------------------------------------------------------
XERS_STRMU      ----------------------------------------------------------------------
XERD_BRAJA      ----------------------------------------------------------------------
XERD_XANCP      ----------------------------------------------------------------------
Y4RC_RHISN      ----------------------------------------------------------------------
XERD_XANAC      ----------------------------------------------------------------------
XERD_COREF      IERYCDWLEAAISEIATATVEAYVMDLRRGVDLSASSAGRALIVVRGLHKFALAEGLVGVDVAADVSPPS
XERS_STRU0      ----------------------------------------------------------------------
XERS_STRPG      ----------------------------------------------------------------------
XERS_STRP6      ----------------------------------------------------------------------
XERC_ERYLH      ----------------------------------------------------------------------
XERS_STRPZ      ----------------------------------------------------------------------
XERS_STRPM      ----------------------------------------------------------------------
XERS_STRPF      ----------------------------------------------------------------------
XERS_STRPD      ----------------------------------------------------------------------
XERS_STRPB      ----------------------------------------------------------------------
XERS_STRP8      ----------------------------------------------------------------------
XERS_STRP3      ----------------------------------------------------------------------
XERS_STRP1      ----------------------------------------------------------------------
XERD_XYLFT      LEGLWNNGRXXXXXXXXXXXXXXXXXWRTQQHYSPLSNARLRSVLRTFFSYAVECGWRNDNPSTXXXXXX
XERC_PSEE4      ----------------------------------------------------------------------
XERC_PELTS      --DLFHGLDYFASRLGKEDFRHYLAHMQKQ-GLXXXXXXXXXXXXXSFYRYLYREKIIDGNPLLRVASPK
XERS_STRPC      ----------------------------------------------------------------------
XERC_RICPR      M-NYYNSELVTLNHIKTADIR-LIRSWLAKRKCENFTASSIARGLSTFYKFLEKTLLLNNHIIFSIKSPK
XERD_CAUCR      ----------------------------------------------------------------------
XERC_RICAE      --NYYNSELVTINHIKTADIR-LIRSWLAKRNCDNFTASSISRGLSAFYRFLEKTTQLNSHIIFSIKSPK
XERC_RICPU      --NYYNSELVTINHIKTADIR-LIRSWLAKRNCDNFTASSISRGLSAFYRFLEKTTQLNSHIIFSIKSPK
XERC_RICFE      --NYYNSELVTINHIKTADIR-LIRSWLAKRNCDNFTTSSISRGLSAFYRFLEKTTQLNSHIIFSIKSPK
Y367_METJA      ----------------------------------------------------------------------
XERD_CHLPN      ----------------------------------------------------------------------
XERDL_THETN     VEQFLTYMNEHGINFCSAK-KSTIVNYLKQQGKSQATISRALSSIKAFYHYLFAKKKIEEDPSYGINAPK
XERC_RICCN      --NYYNSELVTINHIKTADIR-LIRSWLAKRNCDNFTASSISRGLSAFYRFLEKTTQLNSHIIFSIKSPK
XERD_XYLFA      LEGLWNNGRXXXXXXXXXXXXXXXXXWRTQQHYSPLSNARLLSVLRTFFSYAVECGWRNDNPSTXXXXXX
XERC_RICM5      --NYYNSEFVTINHIKTADIR-LIRSWLAKRHCDNFTTSSISRGLSAFYRFLEKTTQLNSHIIFSIKSPK
XERC_BRAJA      ----------------------------------------------------------------------
XERS_STRS7      ----------------------------------------------------------------------
XERS_STREM      ----------------------------------------------------------------------
XERD_CHLTR      ----------------------------------------------------------------------
XERS_STRE4      ----------------------------------------------------------------------
XERD_MYCLE      ----------------------------------------------------------------------
XERC_RICRS      --NYYNSELVTINHIKTADIR-LIRSWLAKRNCDNFAASSISRGLSAFYRFLEKTTQLNSHIIFSIKSPK
XERC_RICRO      --NYYNSELVTINHIKTADIR-LIRSWLAKRNCDNFAASSISRGLSAFYRFLEKTTQLNSHIIFSIKSPK
XERC_RHOCS      ----------------------------------------------------------------------
TNPE_STAAU      ---------QRVHQLTRVEIEAYLSELNM-MGIKPSTITGRISILEGLFSTLHRLEWDDVPSKLLIYPED
TNPB_STAAU      ----------------------------------------------------------------------
TNPB_STAAN      ----------------------------------------------------------------------
TNPB_STAAM      ----------------------------------------------------------------------
XERC_NITWN      VRQCLMFLSEQVTALEPADIRSFMAARRAD-DIGGRSLMRSLAGLRSFARFLEREGLGKVGALGAIRAPK
XERCL_THETN     ----------------------------------------------------------------------
XERS_STRSY      ----------------------------------------------------------------------
XERS_STRS2      ----------------------------------------------------------------------
XERD_BRUSU      ----------------------------------------------------------------------
XERD_BRUME      ----------------------------------------------------------------------
XERC_SYNE7      ----------------------------------------------------------------------
XERD_CHLMU      ----------------------------------------------------------------------
XERC_RICCK      ----YNSDLVTINHIKTADIR-LIRSWLAKRNCNNFTTSSISRGLSAFYKFLEKTTQLNSHIIFSIXXXX
TNPA_STAAU      ----------------------------------------------------------------------
TNPA_STAAN      ----------------------------------------------------------------------
TNPA_STAAM      ----------------------------------------------------------------------
Y4RA_RHISN      ----------------------------------------------------------------------
XERC_RICTY      ----------------------------------------------------------------------
XERD_BRUAB      ----------------------------------------------------------------------
XERD_BRUA2      ----------------------------------------------------------------------
XERC_AGRT5      ----------------------------------------------------------------------
XERCL_PSEAE     ----------------------------------------------------------------------
Y4QK_RHISN      ----------------------------------------------------------------------
XERC_RICAH      --NYYNSELVTINHIKNADIR-LIRSWLAKRNYDNFTTSSIARGLSAFYRFLEKTTQLNSHIIFSIKSPK
XERD_AGRT5      ----------------------------------------------------------------------
XERC_RHIME      ----------------------------------------------------------------------
INT2_SALTI      ----------------------------------------------------------------------
INT2_PSEAE      ----------------------------------------------------------------------
INT2_ECOLX      ----------------------------------------------------------------------
XERC_UREPA      ----------------------------------------------------------------------
XERC_BRUME      ----------------------------------------------------------------------
XERC_BRUSU      ----------------------------------------------------------------------
YOEC_BACSU      ----------------------------------------------------------------------
Y4EF_RHISN      ----------------------------------------------------------------------
XERS_LACLS      ----------------------------------------------------------------------
XERS_LACLM      ----------------------------------------------------------------------
Y4RE_RHISN      ----------------------------------------------------------------------
XERC_RHILO      ----------------------------------------------------------------------
XERS_LACLA      ----------------------------------------------------------------------
Y4GC_RHISN      ----------------------------------------------------------------------
YZ09_AQUAE      ----------------------------------------------------------------------
FIME_SHIFL      ----------------------------------------------------------------------
FIME_ECOLI      ----------------------------------------------------------------------
FIME_ECOL6      ----------------------------------------------------------------------
XERC_METS4      ----------------------------------------------------------------------
XERC_SYNY3      ----------------------------------------------------------------------
Y4RB_RHISN      ----------------------------------------------------------------------
XERC_METNO      ----------------------------------------------------------------------
GP8D_CHLPS      ----------------------------------------------------------------------
VINT_BPML5      ----------------------------------------------------------------------
VINT_BPMD2      ----------------------------------------------------------------------
VINT_BPMFR      ----------------------------------------------------------------------
REDM_ECOLX      ----------------------------------------------------------------------
REDF_ECOLI      ----------------------------------------------------------------------
XERC_PSESX      ----------------------------------------------------------------------
VINT_BPP22      ----------------------------------------------------------------------
INTD_ECOLI      ----------------------------------------------------------------------
GP8D_CHLTR      ----------------------------------------------------------------------
VINT_BPPH8      ----------------------------------------------------------------------
FIMB_ECOLI      ----------------------------------------------------------------------
FIMB_ECO57      ----------------------------------------------------------------------
VLF1_NPVOP      ----------------------------------------------------------------------
GP8D_CHLMU      ----------------------------------------------------------------------
VINT_BP434      IKAIRRGLPDALEDITTKEIAAMLSGYIDEGKAASAKL--IRSTLSDAFREAIAEGHITTNPVAATRAAK
INTR_STRAM      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           TEQNVKETYTDEHLEIMRDNCENLRDLAIIDLLASTGMRVGELVQLNRSDIDFENRECVVFGKGKKERPV
XERC_STAAB      KEKYLPQFFYEEEMEALEDTSKSLRDRVILELLYATGIRVSELVNIKKQDIDFYANGVTVFGKGSKERFV
XERC_OCEIH      TSKPVPGFLYQEELDKLFEVNDGQRDQALLEMLYGTGIRVSECQNLRLQDIDFAIGTIFVRGKGRKERYV
XERC_STAAN      KEKYLPQFFYEEEMEALEDTSKNLRDRVILELLYATGIRVSELVNIKKQDIDFYANGVTVLGKGSKERFV
XERC_STAAM      KEKYLPQFFYEEEMEALEDTSKNLRDRVILELLYATGIRVSELVNIKKQDIDFYANGVTVLGKGSKERFV
XERC_STAA9      KEKYLPQFFYEEEMEALEDTSKNLRDRVILELLYATGIRVSELVNIKKQDIDFYANGVTVLGKGSKERFV
XERC_STAA2      KEKYLPQFFYEEEMEALEDTSKNLRDRVILELLYATGIRVSELVNIKKQDIDFYANGVTVLGKGSKERFV
XERC_STAA1      KEKYLPQFFYEEEMEALEDTSKNLRDRVILELLYATGIRVSELVNIKKQDIDFYANGVTVLGKGSKERFV
XERC_STAAT      KEKYLPQFFYEEEMEALEDTSKNLRDRVILELLYATGIRVSELVNIKKQDIDFYANGVTVLGKGSKERFV
XERC_STAAR      KEKYLPQFFYEEEMEALEDTSKSLRDRVILELLYATGIRVSELVNIKKQDIDFYANGVTVLGKGSKERFV
XERC_STAAE      KEKYLPQFFYEEEMEALEDTSKNLRDRVILELLYATGIRVSELVNIKKQDIDFYANGVTVLGKGSKERFV
XERC_STAAC      KEKYLPQFFYEEEMEALEDTSKNLRDRVILELLYATGIRVSELVNIKKQDIDFYANGVTVLGKGSKERFV
XERC_STAA8      KEKYLPQFFYEEEMEALEDTSKNLRDRVILELLYATGIRVSELVNIKKQDIDFYANGVTVLGKGSKERFV
XERC_STAA3      KEKYLPQFFYEEEMEALEDTSKNLRDRVILELLYATGIRVSELVNIKKQDIDFYANGVTVLGKGSKERFV
XERC_LEPIN      VRKEVPKNFTEEILEFESENASEIRDRAMIEVLYSSGLRVFELVNAKLNSLSKDLTVLKVLGKGRKERFV
XERC_LEPIC      VRKEVPKNFTEEILEFESENASEIRDRAMIEVLYSSGLRVFELVNAKLNSLSKDLTVLKVLGKGRKERFV
XERC_STAAW      KEKYLPQFFYEEEMEALEDTSKSLRDRVILELLYATGIRVSELVNIKKQDIDFYANGVTVLGKGSKERFV
XERC_STAAS      KEKYLPQFFYEEEMEALEDTSKSLRDRVILELLYATGIRVSELVNIKKQDIDFYANGVTVLGKGSKERFV
XERC_STAAU      KEKYLPQFSLEEEMEALKDTSKNLRDRVILELLYATGIRVSELVNIKKQDIDFYANGVTVLGKGSKERFV
XERC_CORGL      ITRDLPKILGEQQAGDFVENAEFLRDSAILELLYATGMRVAELCGIDLSDIDYDRKMVRVLGKGNKERVV
XERCL_PYRHO     IPKSLPKSLTEDEVKKIVSVADNLRDKXXXXXXYGAGLRVSELCNLKIEDVNFEKSFLIVRGKGGKDRVI
XERC_PYRFU      TEEEVKKL-----IEVIPK--DKIRDRLIVLLLYGTGLRVSELCNLKIEDINFEKGFLTVRGKGGKDRTI
XERC_HERA2      VDRFLPKAITDELLELTTSGPEGLRDKAMLEVLYATGMRVSELVALDVGDVDLAIHQIRCLGKANKERNL
XERC_STAS1      KEHYLPHFFYEEEMEALFDTVENLRDRVILELLYSTGIRVSELVHIKEQDIDMTSPGVKVLGKGGKERFI
XERC_PEDPA      QSDKLPHFFYEKEMNMLAEGAQKLRNIAILEVLYGTGMRVSECAALQWSDIDFSMQTILVLGKGNKERYV
XERC_ANOFW      KEQKIPHLYPDELEQLFVVNDLNTRNQAMIELLYATGIRVSECCNIRLSHIDFSVCTILISGKGNKQRYV
XERC_BACSU      QEKRIPKFLYQKELEELFEVSDGMRDQALLELLYATGMRVSECCSITINDVDLFMDTVLVHGKGKKQRYI
XERC_HAEDU      VARHLPKNIDAERLDVEVDEPADIRDLAMMELMYSSGLRLAELQRLDLGDMDLIDAEVRLLGKGNKERIV
XERC_BACP2      QDKRIPSFLYEEELKELFTVSDGQRNQAILELLYATGMRVSELCSLKESDLDLSMDTVLVHGKGSKQRYV
XERC_CHLTR      LPQELPSPLTYEQVLALMDKVTGFRDRCLLELFYSSGLRISEITALNRADIDFQSHLLHIRGKGKKERIV
XERC_CHLTB      LPQELPSPLTYEQVLALMDKVTGFRDRCLLELFYSSGLRISEITALNRADIDFQSHLLHIRGKGKKERIV
XERC_CHLTA      LPQELPSPLTYEQVLALMDKVTGFRDRCLLELFYSSGLRISEITALNRADIDFQSHLLHIRGKGKKERIV
XERC_CHLT2      LPQELPSPLTYEQVLALMDKVTGFRDRCLLELFYSSGLRISEITALNRADIDFQSHLLHIRGKGKKERIV
XERC_LISIN      NQLRLPKFFYSEEMEVYEDNTLTLRDRVILEVLYGTGIRVSECAGIMLSDLDTSYQAILIRGKGNKERYV
XERC_LISMO      NQLRLPKFFYSEEMEVYEDNTLTLRDRVLLEVLYGTGIRVSECAGILLPDLDTSYQAILIRGKGNKERYV
XERC_THEYD      IKRALPKFLTDDAFKLVEAPSEDKRDKAILELFYSSGIRVSELCGLNLEDLDLKEGLIKVRGKGKKERIV
XERC_STAHJ      KENYLPQFFYEEEMEVAKDTKKGLRDRVILELLYATGIRVSELVNIQLKDIDMSLPGVKVLGKGNKERFV
XERC_LISW6      NQLRLPKFFYSEEMEVYEDNTLTLRDRVLLEVLYGTGIRVSECAGILLSDLDTSYQAILIRGKGNKERYV
XERC_STAES      KEKYLPQFFYEEEMEALHDNKKGIRDKVIIELLYATGIRVSELINIKLKDIDMNLPGVKVLGKGNKERFI
XERC_STAEQ      KEKYLPQFFYEEEMEALHDNKKGIRDKVIIELLYATGIRVSELINIKLKDIDMNLPGVKVLGKGNKERFI
XERC_LISMF      NQLRLPKFFYSEEMEVYEDNTLTLRDRVLLEVLYGTGIRVSECAGILLPDLDTSYQAILIRGKGNKERYV
XERC_LISMC      NQLRLPKFFYSEEMEVYEDNTLTLRDRVLLEVLYGTGIRVSECAGILLPDLDTSYQAILIRGKGNKERYV
XERC_LISMH      NQLRLPKFFYSEEMEVYEDNTLTLRDRVLLEVLYGTGIRVSECAGILLPDLDTSYQAILIRGKGNKERYV
XERC_CHLMU      ------------------DKVTGFRDRCLLELFYSSGLRISEITALNRSDIDFQSNLLRICGKGKKERIV
XERD_BACHD      ATKRLPKALTIEEVEALLNSPQSLRNKAMLELLYATGMRVSELIGLTLSDIHLSMGFVRCLGKGNKERII
XERC_PSE14      GERRLPKTLTDRTAQLLDGGVEDHRDQAILELLYSSGLRLSELTGLNLDQLDLRDGLVQVLGKGSKTRVL
XERC_COREF      VTRNLPEVQAGEFMGSAAADTEDRRDSAILELLYATGMRVSELCGLDLGDVDHHRRMVRVLGKGDKERMI
XERCL_METTH     ------------------------RDRLILSLLYSSGLRVSELVSLRINDIDPDERTIRIRGKGDKDRIV
XERD_LEPIN      VMRSIPDYLTQDEIEIKEDNLYELRDKCIFELLYSSGLRISEACNLRLNDMDLEGMTLTVEGKGGRQRLV
XERD_LEPIC      VMRSIPDYLTQDEIEIKEDNLYELRDKCIFELLYSSGLRISEACNLRLNDMDLEGMTLTVEGKGGRQRLV
XERC_PSESM      GERRLPKTLTDRTAQLLDGGVEDHRDQAIMELLYSSGLRLSELTGLNLDQLDLRDGLVQVLGKGSKTRVL
XERC_CHLAB      LPKELPSPITYEQVEILMATPDGLRDRCLLELFYSSGLRISEIVAINHWDIDFTSHLIRIRGKGKKERLV
XERC_PSEU2      GERRLPKTLTDRAAQLLDGGVEDHRDQAILELLYSSGLRLSELTGLNLDQLDLRDGLVQVLGKGSKTRVL
XERC_CHLCV      LPKELPSPITYEQVEILMATPDGFRDRCLLELFYSSGLRISEIVAINHWDIDFNSNLIRIRGKGKKERLV
XERC_PASMU      QNRHLPKNIDAEQVQQLLNNDSDIRDRAILELLYSSGLRLSELQSLNLNSINTRVREVRVMGKGNKERIV
XERD_OCEIH      ----------DRLLEIKMNTKLSVRNKAMLELLYATGLRVSELISLNVSDLHLMMGFVQCFGKGSKERIV
XERC_MANSM      QGKHLPKNINAEQLNKLLDNNSDLRDKAMLELMYSSGLRLSELQGLNLTSLNFRSREIRVLGKGNKERIL
XERC_CHLFF      -----------------------LRDRCLLELFYSSGLRISEIVSLNHWDIDFNSNLIRIRGKGKKERII
XERC_STACT      KEQYLPHFFYEEEMSALFETVEGLRDRVILELLYGTGIRVSELVNIKLEDLDLNSPGVKVLGKGNKERFI
XERC_SHESW      -------------LEIEGTDPLTLRDKAMMELFYSSGLRLAELAALNLSSVQYDLREVRVLGKGNKERIV
XERC_SHEPC      -------------LEIEGTDPLTLRDKAMMELFYSSGLRLAELAALNLSSVQYDLREVRVLGKGNKERIV
XERCL_THEON     TREEVRKI-----LSVIPPTKK--RDRLIFLLLYGAGLRVSELCNLKKSDVDFERSLIIVRGKGAKDRVV
XERC_LACLE      --------YQDEVGQVIRSLNDGVRNRAIVALFYATGMRLSELTDLKIKQLDLENGMILVHGKGNKDRYV
XERC_SHEON      -------------LEIDGNDPLTLRDKAIMELFYSSGLRLAELAALDLSSVQYDQREVRVLGKGNKERIV
XERC_LACDB      --------YQDEVGQVIRSLNDGVRNRAIVALFYATGMRLSELTDLKIKQLDLENGMILVHGKGNKDRYV
XERC_LACDA      --------YQDEVGQVIRSLNDGVRNRAIVALFYATGMRLSELTDLKIKQLDLENGMILVHGKGNKDRYV
XERC_ACTP7      ----------------------DLRDLAMMELMYSSGLRLSELQGLDLGDMDLAGREVRLLGKGNKERIV
XERD_BACSU      TERALPKVLALNEVERLLDTPKGYRDKAMLELLYATGIRVSEMIELKTADVHLSMGFIRCFGKGRKERIV
XERC_BACLD      QDKRIPXXXXXXXXXXXXXVSDGQRNQALLEFLYATGMRVSELCSLKESDLDLFLDTVLVHGKGRKQRYI
XERCL_PYRKO     TREEVKRL-----LSVIPPTRK--RDRLIVLLLYGAGLRVSELCNLKKDDVDLDRGLIVVRGKGAKDRVV
XERD_STAEQ      YEKKLPDVLEDEVIALLEDLTKNYRDRTMLELLYATGMRVTEIIQLDVEDVNLMMGFVRVFGKGNKERIV
XERD_LISIN      QAQSLPKVLNLDDVEKLLSSSDTLRDQAMLEILYATGLRVTELVKLKMDDLHLQMGFIQTIGKGDKERII
XERD_STAES      YEKKLPDVLEDEVIALLEDLTKNYRDRTMLELLYATGMRVTEIIQLDVEDVNLIMGFVRVFGKGNKERIV
XERC_BIFLI      -----------------RVTAESQRNAAILELLYATGIRVAELVSMDIADIDFSNRTIKVTGKGNKQRVV
XERC_BIFLD      -----------------RVTAESQRNAAILELLYATGIRVAELVSMDIADIDFSNRTIKVTGKGNKQRVV
XERC_VIBPA      --KNLDVDEVNQLLEVNEDDPLAIRDRAMMELMYGAGLRLAELVSVDVRDVQLRSGELRVIGKGDKERKV
XERC_VIBCM      -------------LEVTDDDPLSIRDRAIMELMYGAGLRLAELVSIDIKDVNLSEGEIRVIGKGNKERKV
XERC_VIBCH      -------------LEVTDDDPLSIRDRAIMELMYGAGLRLAELVSIDIKDVNLSEGEIRVIGKGNKERKV
XERC_VIBC3      -------------LEVTDDDPLSIRDRAIMELMYGAGLRLAELVSIDIKDVNLSEGEIRVIGKGNKERKV
XERC_SHESR      -----------------------LRDKAIMELFYSSGLRLAELAALDLSSVQYDQHEVRVLGKGNKERIV
XERC_SHESM      -----------------------LRDKAIMELFYSSGLRLAELAALDLSSVQYDQHEVRVLGKGNKERIV
XERC_SHESA      -----------------------LRDKAIMELFYSSGLRLAELAALDLSSVQYDQHEVRVLGKGNKERIV
XERC_NATTJ      KERKLPEFLSIEEVEMLGDDPFGLRDKAILEVFYCSGIRLGELWGLDLQNLDLQTGYLKVTGKGNIERLA
XERC_CHRVO      RDKLLPKALPVDGTAALLDRIEDARDRAIFELVYSCGLRLSETVALNLDDVDFSDSLLRIRGKGGKERLV
XERC_CHLPN      -----------------------LRDRCLMELFYSSGLRISEIVAVNKQDFDLSTHLIRIRGKGKKERII
XERC_VIBHB      --KNLDVDEVNQLLEVNEDDPLAVRDRAMMELMYGAGLRLAELVSVDVRDVQLRSGELRVIGKGDKERKV
XERC_ROSCS      ---------------------ERIRDKAMLELLYATGVRVSELVALNVNDVDLERNEVRCIGKNGRVRVL
XERC_HAES2      --EQVQQLLTNESKEPI-----DLRDKAMMELMYSSGLRLSELQSLNLNSINIRSREVRVIGKGNKERIL
XERC_VIBVY      --KNLDVDEVNQLLEVNEDDPLAIRDRAIMELMYGAGLRLAELVDIDVRDVHLRSGEIRVIGKGNKERKV
XERC_VIBVU      --KNLDVDEVNQLLEVNEDDPLAIRDRAIMELMYGAGLRLAELVDIDVRDVHLRSGEIRVIGKGNKERKV
XERC_LACCB      ------------------------RNRALLEVLYGTGIRVSECAKLTLNQVDFNTALLLIHGKGNKDRYV
XERC_LACC3      ------------------------RNRALLEVLYGTGIRVSECAKLTLNQVDFNTALLLIHGKGNKDRYV
XERD_LISMO      QAQGLPKVLNLDDVEKLLSSSDTLRDQAMMEILYATGLRVTELVSLKMDDLHLHMGFIQTIGKGDKERII
XERD_LISMF      QAQGLPKVLNLDDVEKLLSSSDTLRDQAMMEILYATGLRVTELVSLKMDDLHLHMGFIQTIGKGDKERII
XERC_TREDE      ------------------------RDAALFASLYSTGCRVSELAGLDIKDLDKTLSYAIVFGKGKKERKV
XERC_PSEF5      ------------------------RDQAILELFYSCGLRLSELTSLNLDQLDLADGLVQVHGKGSKTRVL
XERC_HAEIN      ----------------------DIRDRAILELMYSSGLRLSELQGLDLNSINTRVREVRVIGKGNKERVV
XERC_HAEIE      ----------------------DIRDRAILELMYSSGLRLSELQGLDLNSINTRVREVRVIGKGNKERVV
XERC_HAEI8      ----------------------DIRDRAILELMYSSGLRLSELQGLDLNSINTRVREVRVIGKGNKERVV
XERC_PSEPF      ---------TDRALQLLEGAVEDRRDQAILELFYSSGLRLSELTGLNLDQLDLADGMVQVLGKGSKTRLL
XERC_PSEFL      ---------TDRALQLLEGAVEDRRDQAILELFYSSGLRLSELTGLNLDQLDLADGMVQVLGKGSKTRLL
XERD_STAHJ      ------------------------RDRTILELLYATGMRVTELIQIEIDDVNLIMGFVKVFGKGNKERII
XERC_SHEAM      QSKNLDPDSVNHLLDIPPEDGLALRDKAIMELFYSCGLRLAELAALDVKDLDRESREVRVIGKGSKERIL
XERC_ALCBS      SGKRLPKALDVDQVSHLLDNSEPLRDQAIMELLYACGLRLAELLSLNLDSIDLHESQLLVTGKGNKTRPA
TNRI_BACTU      ---------------VLEDN--NKRNYAIATLLAYTGVRISEALSIKMNDFNLQTGECIISGKGGKQRIV
XERD_RHIME      KARTLPKTLSIEDVTRLIGQAEKLRMHALIELLYATGMRVSELVSLPASVLAQNGRFLIIRGKGNKERLV
XERC_SYNAS      TEKYIPAVLSVDEIFVLLEDVFGLRDRAILELFYSSGIRVSELTGINEEDMDFSQGLIRIRGKGKKERIV
XERC_PSEU5      ---------TDRAMQLLDGGVEDRRDQAMLELFYSSGLRLSELVGLNLDQLDLAAGLVRVLGKGNKVREL
VINT_BPL2       NDTKPFERFYHDDLELIMTYTKNLNSSSFIRLLLDSGLRVSEALNIKISDMDFKNKVIVLSSKTRKQRYA
XERD_STAS1      YDRKLPDVLENEVLALLETKINGYRDRTMLELLYATGMRVSELIQIELEDVNLIMGFVKVFGKGNKERIV
XERC_PSEFS      ---------TDRALQLLDGAVEDHRDQAILELFYSSGLRLSELTGLNLDQLDLADGLVQVLGKGSKTRVL
XERC_PROMI      SGRHLKNMDVDEVSQLMNIDLKDVRDRTMLEVMYGAGLRLSELTNLNINDIDLQEGEVRVLGKGSKERKV
XERC_SHIF8      APRHLPKNIDVDDMNRLLDIDINVRDRAMLEVMYGAGLRLSELVGLDIKHLDLESGEVWVMGKGSKERRL
XERC_ECO27      -----------------------VRDRAMLEVMYGAGLRLSELVGLDIKHLDLESGEVWVMGKGSKERRL
XERC_VIBSL      -------------LDVNEDDPLSIRDRAMMEVMYGAGLRLAELVGINLKDVLGRQGEIRVIGKGDKERKA
XERC_SHISS      -----------------------VRDRAMLEVMYGAGLRLSELVGLDIKHLDLESGEVWVMGKGSKERRL
XERC_SHIFL      -----------------------VRDRAMLEVMYGAGLRLSELVGLDIKHLDLESGEVWVMGKGSKERRL
XERC_SHIDS      -----------------------VRDRAMLEVMYGAGLRLSELVGLDIKHLDLESGEVWVMGKGSKERRL
XERC_SHIBS      -----------------------VRDRAMLEVMYGAGLRLSELVGLDIKHLDLESGEVWVMGKGSKERRL
XERC_SHIB3      -----------------------VRDRAMLEVMYGAGLRLSELVGLDIKHLDLESGEVWVMGKGSKERRL
XERC_ESCF3      -----------------------VRDRAMLEVMYGAGLRLSELVGLDIKHLDLESGEVWVMGKGSKERRL
XERC_ECOUT      -----------------------VRDRAMLEVMYGAGLRLSELVGLDIKHLDLESGEVWVMGKGSKERRL
XERC_ECOSM      -----------------------VRDRAMLEVMYGAGLRLSELVGLDIKHLDLESGEVWVMGKGSKERRL
XERC_ECOSE      -----------------------VRDRAMLEVMYGAGLRLSELVGLDIKHLDLESGEVWVMGKGSKERRL
XERC_ECOLU      -----------------------VRDRAMLEVMYGAGLRLSELVGLDIKHLDLESGEVWVMGKGSKERRL
XERC_ECOLI      -----------------------VRDRAMLEVMYGAGLRLSELVGLDIKHLDLESGEVWVMGKGSKERRL
XERC_ECOLC      -----------------------VRDRAMLEVMYGAGLRLSELVGLDIKHLDLESGEVWVMGKGSKERRL
XERC_ECOL6      -----------------------VRDRAMLEVMYGAGLRLSELVGLDIKHLDLESGEVWVMGKGSKERRL
XERC_ECOL5      -----------------------VRDRAMLEVMYGAGLRLSELVGLDIKHLDLESGEVWVMGKGSKERRL
XERC_ECOK1      -----------------------VRDRAMLEVMYGAGLRLSELVGLDIKHLDLESGEVWVMGKGSKERRL
XERC_ECOHS      -----------------------VRDRAMLEVMYGAGLRLSELVGLDIKHLDLESGEVWVMGKGSKERRL
XERC_ECODH      -----------------------VRDRAMLEVMYGAGLRLSELVGLDIKHLDLESGEVWVMGKGSKERRL
XERC_ECOBW      -----------------------VRDRAMLEVMYGAGLRLSELVGLDIKHLDLESGEVWVMGKGSKERRL
XERC_ECO8A      -----------------------VRDRAMLEVMYGAGLRLSELVGLDIKHLDLESGEVWVMGKGSKERRL
XERC_ECO81      -----------------------VRDRAMLEVMYGAGLRLSELVGLDIKHLDLESGEVWVMGKGSKERRL
XERC_ECO7I      -----------------------VRDRAMLEVMYGAGLRLSELVGLDIKHLDLESGEVWVMGKGSKERRL
XERC_ECO55      -----------------------VRDRAMLEVMYGAGLRLSELVGLDIKHLDLESGEVWVMGKGSKERRL
XERC_ECO45      -----------------------VRDRAMLEVMYGAGLRLSELVGLDIKHLDLESGEVWVMGKGSKERRL
XERC_ECO24      -----------------------VRDRAMLEVMYGAGLRLSELVGLDIKHLDLESGEVWVMGKGSKERRL
XERD_STAAW      YDKKLPDVLNDEVLALLENKINGYRDRTMLELLYATGMRVSELIHLELENVNLIMGFVRVFGKGDKERIV
XERD_STAAU      YDKKLPDVLNDEVLALLENKINGYRDRTMLELLYATGMRVSELIHLELENVNLIMGFVRVFGKGDKERIV
XERD_STAAS      YDKKLPDVLNDEVLALLENKINGYRDRTMLELLYATGMRVSELIHLELENVNLIMGFVRVFGKGDKERIV
XERD_STAAR      YDKKLPDVLNDEVLALLENKINGYRDRTMLELLYATGMRVSELIHLELENVNLIMGFVRVFGKGDKERIV
XERD_STAAN      YDKKLPDVLNDEVLALLENKINGYRDRTMLELLYATGMRVSELIHLELENVNLIMGFVRVFGKGDKERIV
XERD_STAAM      YDKKLPDVLNDEVLALLENKINGYRDRTMLELLYATGMRVSELIHLELENVNLIMGFVRVFGKGDKERIV
XERD_STAAC      YDKKLPDVLNDEVLALLENKINGYRDRTMLELLYATGMRVSELIHLELENVNLIMGFVRVFGKGDKERIV
XERC_MYCLE      -----------------------LRDRLIVEMLYATGIRVSELCGLDIDDVDTRHRLVRVLGKGNKQRTA
XERC_ECO5E      -----------------------VRDRAMLEVMYGAGLRLSELVGLDIKHLDLESGEVWVMGKGSKERRL
XERC_ECO57      -----------------------VRDRAMLEVMYGAGLRLSELVGLDIKHLDLESGEVWVMGKGSKERRL
XERD_SALTY      LPQRLPKDLSEAQVERLLDQPLELRDKAMLEVLYATGLRVSELVGLTMSDISLRQGVVRVIGKGNKERLV
XERD_SALTI      LPQRLPKDLSEAQVERLLDQPLELRDKAMLEVLYATGLRVSELVGLTMSDISLRQGVVRVIGKGNKERLV
XERD_PASMU      LPSRLPKYLTEQQVTDLLNSPDELRDKAMMELLYATGLRVTELVSLTIENININQGIVRVVGKGNKERIV
XERD_ECO57      LPQRLPKDLSEAQVERLLDQPLELRDKAMLEVLYATGLRVSELVGLTMSDISLRQGVVRVIGKGNKERLV
XERC_YERPE      -----------------------VRDRAMLEVMYGAGLRLSELVGMNCKHVDLASGDVWVMGKGSKERKV
XERC_ROSS1      ---------------------ERIRDKAMLELLYATGMRVSELVALNMTDIDLVHSTVRCTGKNGRVRVL
XERD_PROMI      LPKRLPKDLSEQQVENLLDEPIELRDKAMLEVLYACGLRVSELVGLSLSDISLRQGVLRVIGKGDKERLV
XERD_CHLTE      -----------------------LRDKAMLEFLYATGVRVSELLGLSRLNLHMDDGFVRVFGKGSKERLV
XERC_SALTY      -----------------------VRDRAMLEVMYGAGLRLSELVGLDIKHLDLDTGEVWVMGKGSKERRL
XERC_SALTI      -----------------------VRDRAMLEVMYGAGLRLSELVGLDIKHLDLDTGEVWVMGKGSKERRL
XERD_SHIFL      LPQRLPKDLSEAQVERLLDQPLELRDKAMLEVLYATGLRVSELVGLTMSDISLRQGVVRVIGKGNKERLV
XERD_ECOLI      LPQRLPKDLSEAQVERLLDQPLELRDKAMLEVLYATGLRVSELVGLTMSDISLRQGVVRVIGKGNKERLV
XERD_ECOL6      LPQRLPKDLSEAQVERLLDQPLELRDKAMLEVLYATGLRVSELVGLTMSDISLRQGVVRVIGKGNKERLV
XERC_XANCP      XXXXXXQVLDADEVEVPTDAPLGLRDRALLELFYSSGLRLSELCALRWRDLDLDSGLVTVLGKGGKQRLV
XERC_XANCB      XXXXXXQVLDADEVEVPTDAPLGLRDRALLELFYSSGLRLSELCALRWRDLDLDSGLVTVLGKGGKQRLV
XERC_XANC8      XXXXXXQVLDADEVEVPTDAPLGLRDRALLELFYSSGLRLSELCALRWRDLDLDSGLVTVLGKGGKQRLV
XERD_YERPE      LPQRLPKDLSEAQVDALLNSPNELRDKAMLEVLYATGLRVSELVGLTISDVSLRQGVVRVIGKGNKERLV
XERC_XANAC      -------------VEVPTDAPLGLRDRALLEVFYSSGLRLSELCALRWRDLDLDSGLVMVLGKGSKQRLV
XERD_NEIMB      IDKNIPTLITEQQISRLTDTPHGLRDKALLELMYATGLRVSEAVGLNFGNVDLDRGCITALGKGDKQRMV
XERD_NEIMA      IDKNIPTLITEQQISRLTDTPHGLRDKALLELMYATGLRVSEAVGLNFGNVDLDRGCITALGKGDKQRMV
XERC_THELT      IRRRIPDFLLPSEIQLLEFSMKNQRDYLMLSLLYFCGLRVSELCNLRVEDLSFSPAFVITMGKGKKDRIV
XERC_CHRSD      -----------------------VRDQAMLELFYSCGLRLAELTALDVTDLDA--RRLRVVGKGNKPRQM
XERD_HAEDU      KRVQLPKSLSEEQVMDLLDAPNELRDKAMLELLYATGLRVTELISLTIDNLNLRQGVVRVIGKGDKERLV
XERC_SERMA      --KNIDVDEMNQLLEIDLNDPLAVRDRAMLEVMYGAGLRLSELVGLDCRHVDMAAGEVWVMGKGSKERKL
XERC_PSYIN      -------------LDIDEKDPLSIRDQCMMELMYSSGLRLSELVGINLQDIKLSAKEIMVTGKGSKQRLL
XERC_MYXXD      -----------------------LRDRAILELLYGGGLRISELCGLDLLDIDRSGRIVRVMGKGSKERLV
XERC_MYXXA      -----------------------LRDRAILELLYGGGLRISELCGLDLLDIDRSGRIVRVMGKGSKERLV
XERC_ACTSZ      QGKYLPKNIDQEQIGKLLDNRSNIRDRAMLELMYSSGLRLSELHGLDLNHVNLQSREVRVLGKGSKERIL
XERC_NEIMA      QPERVPKALPQEWLNRMLDLPVDVRDHALFELMYGSGLRVSEIHGLNADDVYLDEAWVHVTGKGRKQRQV
XERD_CLOAB      IRRNFPDILTIEEVEKLLNTDKGIRDKAMLEIMYATGMKVTELLNLTIYDINLKLSYIKCRGIKNKEREI
XERD_BIFLO      -----------------------LRDKALLEFMYATGCRVSEATGANLDDIDLDEHIARLMGKGSKQRLV
XERC_PSEPW      ---------TDRALQLLDGGVDDRRDQAILELFYSSGLRLSELTNLDLEHLDLAAGLVQVLGKGGKARVL
XERD_RICCN      YQNKLPEILSIAQIKSLLEHCEGIRLNAMIHLLYASGLRVSELVSLKLADIKGEVRKIFVLGKGNKERVI
XERD_HAEIN      TEQQVSDLLNTPNVEVPLE----LRDKAMLELLYATGLRVTELVSLTIENMSVQQGVVRVIGKGNKERIV
XERC_CHLTE      ---------------------ELARDRAVLELLYGCGLRLSEVTGLENADVDLVHGFLKVTGKGRKQRIV
XERC_NEIMF      QPERVPKALPQEWLNRMLDLPVDVRDHALFELMYGSGLRVSEIHGLNADDVYLDEAWVHVTGKGRKQRQV
XERC_MYCGI      -----------------------VRDRLVVEMLYATGIRVSELCGLDVDDVDTSRRLLRVLGKGNKQRTV
XERC_PELPD      -----------------------LRDRAILETLYSSGLRVSELTGLAIRDINLAGGMLRVMGKGGKERIV
XERC_NEIG2      QPERVPKALPQEWLNRMLDLPVDVRDHALFELMYGSGLRVSEIHGLNADDVYLDEAWVHVTGKGRKQRQV
XERC_NEIG1      QPERVPKALPQEWLNRMLDLPVDVRDHALFELMYGSGLRVSEIHGLNADDVYLDEAWVHVTGKGRKQRQV
XERD_RICBR      YQNKLPEILSIDDIKSLLEYCEGARLNAMIHLLYASGLRVSELVSLKLSDINKVSREVKVLGKGNKERII
XERC_EUBR3      -----------------------LRDAAIVELLFSTGIRISELCNLKISDVNLIDGVILIYGKGSKERIL
XERD_RICFE      YQNKLPEILSIDQIKSLLEYCEGIRLNAMIHLLYASGLRVSELVSLKLTDIKGEVRKIFVLGKGNKERVI
XERC_RALPJ      ------------------DDAETIRDRAVNELFYSCGLRLSELVSLDMSWLDLEAREVQVLGKGSKRRTV
XERC_NEIM0      QPERVPKALPQEWLNRMLDLPVDVRDHALFELMYGSGLRVSEIHGLNADDVYLDEAWVHVTGKGRKQRQV
XERD_LACCA      -----------------------LRDRAIFELMYATGLRVSEVVGLRLDQLHLAMNLLQVTGKGDKERLV
XERC_XYLFA      ALRKLPRILDADEVQIPTDTPLGLRDRALLELFYSSGLRLSELCGLRWGGVDLDAGLVSVLGKGSRQRVV
XERC_SYNFM      ---------------------------ALFECMYSTGVRVSELAGMDESDVDFHEGMVRVLGKGSKERIV
XERC_GEOLS      REQNIDQTVTEAPGHTGQEQPTFARDTAILELLYSSGLRVSELTGLAVADLDRAAGMVRVQGKGGKERIV
XERC_AZOVD      ------------------------RDQAMLELFYSSGLRLSEXXXXXXXXXXXXXXXXXVHGKGNKARDL
XERC_PELPB      --------------------CE--RDRSILELLYSSGLRISELIGLKVGELDLERGYVKLTGKGRKQRIV
XERC_CHLP8      ---------------------ETFRDRAVLEVLYGCGLRLSELIALERADVDLVHGFLKVTGKGRKQRIV
XERD_RICPR      YQNKLPIILSIDQIKLILEYCEGIRLNAMINLLYASGLRVSELVSLKLADILTNNTSFSVLGKGNKERVI
XERC_THETN      ------------------------RDYAIITLFLNCGLRVSELVNINLDDI--KEDKLTVIGKGNKQRTI
XERC_NEIMB      QPERVPKALPQEWLNRMLDLPVDVRDHALFELMYGSGLRVSEIHGLNADDVYLDEAWVHVIGKGRKQRQV
XERD_CORGL      ----------------------DLRDRALVELLYGTGARISEAIGLAVDDVSEMPEVLRITGKGSKQRIV
XERD_SHEON      LSRHLPDSLSESQVDRLLDDPVECRDKAMLELLYATGLRVSELVGLTMEQMSLRQGLVRIIGKGGKERLV
XERC_XYLFT      ALRKLPRILDADEVQIPTDTPLGLRDRALLELFYSSGLRLSELCGLRWDGLDLDAGLVSVLGKGSRQRVV
XERC_XYLF2      ALRKLPRILDADEVQIPTDTPLGLRDRALLELFYSSGLRLSELCGLRWDGLDLDAGLVSVLGKGSRQRVV
XERC_PSEAE      ------------------------RDQALLELFYSSGLRLSELVGLDLEWLDLKEGLVRVRGKGNKVREL
XERC_PSEA7      ------------------------RDQALLELFYSSGLRLSELVGLDLEWLDLKEGLVRVRGKGNKVREL
XERC_PSEAB      ------------------------RDQALLELFYSSGLRLSELVGLDLEWLDLKEGLVRVRGKGNKVREL
XERC_PSEA8      ------------------------RDQALLELFYSSGLRLSELVGLDLEWLDLKEGLVRVRGKGNKVREL
XERD_RALSO      QPPRVPKTLSEAQVEALIDAPLGLRDRAMIELMYASGLRVSEIVALKTVEVGLEXXXXXXXXXXXXDRLV
XERS_STRPI      -DQEYPQQLSNRALSSFNKNKE--RDLAIIALLLASGVRLSEAVNLDLRDLNLKMMVIDVTRKGGKRDSV
XERD_VIBCH      LPTRLPKDLSEAQVEALLSAPDELRDKAMLELLYATGLRVTELVSLTMENMSLRQGVVRVMGKGGKERLV
XERC_THEAB      XXXXXXDFLTEDEVSIGAFNEENLRQKTAISLLYYAGLRISELCNLRTTDISFIPPFLVEMGKGRKDRLV
XERC_MYCS2      ARRTLPAVLRRDQLDAVNSGAQELRDRLIVELLYATGIRVSELCGLDIDDIDTSRRVVRVLGKGNKQRTV
XERS_STRZT      ------------------------RDLAIIALLLASGVRLSEAVNLDLRDLNLKMMVIDVTRKGGKRDSV
XERS_STRZP      ------------------------RDLAIIALLLASGVRLSEAVNLDLRDLNLKMMVIDVTRKGGKRDSV
XERS_STRZJ      ------------------------RDLAIIALLLASGVRLSEAVNLDLRDLNLKMMVIDVTRKGGKRDSV
XERS_STRR6      ------------------------RDLAIIALLLASGVRLSEAVNLDLRDLNLKMMVIDVTRKGGKRDSV
XERS_STRPS      ------------------------RDLAIIALLLASGVRLSEAVNLDLRDLNLKMMVIDVTRKGGKRDSV
XERS_STRPJ      ------------------------RDLAIIALLLASGVRLSEAVNLDLRDLNLKMMVIDVTRKGGKRDSV
XERS_STRP7      ------------------------RDLAIIALLLASGVRLSEAVNLDLRDLNLKMMVIDVTRKGGKRDSV
XERS_STRP4      ------------------------RDLAIIALLLASGVRLSEAVNLDLRDLNLKMMVIDVTRKGGKRDSV
XERS_STRP2      ------------------------RDLAIIALLLASGVRLSEAVNLDLRDLNLKMMVIDVTRKGGKRDSV
XERS_STRPN      ------------------------RDLAIIALLLASGVRLSEAVNLDLRDLNLKMMVIDVTRKGCKRDSV
XERD_VIBVY      LPQRLPKDISEEQVXXXXXXXXELRDKAMLELLYATGLRVTELVSLTMENISLRQGVVRVTGKGGKERLV
XERD_VIBVU      LPQRLPKDISEEQVXXXXXXXXELRDKAMLELLYATGLRVTELVSLTMENISLRQGVVRVTGKGGKERLV
XERD_MYCTU      -----------------------LRNRAVLELLYSTGARISEAVGLDLDDIDTHARSVLLRGKGGKQRLV
XERD_MYCBO      -----------------------LRNRAVLELLYSTGARISEAVGLDLDDIDTHARSVLLRGKGGKQRLV
XERC_BACHD      GVKKLPSFLYEEEMEQLLDALNGLRNRALFETIYASGLRVSECCGLKLQDVDLSIGTVFVFGKGRKERYV
XERS_STRA5      ------------------------RDLAIIALLLASGVRLSEAVNLDLKDINLNVMVIDVTRKGGKRDSV
XERS_STRA3      ------------------------RDLAIIALLLASGVRLSEAVNLDLKDINLNVMVIDVTRKGGKRDSV
XERS_STRA1      ------------------------RDLAIIALLLASGVRLSEAVNLDLKDINLNVMVIDVTRKGGKRDSV
XERC_MYCSS      -----------------------LRDRLIVEMLYATGIRVSELCGLDIDDVDTSRRLLRVLGKGDKQRTV
XERC_MYCSK      -----------------------LRDRLIVEMLYATGIRVSELCGLDIDDVDTSRRLLRVLGKGDKQRTV
XERC_MYCSJ      -----------------------LRDRLIVEMLYATGIRVSELCGLDIDDVDTSRRLLRVLGKGDKQRTV
XERC_MYCTU      -----------------------LRDRLIVELLYATGIRVSELCGLDVDDIDTGHRLVRVLGKGNKQRTV
XERC_MYCTA      -----------------------LRDRLIVELLYATGIRVSELCGLDVDDIDTGHRLVRVLGKGNKQRTV
XERC_MYCBT      -----------------------LRDRLIVELLYATGIRVSELCGLDVDDIDTGHRLVRVLGKGNKQRTV
XERC_MYCBP      -----------------------LRDRLIVELLYATGIRVSELCGLDVDDIDTGHRLVRVLGKGNKQRTV
XERC_MYCBO      -----------------------LRDRLIVELLYATGIRVSELCGLDVDDIDTGHRLVRVLGKGNKQRTV
XERC2_RALSO     -----------------------LRDRAMLELLYSTGIRRMEVAGLALYDVDATRRLAFVRGKGAKDRVV
XERC1_RALSO     ------------------DDPEAVRDRAVNELFYSCGLRLSELVGLDASWLDLEAREVTVLGKGNKRRTV
XERD_RHILO      ------------------DRLAALRLHALVEVLYATGLRVSELVGLPVTVAQRDDRFFMVRGKGDKERMV
XERC_PSEPG      ---------TDRALQLLDGGVDDRRDQAILELFYSSGLRLSELTNXXXXXXXXAAGLVQVLGKGGKARVL
XERCL_PYRAB     XEEEVRRII---------NAAETXXXXXXXXXXXXXXXXVSELCNLRVEDVNFEYXXXXXXXXXXXXXXX
XERS_STRT2      ------------------------RDLAIIALLLSSGVRLSEAVNLDLKDINLKRMVIDVTRKGGQRDSV
XERS_STRT1      ------------------------RDLAIIALLLSSGVRLSEAVNLDLKDINLKRMVIDVTRKGGQRDSV
XERS_STRGC      ------------------------RDLAIIALLLASGVRLSEAVNLDLKDINLKMMVIEVTRKGGKRDSV
Y4RF_RHISN      -----------------------IRDRAVLLLLATTGIRNGELRAIRLQDIDWRTGEVFIRRKGKRDRVV
XERC_PSEP1      ---------TDRALQLLDGGVDDRRDQAILELFYSSGLRLSELTNXXXXXXXXAAGLVQVLGKGGKARVL
XERS_STRSV      ------------------------RDLAIIALLLASGVRLSEAVNLDLKDINLKMMVIEVTRKGGKRDSV
XERD_PSEPK      ------------------------RDRAMLEVLYACGLRVTELVSLTLDQVNLRQGVLRVMGKGSKERLV
XERD_PSEAE      ------------------DDPLGLRDRTMLEVLYACGLRVSELVGLTLEQVNLRQGVVKVFGKGSKERLV
XERC_PSEPK      ---------TDRALQLLDGGVDDRRDQAILELFYSSGLRLSELTNXXXXXXXXAAGLVQVLGKGGKARVL
XERS_STRTD      ------------------------RDLAIIALLLSSGVRLSEAVNLDLKDINLKMMVIDVTRKGGQRDSV
XERS_STRMU      -------------LSSFRKNKE--RDLAIIALLLASGVRLSEAVNLDLKDVNLNMMIIEVTRKGGKHDSV
XERD_BRAJA      -----------------------LRLYCLLEVLYATGLRVSELVALPRTAAKRDARMIVVRGKGNKERLV
XERD_XANCP      -----------------------LRDRAMLELMYAAGLRVSELVTLPAVAINLRQGVLRVTGKGSKERLV
Y4RC_RHISN      -----------------RSTWSGRRDHAFLLVAVQTGLRLSEITGLKRDDLFFTGAHLRVIGKGRKERCT
XERD_XANAC      ------------------------RDRAMLELMYAAGLRVSELVNLPAVGVNLRQGVLRVTGKGSKDRLV
XERD_COREF      TGRHLPDTLSVPEVETLIDAIPDIRDRALLEVLYGTGARISEAVGLMVDDVTHTPEVLRITGKGSKQRMV
XERS_STRU0      ------------------------RDLAIIALLLASGVRLSEAVNLDLKDVNLKMMVIEVTRKGGKRDSV
XERS_STRPG      ------------------------RDLAIISLLLASGVRLSEAVNLDLKDVNLNMMIIEVIRKGGKRDSV
XERS_STRP6      ------------------------RDLAIISLLLASGVRLSEAVNLDLKDVNLNMMIIEVIRKGGKRDSV
XERC_ERYLH      -----------------------VRLLALIELLYGSGLRATELVSLPVAAVPRDAPFLTVTGKGGVARMV
XERS_STRPZ      ------------------------RDLAIIALLLASGVRLSEAVNLDLKDVNLNMMIIEVIRKGGKRDSV
XERS_STRPM      ------------------------RDLAIIALLLASGVRLSEAVNLDLKDVNLNMMIIEVIRKGGKRDSV
XERS_STRPF      ------------------------RDLAIIALLLASGVRLSEAVNLDLKDVNLNMMIIEVIRKGGKRDSV
XERS_STRPD      ------------------------RDLAIIALLLASGVRLSEAVNLDLKDVNLNMMIIEVIRKGGKRDSV
XERS_STRPB      ------------------------RDLAIIALLLASGVRLSEAVNLDLKDVNLNMMIIEVIRKGGKRDSV
XERS_STRP8      ------------------------RDLAIIALLLASGVRLSEAVNLDLKDVNLNMMIIEVIRKGGKRDSV
XERS_STRP3      ------------------------RDLAIIALLLASGVRLSEAVNLDLKDVNLNMMIIEVIRKGGKRDSV
XERS_STRP1      ------------------------RDLAIIALLLASGVRLSEAVNLDLKDVNLNMMIIEVIRKGGKRDSV
XERD_XYLFT      XXXXXXXXXTESQIEALLETPEGLRNRAMLELMYAAGLRVSELVTLPVAMLNQRQGVLRITGKGGKERLV
XERC_PSEE4      ---------TDRALQLLDGGVDDRRDQAILELFYSSGLRLSELAGLDLEHLDLTXXXXXXXXXXXXSRVL
XERC_PELTS      LEKRLPRLYEDEAKELVEDTKQPLRDRALLETLYAGGLRISEXXXXXXXXXXISSGYIRVTGKRARERLV
XERS_STRPC      ------------------------RDLAIIALLLASGVRLSEAVNLDLKDVNLNMMIIEVIRKGGKRDSV
XERC_RICPR      KAKLLPKGLSVDDVLISLEHIEELRNKALIVLIYAAGLRISEALSITK--LHLQNLEFIIIGKGSKERII
XERD_CAUCR      -----------------KDSAQGLRLACMIELIYASGLRISEXXXXXXXXXXRDPAYLIVKGKGGKERLA
XERC_RICAE      KTKLLPKALSEDDVVISLEHIEELRNKALLVLIYASGLRISEALSITK--LHLQNLEFIIIGKGSKERII
XERC_RICPU      KTKLLPKALSEDDVVISLEHIEELRNKALLVLIYASGLRISEALSITK--LHLQNLEFIIIGKGSKERII
XERC_RICFE      KTKLLPKALSEDDVVISLEHIEELRNKALLVLIYASGLRISEALSITK--LHLQNLEFIIIGKGSKERII
Y367_METJA      -----------------------IRDALIIRLLWDTGCRVSEVLNLKYKDCDLDNGIFKIRNKTHEERTV
XERD_CHLPN      ------------------------RDTAILHTLYSTGVRVSELCDLRLGHV---SDDCIVTGKGSKTRLV
XERDL_THETN     VEKKEPVTLTVEQVDMLLSDEKGLRDKALIELMYASGLKVSEVISLKIEDVNLASGYIVV--RSGKERVI
XERC_RICCN      KTKLLPKALSEDDVVISLEHIEELRNKALLVLIYASGLRISEALSITK--LHLQNLEFIIIGKGSKERII
XERD_XYLFA      XXXXXXXXXTESQIEALLETPEGLRNRAMLELMYAAGLRVSELVTLPVAMLNRRQGVLRIIGKGGKERLV
XERC_RICM5      KTKLLPKALSEDDVVISLEHIEELRNKALLVLIYASGLRISEALSITK--LHLQNLEFIIIGKGSKERII
XERC_BRAJA      ------------------------RDAAVMALLYGSGLRISEALGLKRREVPKEGDVLVVTGKGNKTRMV
XERS_STRS7      ------------------------RDXXXXXXXXXSGIRLSEAVNLDLKDVNLNMMLVEVTRKGGKRDSV
XERS_STREM      ------------------------RDXXXXXXXXXSGIRLSEAVNLDLKDVNLNMMLVEVTRKGGKRDSV
XERD_CHLTR      ------------------------RDAAILYTFYATGIRVSELCDLCIGDIDFIR----VTGKGRKTRLV
XERS_STRE4      ------------------------RDXXXXXXXXXSGIRLSEAVNLDLKDVNLNMMLVEVTRKGGKRDSV
XERD_MYCLE      ----------------------------------STGSRISEAVGLDVDDVDTQARTVLLQGKGGKQRLV
XERC_RICRS      KTKLLPKALSEDDVVISLEHIEELRNKALLVLIYASGLRISEALSITK--LHLQNLEFIIIGKGSKERII
XERC_RICRO      KTKLLPKALSEDDVVISLEHIEELRNKALLVLIYASGLRISEALSITK--LHLQNLEFIIIGKGSKERII
XERC_RHOCS      -----------------------LRDRALFTLLYGCGLRISEAIGLNRSDLPAGAASVRVLGKGGKQRDV
TNPE_STAAU      YPKRAKPRFIDEFLEQLNSHLDKLPEYTMTMIVQECGMRISELCTLKKGCL-LEDKDGYYFWKMKKEHPI
TNPB_STAAU      -------------------------------IVQECGMRISELCTLKKGCL-LEDKDGDFFWKMKKEHPI
TNPB_STAAN      -------------------------------IVQECGMRISELCTLKKGCL-LEDKDGDFFWKMKKEHPI
TNPB_STAAM      -------------------------------IVQECGMRISELCTLKKGCL-LEDKDGDFFWKMKKEHPI
XERC_NITWN      VGKSVPKPIHMSAAKRFADASERARDAAVMALLYGSGLRISEALGLKRRDVPPPGAGLVVTGKGNKTRPV
XERCL_THETN     --------FSDEEIKKIKEALKGHRLKALFLLAFGTGLRQGELLGLKWTDIDFEKKELIIDEKGRKYKTI
XERS_STRSY      ------------------------RDLAILALLLASGVRLSEAVNLDLRDVNLNMMIIEVTRKGGKRDSV
XERS_STRS2      ------------------------RDLAILALLLASGVRLSEAVNLDLRDVNLNMMIIEVTRKGGKRDSV
XERD_BRUSU      -----------------------LRLHALLETLYATGLRVSELVGLPVTVARTDHRFLLVRGKGSKDRMV
XERD_BRUME      -----------------------LRLHALLETLYATGLRVSELVGLPVTVARTDHRFLLVRGKGSKDRMV
XERC_SYNE7      -----------------RQTAKGARDYAILRLLWENALRRSEAVQTRVQDLEQGDRRLWILGKGKGRQPV
XERD_CHLMU      ------------------------RDTAILYTFYATGIRVSELCDLCIGDIDFIR----VTGKGRKTRPI
XERC_RICCK      XXXXXXXXXXEDDVVISLKHIEELRNKALLVLIYATGLRISEALSITK--LHLQNLEFIIIGKGSKERII
TNPA_STAAU      -------TLRSKEVKQIIDACHTKRDKLILMLMYEGGLRIGEVLSLRLEDIDVNVNEAYI--KLRKERTI
TNPA_STAAN      -------TLRSKEVKQIIDACHTKRDKLILMLMYEGGLRIGEVLSLRLEDIDVNVNEAYI--KLRKERTI
TNPA_STAAM      -------TLRSKEVKQIIDACHTKRDKLILMLMYEGGLRIGEVLSLRLEDIDVNVNEAYI--KLRKERTI
Y4RA_RHISN      ---------------IDRDTPIGCRDYAMILALARLGLRSSEVVTLELDDIDWVAGRIRVRGKGRNELPL
XERC_RICTY      -----------------------LRNKALLVLIYAAGLRISEALSITK--LHLQNLEFIIIGKGSKERII
XERD_BRUAB      -----------------------LRLHALLETLYATGLRVSELVGLPVTVARTDHRFLLVRGKGSKDRMV
XERD_BRUA2      -----------------------LRLHALLETLYATGLRVSELVGLPVTVARTDHRFLLVRGKGSKDRMV
XERC_AGRT5      ------------------------RNAAVLSLLYGCGLRISEALGLTPADFPPGTRSLRITGKGNKTRIV
XERCL_PSEAE     --------------------------LCTFEVFYYTGIRLNALLCIRKRDIDWDNQLILIRGETEKTHKE
Y4QK_RHISN      ----------------------DLKHHAILTTCYAAGLRISEAVQLKPTDIDSQRMVVVEQGKGQKDRYV
XERC_RICAH      KTKLLPKALSEDDVVVSLEHIEELRNKSLLVLIYASGLRISEALSITK--LHLQNLEFIIIGKGSKERII
XERD_AGRT5      ----------------------------LLELLYATGMRVSELVSLPVKVLRQEGRFLMIRGKGNKDRMV
XERC_RHIME      ------------------------RNAAVLTLLYGCGLRIAEALDLTPADFSGPVTSLRVTGKGGKTRIV
INT2_SALTI      -------------------------------LLYGTGMRISEGLQLRVKDLDFDHGTIIVRGKGSKDRAL
INT2_PSEAE      -------------------------------LLYGTGMRISEGLQLRVKDLDFDHGTIIVRGKGSKDRAL
INT2_ECOLX      -------------------------------LLYGTGMRISEGLQLRVKDLDFDHGTIIVRGKGSKDRAL
XERC_UREPA      ------------------DSLEIKKYKTIIRFLFETGIRAHELFFLESI-----NNRLYVLGKGNKKRQI
XERC_BRUME      ------------------------RNAAVLTLLYGCGLRISEALGLSGDALDPSARSMTITGKGSKTRLV
XERC_BRUSU      ------------------------RNAAVLTLLYGCGLRISEALGLSGDALDPSARSMTITGKGSKTRLV
YOEC_BACSU      ---------------------KNKRDYFLFIFGINSALRISDILPLQVKDVQNKDHLWATESKTKKKRKI
Y4EF_RHISN      ---------------------------AILTTCYAAGLRISEAVQLKPTDIDSQRMVVVEHGKGQKDRYV
XERS_LACLS      ------------------------RDXXXXXXXXXSGIRLSEAVNVDLRDLNLNTMIVEVTRKGGKRDAV
XERS_LACLM      ------------------------RDXXXXXXXXXSGIRLSEAVNVDLRDLNLNTMIVEVTRKGGKRDAV
Y4RE_RHISN      ----------------------------LIGLLASSGLRSGEVVRLDRSDVDLTNGVLLVKTKFRKDRLV
XERC_RHILO      ------------------------RNAAVLTLLYGSGLRISEALGLAGADLASETDTVLVTGKGGKTRPV
XERS_LACLA      ------------------------RDXXXXXXXXXSGIRLSEAVNVDLRDLNLITMVVEVTRKGGKRDAV
Y4GC_RHISN      -----------------------LRDHAILQLLATYGLRSGEIRNMRIEDIDWRT-ETIRVRHSKTQAYT
YZ09_AQUAE      --------------------------------LLCSGLRISEAVKVRKKDFEVEGEEKEVWGKFGKERKI
FIME_SHIFL      ------------------------RDYCLILLAYRHGMRISELLDLHYQDLDLEGRINIRRLKNSTVHPL
FIME_ECOLI      ------------------------RDYCLILLAYRHGMRISELLDLHYQDLDLEGRINIRRLKNSTVHPL
FIME_ECOL6      ------------------------RDYCLILLAYRHGMRISELLDLHYQDLDLEGRINIRRLKNSTVHPL
XERC_METS4      --------------------------------------RIGEALGLRRKDAPVGGLDTLIVGKGQKTRMV
XERC_SYNY3      ---------------ITPDSLKGKRDLAIMRLLWDNALRRAEVCGLNVGDYQTERQXXXXXXXXXXXQAI
Y4RB_RHISN      ----------------------------LFGLLSVSGLRLGEARNLKLADVDFDAAVLTIRGKFGKSRLV
XERC_METNO      --------------------------------------RIGEALGIRRKDAPVGDIDTLILGKGQKTRMX
GP8D_CHLPS      ----------------------NYRDWLIAQTILQGAKRVTEALSVTTDHICFENG--VISFNQIKSRGV
VINT_BPML5      ------EALTPEELDIVAAEIEHYRIAAYI--LAWTSLRFGELIELRRKDIVDDGMTMIVVGNAKSKRPV
VINT_BPMD2      ------EALTPEELDVVAGEVFEHYRVAVY-ILAWTSLRFGELIEIRRKDIVDDGEEKIVVGNTKSKRPV
VINT_BPMFR      ------EALTPEELDVVAGEVFEHYRVAVY-ILAWTSLRFGELIEIRRKDIMDDGEEKIVVGNTKSKRPV
REDM_ECOLX      ----------------------------------------------------------------------
REDF_ECOLI      ----------------------------------------------------------------------
XERC_PSESX      --------------------------LAVFETFYYTGIRLNALLCLRYENVDLGQRLIRVRGETEKTH--
VINT_BPP22      ---------------------------SVVEFALSTGLRRSNIINLEWQQIDMQRKVAWIHPEQSKSNHA
INTD_ECOLI      ---------------------------SVVKFALATGLRKSNIINLEWQQIDMQRRVAWVNPEESKSNRA
GP8D_CHLTR      ----------------------NARDWLIAQTMLQGGKRSSEVLSLEISQICFQ-QATISFSQLKNRQTI
VINT_BPPH8      ----------------------SIESVFLVKFIMLTGCRTAEIRLSERSWFRLDDNEWVVPAGSYKTR-V
FIMB_ECOLI      ------------------------------------GFRASEICRLRISDIDLKAK-CIYIHRLKKGFST
FIMB_ECO57      ------------------------------------GFRASEICRLRISDIDLKAK-CIYIHRLKKGFST
VLF1_NPVOP      -----------------------IRGAIVFCIMLGTGMRINEARQLSVDDLN------VLIKKGKL-RSD
GP8D_CHLMU      ----------------------NPRDWLIAQTMLQGGKRSSEVLSLEIDQICFQ-QATISFSQLKNRQTI
VINT_BP434      SEVRRSRLTADEYLKIYQAAESSPCWLRLMELAVVTGQRVGDLCEMKWSDI-------------------
INTR_STRAM      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           YFDARTKIHLRNYLNDRKDSHPALFVTLVGKAQRLGIAGVEIRLRKLGDKLGIQKVHPHKFRRTLATKAI
XERC_STAAB      PFGAYCRQSIENYLEHFKPNHDFLIVNMKGEA--ITERGVRYVLNDIVKRAGVSEIHPHKLRHTFATHLL
XERC_OCEIH      PFGSFAEIALETYLQEEKSNSDTEFIFLNSRGGHLTNRGIRTILNKIVERASLTHVHPHKLRHTFATHLL
XERC_STAAN      PFGAYCRQSIENYLEHFKPNHDFLILNMKGEA--ITERGVRYVLNDIVKRAGVSEIHPHKLRHTFATHLL
XERC_STAAM      PFGAYCRQSIENYLEHFKPNHDFLILNMKGEA--ITERGVRYVLNDIVKRAGVSEIHPHKLRHTFATHLL
XERC_STAA9      PFGAYCRQSIENYLEHFKPNHDFLILNMKGEA--ITERGVRYVLNDIVKRAGVSEIHPHKLRHTFATHLL
XERC_STAA2      PFGAYCRQSIENYLEHFKPNHDFLILNMKGEA--ITERGVRYVLNDIVKRAGVSEIHPHKLRHTFATHLL
XERC_STAA1      PFGAYCRQSIENYLEHFKPNHDFLILNMKGEA--ITERGVRYVLNDIVKRAGVSEIHPHKLRHTFATHLL
XERC_STAAT      PFGAYCRQSIENYLEHFKPNHDFLIVNMKGEA--ITERGVRYVLNDIVKRAGVSEIHPHKLRHTFATHLL
XERC_STAAR      PFGAYCRQSIENYLEHFKPNHDFLIVNMKGEA--ITERGVRYVLNDIVKRAGVSEIHPHKLRHTFATHLL
XERC_STAAE      PFGAYCRQSIENYLEHFKPNHDFLIVNMKGEA--ITERGVRYVLNDIVKRAGVSEIHPHKLRHTFATHLL
XERC_STAAC      PFGAYCRQSIENYLEHFKPNHDFLIVNMKGEA--ITERGVRYVLNDIVKRAGVSEIHPHKLRHTFATHLL
XERC_STAA8      PFGAYCRQSIENYLEHFKPNHDFLIVNMKGEA--ITERGVRYVLNDIVKRAGVSEIHPHKLRHTFATHLL
XERC_STAA3      PFGAYCRQSIENYLEHFKPNHDFLIVNMKGEA--ITERGVRYVLNDIVKRAGVSEIHPHKLRHTFATHLL
XERC_LEPIN      YFGKEAVSSLQKYLEYRNVSFPAEEIFLNQRGKKLTTRGVRYILNERRKKMGWEKITPHKFRHTFATDLL
XERC_LEPIC      YFGKEAVSSLQKYLEYRNVSFPAEEIFLNQRGKKLTTRGVRYILNERRKKMGWEKITPHKFRHTFATDLL
XERC_STAAW      PFGAYCRQSIENYLEHFKPNHDFLIVNMKGEA--ITERGVRYVLNDIVKRAGVSEIHPHKLRHTFATHLL
XERC_STAAS      PFGAYCRQSIENYLEHFKPNHDFLIVNMKGEA--ITERGVRYVLNDIVKRAGVSEIHPHKLRHTFATHLL
XERC_STAAU      PFGAYCRQSIENYLEHFKPNHDFLILNMKGEA--ITERGVRYVLNDIVKRAGVSEIHPHKLRHTFATHLL
XERC_CORGL      PFGESAHKALRNWLDVRTEDPKALFVGVRG--QRINARQVRRIVDRAAKVTGVDHLSPHSLRHTAATHLL
XERCL_PYRHO     PISKTLLFEIERYLKTRKDNSPYLFVEKRNRKDKLSPKTVWMLVKKYGKKVGLN-VTPHQLRHSFATHML
XERC_PYRFU      PIPQPLLTEIKNYLRRRTDDSPYLFVESRRKKEKLSPKTVWRILKEYGRKAGI-KVTPHQLRHSFATHML
XERC_HERA2      PIVGSASTALEEYLDSRNGGDPALFLNHRGK--RLTRQGFWLILKGYAERLGLSDLTPHTLRHSFATHML
XERC_STAS1      PFGEFCKQSMERYLASFKSNHDYLLVNM--KGDPITERGVRYVLNDVVKRAGVTEIHPHKLRHTFATHML
XERC_PEDPA      PFGRYAKEALQNYLSKYKQTHNFVFINHYAKP--ITTTGIEYILNQVITASSLNKIHPHMLRHSFATALL
XERC_ANOFW      PFGTYAKEALERYIQDSKAKTPTDVLFLNARGGALTPRGVRHILNDIVERAALSKVSPHTFRHTFATHLL
XERC_BACSU      PFGSYAREALKVYMNSAKEPHDLLFVNQRGGP--LTARGIRHILSGLVQKASTLHIHPHMLRHTFATHLL
XERC_HAEDU      PIGSRALTALQAWLTVRPSFNPALFLNKRG--GRLSHRSIQLAMQKWGERQGLTRLHPHKLRHSFATHLL
XERC_BACP2      PFGSYAHEALITYLEDGKDRADA-YVFLNQRGAPLTDRGVRFILTELMKKAGTLHIHPHMLRHTFATHLL
XERC_CHLTR      PMTKVAVQWLQDYLNDREQDHQACFLNRFGK--RLSTRSIDRKFQQYLLKTGLSSITPHTIRHTIATHWL
XERC_CHLTB      PMTKVAVQWLQDYLNDREQDHQACFLNRFGK--RLSTRSIDRKFQQYLLKTGLSSITPHTIRHTIATHWL
XERC_CHLTA      PMTKVAVQWLQDYLNDREQDHQACFLNRFGK--RLSTRSIDRKFQQYLLKTGLSSITPHTIRHTIATHWL
XERC_CHLT2      PMTKVAVQWLQDYLNDREQDHQACFLNRFGK--RLSTRSIDRKFQQYLLKTGLSSITPHTIRHTIATHWL
XERC_LISIN      PFGAYAEDAITDYLSGRKKTHDSLLINHYGDP--LTTRGIRYCLTKIISKASLRKIHPHMLRHTFATDLL
XERC_LISMO      PFGAYAEDAITDYLPERKKSHDALLVNHYGDP--LTTRGIRYCLTKIISKASLRKIHPHMLRHTFATDLL
XERC_THEYD      PVGQKAKEALKKYLAIRQDETP-LFIN--NRGQRISDRQVRRIVEKYAKFIGVEKIGPHTLRHTFASHLL
XERC_STAHJ      PFGEFCRQSIEQYLREFKTKHSFLLVNMNGAP--ITERGVRYVLNDVVKRAGVTEIHPHKLRHTFATHLL
XERC_LISW6      PFGAYAEDAITDYLSSRKKEHDSLLINHYGDP--LTTRGIRYCLTKIISKASLRKIHPHMLRHTFATDLL
XERC_STAES      PFGEFCRQSIERYLEEQLANHDYLIVNM--KGDPITERGVRYVLNDVVKRAGVNDIHPHKLRHTFATHLL
XERC_STAEQ      PFGEFCRQSIERYLEEQLANHDYLIVNM--KGDPITERGVRYVLNDVVKRAGVNDIHPHKLRHTFATHLL
XERC_LISMF      PFGVYAEDAITDYLPERKKSHDALLVNHYGDP--LTTRGIRYCLSKIISKASLRKIHPHMLRHTFATDLL
XERC_LISMC      PFGVYAEDAITDYLPERKKSHDALLVNHYGDP--LTTRGIRYCLSKIISKASLRKIHPHMLRHTFATDLL
XERC_LISMH      PFGVYAEDAITDYLPKRKKSHDALLVNHYGDP--LTTRGIRYCLTKIISKASLRKIHPHMLRHTFATDLL
XERC_CHLMU      PMTKVAVQWLQAYLDDREQDHQACFLNRFGK--RLSTRSIDRKFQQYLLKTGLSTITPHTIRHTIATHWL
XERD_BACHD      PIGQVATEAVESYLANKKQSHDHVFVNHHGRP--LSRQGFWKMLKQLAKNVNIDKLTPHTLRHSFATHLL
XERC_PSE14      PVGSKARQALEIWLPLRALTNPAVFVSQQGK--RLGPRTIQVRLKAAGERELGQNLHPHMLRHSFASHLL
XERC_COREF      PFGKAAADALEQWLEARDR------MAKVEDAMFVGVRGGRIQIRRIVDRAGADHLSPHSLRHTAATHLL
XERCL_METTH     LFDENTRDLLMDYLKRRIHESEYLFLNRFG--DPLTPRYVQMMIKNYARKAGIKKVTPHILRHSFATHLL
XERD_LEPIN      PFGEKSLDILNRYL---KQSRPFILKSRNCEYLFVSKKGSYINRKSVWRLLNLKKVTPHTLRHSFATHLL
XERD_LEPIC      PFGEKSLDILNRYL---KQSRPFILKSRNCEYLFVSKKGSYINRKSVWRLLNLKKVTPHTLRHSFATHLL
XERC_PSESM      PVGSKARQALETWLPLRALTNPAVFVSQQGK--RLGPRAVQLRIKTAGERELGQNLHPHMLRHSFASHLL
XERC_CHLAB      PITPHAAQWLQHYLTHEKDAQ-AIFLNRFGK--RLTTRSIDRKFQKYLRQSGLSHITPHTIRHTIATHWL
XERC_PSEU2      PVGSKARQALEVWLPLRALTNPAVFVSQQGK--RLGPRAIQVRLKAAGERELGQNLHPHMLRHSFASHLL
XERC_CHLCV      PMTPHAAQWLQQYLHHPERAHQAFFLNRFGK--RLTTRSIDRKFQKYLRQSGLSSITPHTIRHTIATHWL
XERC_PASMU      PFGRYASHAIQQWLKVRILFNPALFVSQLG--NRLTHRAIQQRLEVWGIKQGLSSLNPHKLRHSFATHML
XERD_OCEIH      PLGDTAKHYLEKYISEARDSEDALFVNQHGR--RLTRQGFWKILKGLTLEAGILKITPHTLRHSFATHLL
XERC_MANSM      PFGRHASHSVQEWLKVRLLFNPALFVSSLG--NRMSNRSIQKRMEIWGVRQGLNSLNPHKLRHSFATQML
XERC_CHLFF      PITTLAAQWLKQYLNHAKDSQ-AIFLNCFG--TRLTTRSIDRKFQKYLRLSGLSNITPHTIRHTIATHWL
XERC_STACT      PFGNMCRESIERYLEIQNVKHDYLLVNINGRP--ITERGVRYVLNDIVKRAGVTDIHPHKLRHTFATHML
XERC_SHESW      PVGSYAIKALEAWLVCRQQEDCALFVT--GKGRRLSHRSIQSRMAKWGQEQALSRVHPHKLRHSFATHML
XERC_SHEPC      PVGSYAIKALEAWLVCRQQEDCALFVT--GKGRRLSHRSIQSRMAKWGQEQALSRVHPHKLRHSFATHML
XERCL_THEON     PIPAFLLEGIKAYLETRDDDSEYLIVERRERKDKLSPKTVWYLLKKYGDRAGI-RVTPHMLRHSFATHML
XERC_LACLE      FFDQESKKYLEEYLQVARPSTEAVFLNKLGRP--ISSRGIAKAVQQIFQKAGLTAAHPHELRHSFATAML
XERC_SHEON      PVGRYAIDAISAWLECRRQEDNALFVTEKGK--RLSHRSIQARMSKWGQEQALMRVHPHKLRHSFATHML
XERC_LACDB      FFDQESKKYLEEYLQAARPSTGAVFLNKLGRP--ISSRGIAKAVQQIFQKAGLTAAHPHELRHSFATAML
XERC_LACDA      FFDQESKKYLEEYLQAARPSTGAVFLNKLGRP--ISSRGIAKAVQQIFQKAGLTAAHPHELRHSFATAML
XERC_ACTP7      PIGSKALEALNRWLAVRNQFKPQDNAVFLNKGGRLSHRSIQLVMQKWGEKQGLESLHPHKLRHSFATHML
XERD_BACSU      PIGEAAASAIEEYMTKKNNVSDALFLNHHGK--QISRQGFWKNLKKIALEAGIKKLTPHTLRHSFATHLL
XERC_BACLD      PFGSFAREALDLYLQNGKAKEPCPFIFLNQRGGPLTPRGVRYILGELVKKTGTLHIHPHMLRHTFATHLL
XERCL_PYRKO     PIPKYLADEIRAYLESRSDESEYLLVERRRRKDKLSTRNVWYLLKRYGQKAGVE-VTPHKLRHSFATHLL
XERD_STAEQ      PLGDTVIEYLTTYIETKQTTTQALFLNMHGKS--LSRQGIWKIIKQYGLKANINKLTPHTLRHSFATHLL
XERD_LISIN      PLGKTATTVLEQYLEERRPKYRNDFVFLNHHGQGLTRQGFWKILKGIAKESGIEKITPHTLRHSFATHLL
XERD_STAES      PLGDTVIEYLTTYIETKQTTTQALFLNMHGKS--LSRQGIWKIIKQYGLKANINKLTPHTLRHSFATHLL
XERC_BIFLI      PFGLPAQRALETWL---EQGRPVLARTAAANALFLGARGGRIDQRIARDEAGVPDISPHALRHSAATHIL
XERC_BIFLD      PFGLPAQRALETWL---EQGRPVLARTAAANALFLGARGGRIDQRIARDEAGVPDISPHALRHSAATHML
XERC_VIBPA      PFSGMATEWVGKWLRVRGDGEPALFVSKLG--TRISHRSVQKRMAEWGQKQSVSHISPHKLRHSFATHML
XERC_VIBCM      WFAGQAQLKLRSQLADSAET--ALFVSKLG--TRISHRSVQKRMAEWGQKQAVSHISPHKLRHSFATHML
XERC_VIBCH      WFAGQAQLKLRSQLADSAET--ALFVSKLG--TRISHRSVQKRMAEWGQKQAVSHISPHKLRHSFATHML
XERC_VIBC3      WFAGQAQLKLRSQLADSAET--ALFVSKLG--TRISHRSVQKRMAEWGQKQAVSHISPHKLRHSFATHML
XERC_SHESR      PVGRYAIEAISAWLKCRKQEDNALFVTEKGK--RLSHRSIQARMSKWGQEQALMRVHPHKLRHSFATHML
XERC_SHESM      PVGRYAIEAISAWLKCRKQEDNALFVTEKGK--RLSHRSIQARMSKWGQEQALMRVHPHKLRHSFATHML
XERC_SHESA      PVGRYAIEAISAWLKCRKQEDNALFVTEKGK--RLSHRSIQARMSKWGQEQALMRVHPHKLRHSFATHML
XERC_NATTJ      PLGSFALAAIEDYLNKSVENCDALFLNKFGT--RISQRSIRRRVKKYVQQTASERVSPHSLRHSFATHLL
XERC_CHRVO      PIGAEAMLRLRTWLGERSADEPALF--XXXXXXXXXXXQVEKRLRDWAIKTGAQHVHPHMLRHSFASHML
XERC_CHLPN      PVTSNAIQWIQIYLNDRKEKDPAIFLNRFGR--RISTRSIDRSFQEYLRRSGLSHITPHTIRHTIATHWL
XERC_VIBHB      PFSGMATEWVGKWLRVRGDGEPALFVSKLG--TRISHRSVQKRMAEWGQKQSVSHISPHKLRHSFATHML
XERC_ROSCS      PINGSAATALEEYFDISRNSTEALFLNHRGK--RLTRQGFWLILKQYAEELGLSDLTPHVLRHSFAVHML
XERC_HAES2      PFGRYASQAIQQWLKVRLLFNPALFVSQLG--NRISHRSIQKRMETWGIRQGLNHLNPHKLRHSFATHML
XERC_VIBVY      PFAGMAVEWVGKWLKVRSPSEPALFVSKLG--TRISHRSVQKRMAEWGQKQAVSHITPHKLRHSFATHIL
XERC_VIBVU      PFAGMAVEWVGKWLKVRSPSEPALFVSKLG--TRISHRSVQKRMAEWGQKQAVSHITPHKLRHSFATHIL
XERC_LACCB      PFGQYAQQALRTYLKDGRQQHRYVFVNQYGRP--ITSRGIEYILDQLIKQTTLTNIHPHMLRHSFATHML
XERC_LACC3      PFGQYAQQALRTYLKDGRQQHRYVFVNQYGRP--ITSRGIEYILDQLIKQTTLTNIHPHMLRHSFATHML
XERD_LISMO      PLGKTATTVLEKYLEERRPKYRNDFVFLNHHGQGLTRQGFWKILKGIAKESGIEKITPHTLRHSFATHLL
XERD_LISMF      PLGKTATTVLEKYLEERRPKYRNDFVFLNHHGQGLTRQGFWKILKGIAKESGIEKITPHTLRHSFATHLL
XERC_TREDE      FFAEFAKEYLREYLKERSDIRDTLFIN--QKAQPLGIRYIIDRYVELSPEL--KHLSPHAFRHSFASTLI
XERC_PSEF5      PVGKKARSALEQWLPLRALSNPALFVSQKGR--RLGPRAIQLRVKAAGERELGQNLHPHMLRHSFASHLL
XERC_HAEIN      PFGRYASHAIQEWLKVRALFNPALFVSQLG--NRISHRAIQKRLETWGIRQGLNSLNPHKLRHSFATHML
XERC_HAEIE      PFGRYASHAIQEWLKVRALFNPALFVSQLG--NRISHRAIQKRLETWGIRQGLNSLNPHKLRHSFATHML
XERC_HAEI8      PFGRYASHAIQEWLKVRALFNPALFVSQLG--NRISHRAIQKRLETWGIRQGLNSLNPHKLRHSFATHML
XERC_PSEPF      PVGKKAREALEQWLPLRALTNPAVFVSQQGR--RLGPRAIQVRVKLAGERELGQNLHPHMLRHSFASHLL
XERC_PSEFL      PVGRKAREALEQWLPLRALTNPAVFVSQQGR--RLGPRAIQLRVKAAGERELGQNLHPHMLRHSFASHLL
XERD_STAHJ      PLGDTVIEYLDTYINNKKTVTNVLFLNLHGRP--LTRQGIWKLIKQYGLRANINKLTPHTLRHSFATHLL
XERC_SHEAM      PVGSVALAAIGDWLKVRNQQDDALFVS--SRGSRLSHRSIQARMEKWAQIQGLSGVHPHKLRHSFATHML
XERC_ALCBS      LTAVRRWLQVRPMLIKSSDQN-ALFISKNGR--RLSPSSVQQRLKRHALERGLDHLHPHKLRHSFATHLL
TNRI_BACTU      LLNSKVLSAIKDYLIDRKTAHESPYLFISKKREKLDRTVVNRIFKSYSNV-----ITPHQLRHFFCTNAI
XERD_RHIME      PLSQAAIRAMRAYLQEESADSPWLFPS-NGKSGHLPRQVFARDLKSLAARAGIRAISPHVLRHAFASHLL
XERC_SYNAS      PIGQPASEAVQRYMMKKPGSETSLFVN--RRQGRLSARSVARILSKYVSMSGLQKISPHTLRHSFATHLM
XERC_PSEU5      PVGSKAREALQAWLPLRTLAGPADGAVFIGQGRRLGARAVQLRVRQAGVRELGQHLHPHMLRHSFASHLL
VINT_BPL2       PFSSFSLKYIKELINPKRDY---LFYNFI-KDRQTNKNDIKLFYKRLKKHLNLERIHTHRFRKTFASILI
XERD_STAS1      PLGDTVIEYLKTYIETKKTVTNTLFLNMHGKP--LSRQAIWKMIKQNAIKANITKLTPHTLRHSFATHLL
XERC_PSEFS      PVGRKAREALQLWLPLRLLTNPAVFVSQQGR--RLGPRAIQVRVKAAGERELGQNLHPHMLRHSFASHML
XERC_PROMI      PLGRKAVEWLQHWFAMRELYSPAVFIS-TKSGKRLSVRSVQKRFELWGVKQGLSSVNPHKLRHSFATHLL
XERC_SHIF8      PIGRNAVAWIEHWLDLRDSEDDALFLSKLGK--RISARNVQKRFAEWGIKQGLNNVHPHKLRHSFATHML
XERC_ECO27      PIGRNAVAWIEHWLDLRNSEDDALFLSKLGK--RISARNVQKRFAEWGIKQGLNNVHPHKLRHSFATHML
XERC_VIBSL      PFSGLAKEWVDKWLKVRSPGETALFVSKLG--TRISHRSVQKRMEEWGKKQSVSHISPHKLRHSFATHVL
XERC_SHISS      PIGRNAVAWIEHWLDLRDSEDDALFLSKLGK--RISARNVQKRFAEWGIKQGLNNVHPHKLRHSFATHML
XERC_SHIFL      PIGRNAVAWIEHWLDLRDSEDDALFLSKLGK--RISARNVQKRFAEWGIKQGLNNVHPHKLRHSFATHML
XERC_SHIDS      PIGRNAVAWIEHWLDLRDSEDDALFLSKLGK--RISARNVQKRFAEWGIKQGLNNVHPHKLRHSFATHML
XERC_SHIBS      PIGRNAVAWIEHWLDLRDSEDDALFLSKLGK--RISARNVQKRFAEWGIKQGLNNVHPHKLRHSFATHML
XERC_SHIB3      PIGRNAVAWIEHWLDLRDSEDDALFLSKLGK--RISARNVQKRFAEWGIKQGLNNVHPHKLRHSFATHML
XERC_ESCF3      PIGRNAVAWIEHWLDLRDSEDDALFLSKLGK--RISARNVQKRFAEWGIKQGLNNVHPHKLRHSFATHML
XERC_ECOUT      PIGRNAVAWIEHWLDLRDSEDDALFLSKLGK--RISARNVQKRFAEWGIKQGLNNVHPHKLRHSFATHML
XERC_ECOSM      PIGRNAVAWIEHWLDLRDSEDDALFLSKLGK--RISARNVQKRFAEWGIKQGLNNVHPHKLRHSFATHML
XERC_ECOSE      PIGRNAVAWIEHWLDLRDSEDDALFLSKLGK--RISARNVQKRFAEWGIKQGLNNVHPHKLRHSFATHML
XERC_ECOLU      PIGRNAVAWIEHWLDLRDSEDDALFLSKLGK--RISARNVQKRFAEWGIKQGLNNVHPHKLRHSFATHML
XERC_ECOLI      PIGRNAVAWIEHWLDLRDSEDDALFLSKLGK--RISARNVQKRFAEWGIKQGLNNVHPHKLRHSFATHML
XERC_ECOLC      PIGRNAVAWIEHWLDLRDSEDDALFLSKLGK--RISARNVQKRFAEWGIKQGLNNVHPHKLRHSFATHML
XERC_ECOL6      PIGRNAVAWIEHWLDLRDSEDDALFLSKLGK--RISARNVQKRFAEWGIKQGLNNVHPHKLRHSFATHML
XERC_ECOL5      PIGRNAVAWIEHWLDLRDSEDDALFLSKLGK--RISARNVQKRFAEWGIKQGLNNVHPHKLRHSFATHML
XERC_ECOK1      PIGRNAVAWIEHWLDLRDSEDDALFLSKLGK--RISARNVQKRFAEWGIKQGLNNVHPHKLRHSFATHML
XERC_ECOHS      PIGRNAVAWIEHWLDLRDSEDDALFLSKLGK--RISARNVQKRFAEWGIKQGLNNVHPHKLRHSFATHML
XERC_ECODH      PIGRNAVAWIEHWLDLRDSEDDALFLSKLGK--RISARNVQKRFAEWGIKQGLNNVHPHKLRHSFATHML
XERC_ECOBW      PIGRNAVAWIEHWLDLRDSEDDALFLSKLGK--RISARNVQKRFAEWGIKQGLNNVHPHKLRHSFATHML
XERC_ECO8A      PIGRNAVAWIEHWLDLRDSEDDALFLSKLGK--RISARNVQKRFAEWGIKQGLNNVHPHKLRHSFATHML
XERC_ECO81      PIGRNAVAWIEHWLDLRDSEDDALFLSKLGK--RISARNVQKRFAEWGIKQGLNNVHPHKLRHSFATHML
XERC_ECO7I      PIGRNAVAWIEHWLDLRDSEDDALFLSKLGK--RISARNVQKRFAEWGIKQGLNNVHPHKLRHSFATHML
XERC_ECO55      PIGRNAVAWIEHWLDLRDSEDDALFLSKLGK--RISARNVQKRFAEWGIKQGLNNVHPHKLRHSFATHML
XERC_ECO45      PIGRNAVAWIEHWLDLRDSEDDALFLSKLGK--RISARNVQKRFAEWGIKQGLNNVHPHKLRHSFATHML
XERC_ECO24      PIGRNAVAWIEHWLDLRDSEDDALFLSKLGK--RISARNVQKRFAEWGIKQGLNNVHPHKLRHSFATHML
XERD_STAAW      PLGDAVIEYLTTYIETKKTVTEVLFLNMHGKP--LSRQAIWKMIKQNGVKANIKKLTPHTLRHSFATHLL
XERD_STAAU      PLGDAVIEYLTTYIETKKTVTEVLFLNMHGKP--LSRQAIWKMIKQNGVKANIKKLTPHTLRHSFATHLL
XERD_STAAS      PLGDAVIEYLTTYIETKKTVTEVLFLNMHGKP--LSRQAIWKMIKQNGVKANIKKLTPHTLRHSFATHLL
XERD_STAAR      PLGDAVIEYLTTYIETKKTVTEVLFLNMHGKP--LSRQAIWKMIKQNGVKANIKKLTPHTLRHSFATHLL
XERD_STAAN      PLGDAVIEYLTTYIETKKTVTEVLFLNMHGKP--LSRQAIWKMIKQNGVKANIKKLTPHTLRHSFATHLL
XERD_STAAM      PLGDAVIEYLTTYIETKKTVTEVLFLNMHGKP--LSRQAIWKMIKQNGVKANIKKLTPHTLRHSFATHLL
XERD_STAAC      PLGDAVIEYLTTYIETKKTVTEVLFLNMHGKP--LSRQAIWKMIKQNGVKANIKKLTPHTLRHSFATHLL
XERC_MYCLE      PFGVPAADALRGWLD---DGRPALVTVESGPALLLGSRGRRLDVRQVAVVAGAPDMGPHGLRHSAATHLL
XERC_ECO5E      PIGRNALSWIEHWLDLRDSEDDALFLSKLGK--RISARNVQKRFAEWGIKQGLNNVHPHKLRHSFATHML
XERC_ECO57      PIGRNALSWIEHWLDLRDSEDDALFLSKLGK--RISARNVQKRFAEWGIKQGLNNVHPHKLRHSFATHML
XERD_SALTY      PLGEEAVYWLETYLEHGRPSIDVLFPS--QRAQQMTRQTFWHRIKHYAVLAGIEKLSPHVLRHAFATHLL
XERD_SALTI      PLGEEAVYWLETYLEHGRPSIDVLFPS--QRAQQMTRQTFWHRIKHYAVLAGIEKLSPHVLRHAFATHLL
XERD_PASMU      PIGEEATYWIRQFMLYGRQSSDVVFPSKRALQMTRQTFWHRIKHYALLSDIDINSLSPHVLRHAFATHLV
XERD_ECO57      PLGEEAVYWLETYLEHGRPSIDVLFPS--QRAQQMTRQTLWHRIKHYAVLAGIEKLSPHVLRHAFATHLL
XERC_YERPE      PLGKTAVTWLQHWLALRELFEPAIFLANTGK--RISARNVQKRFAEWGVKQGVSSIHPHKLRHSFATHML
XERC_ROSS1      PINGSAATALEEYCDNSRSQLAALFLNHRGK--RLTRQGFWLILKQYAEEMGLGELTPHMLRHSFAVHML
XERD_PROMI      PLGEEAIYWLEQYL---QYGRPALFPSLRGQKMTRQTFWHRIKHYAVIAGIDSEKLSPHVLRHAFATHLL
XERD_CHLTE      PVGQTAISWMKRYLDELRPSHDTIFLSRGGPLSRMAAWNI---VREHAVIAGIEKISPHTFRHSFATHLL
XERC_SALTY      PIGRNAVTWIEHWLDLRASDEEALFLSKLGK--RISARNVQKRFAEWGIKQGLNSVHPHKLRHSFATHML
XERC_SALTI      PIGRNAVTWIEHWLDLRASDEEALFLSKLGK--RISARNVQKRFAEWGIKQGLNSVHPHKLRHSFATHML
XERD_SHIFL      PLGEEAVYWLETYLEHGRPSIDVLFPS--QRAQQMTRQTFWHRIKHYAVLAGIEKLSPHVLRHAFATHLL
XERD_ECOLI      PLGEEAVYWLETYLEHGRPSIDVLFPS--QRAQQMTRQTFWHRIKHYAVLAGIEKLSPHVLRHAFATHLL
XERD_ECOL6      PLGEEAVYWLETYLEHGRPSIDVLFPS--QRAQQMTRQTFWHRIKHYAVLAGIEKLSPHVLRHAFATHLL
XERC_XANCP      PVGSHAVAALRAWQRDSGGSQTHVFPGRAGGA--ISQRAVQIRIKQLAVRQGMFKVHPHMLRHSFASHIL
XERC_XANCB      PVGSHAVAALRAWQRDSGGSQTHVFPGRAGGA--ISQRAVQIRIKQLAVRQGMFKVHPHMLRHSFASHIL
XERC_XANC8      PVGSHAVAALRAWQRDSGGSQTHVFPGRAGGA--ISQRAVQIRIKQLAVRQGMFKVHPHMLRHSFASHIL
XERD_YERPE      PLGEEAVYWIENYMEHGRPSLDVLFPS--NRSQQMTRQTFWHRIKHYAILAGIERLSPHVLRHAFATHLL
XERC_XANAC      PVGSHAIAALREWRRDSADSH--VFPGRAGGA--ISQRAVQIRIKQLAVRQGMFKVHPHMLRHSFASHIL
XERD_NEIMB      PMGQESAYWVERYYTEARPNCDALFVS----QKKTGISRAWMIVKEYASQAGIGHISPHSLRHAFATHLV
XERD_NEIMA      PMGQESAYWVGRYYTEARPSCDALFVS----QKKTGISRAWMIVKEYASQAGIGHISPHSLRHAFATHLV
XERC_THELT      PLTSKLAEKLENYITSGKSPEDYLF----GSQIKIHPSTVFRIVRKYTMMCGIKKIHPHTLRHTFATHLL
XERC_CHRSD      PIGRRAQAALADWYRLRGQDEPALFVGQRGA--RLGHRAVQKRLAQLARERGLEHLHPHRLRHSFASHLL
XERD_HAEDU      PIGEEASYWIQEFLSDQQSD--VLFPSRRAKQMTRQTFWHRIKYYAILAGIDAEKLSPHVLRHAFATHLI
XERC_SERMA      PIGRTAVTWLEHWLAMRDLFGPAMFLSNQGR--RISTRNVQKRFAEWGVKQGVNSIHPHKLRHSFATHML
XERC_PSYIN      PITDRAVATVKIWLKIRPEDEKALFVS--KQKKRISARNVQARMEKWGLKQALPHINPHKLRHSFATHML
XERC_MYXXD      PVNAQSIRALEAYLARRGELLATIRKDQAPEAMFLNFRGGRLTPRSIARHLDTRKVSPHAMRHSFATHLL
XERC_MYXXA      PVNAQSIRALEAYLARRGELLATIRKDQAPEAMFLNFRGGRLTPRSIARHLDTRKVSPHAMRHSFATHLL
XERC_ACTSZ      PVGHQALDAVLDWLQVRLRFNPALFVSSQG--GRLTPRAIQKRMEIWGVKQGLSHLNPHKLRHSFATHML
XERC_NEIMA      PLTGKSVEALKNYLPLRQTASDGKALFTGRNGTRLSQRQIQKRLAQWAAQNGDRHVSPHMMRHSYAGHLL
XERD_CLOAB      YLKVRTKLNVQNI--------DYLFFNLQGKMTRQGFWKI---IKQYAQESGIKKINAYTLRHSFAVHLL
XERD_BIFLO      PLGSYACRAITAYLNEQRSSRRALFLNKRGK--RISRQSVWEIVKATGERAGITKLHPHTLRHSFATHLI
XERC_PSEPW      PVGRKAREAMQQWLRLRGIGGPAVFISRQGN--RLGPRAIQMRVKAAGERELGQHLHPHMLRHSFASHVL
XERD_RICCN      VINEQAVISIAKYLTIRNKAKPRNLIYLFPSSALAGYMAILLKSAALYAGLNPEYISPHILRHSFASHLL
XERD_HAEIN      PMGEEAAYWVRQFMLYGRQSSDVVFPSQRAQQMTRQTFWHRVKHYXXXXXXXXXXXSPHVLRHAFATHLV
XERC_CHLTE      PFGEPAAEALRNYFEVRRNFFRILFVTAKGR-QIYPMLVQRMTKRYLSPVTESARKNPHMLRHTFATHML
XERC_NEIMF      PLTGKSVEALKNYLPLRQTASDGKALFTGRNGTRLSQRQIQKRLAQWAAQNGDRHVSPHMMRHSYAGHLL
XERC_MYCGI      PYGEPAHAALTAWLH---EGRPALATADSGPALLLGARGKRLDPRQARTVVGAPDIGPHGLRHSAATHLL
XERC_PELPD      PLGSRAVRAIQEYLDSRGGGTATAPLFLNSRGDRINRRSVRIVDAHVHEIAAFKHISPHTLRHTFATHML
XERC_NEIG2      PLTGKSVEALKNYLPLRQTASDGKALFTGRNGTRLSQRQIQKRLESWAAQYGDRHVSPHMMRHSYAGHLL
XERC_NEIG1      PLTGKSVEALKNYLPLRQTASDGKALFTGRNGTRLSQRQIQKRLESWAAQYGDRHVSPHMMRHSYAGHLL
XERD_RICBR      VINEPAINSLVKYLVVRDNTKPKNLIYLFPSSAAAGYMAILLKSAALYAGLNPEHISPHVLRHSFASHLL
XERC_EUBR3      QIGNSSVLNLKEYKNDFYNNH--FFSSQSGKP--LSDQSVRRMINKYASLSSIDHITPHMFRHTFATSLL
XERD_RICFE      VINEQAVISIAKYLAIRNKAKPKNLIYLFPSSALAGYMAILLKSAALYANLNPEHISPHILRHSFASHLL
XERC_RALPJ      PVGTKATEALAAWLAVREDAH-ALFLSPRGK--RLAQRQIQLRMKRNAIAAGVPAVHPHVLRHSFATHML
XERC_NEIM0      PLTGKSVEALKNYLPLRQTASDGKALFTGRNGTRLSQRQIQKRLAQWAAQNGDRHVSPHMMRHSYAGHLL
XERD_LACCA      PISPQAADWVNRYLQESKHQQPAVFVNFHGHALTRQV--IWKNLKAYIASVGIEKVTPHTLRHSFATRLL
XERC_XYLFA      PVGSYALSALREWASSGGGAQQPVFPGRYGGP--ISARAVQVRIKQLAQRQGMAKVHPHMLRHSFASHLL
XERC_SYNFM      PVGGKALDAVKLYLRVLDSQFPALFRNARGR--RLTTRSVHRLLRMELRRCGLQHLSPHGLRHTFATHLL
XERC_GEOLS      PVGSAALEALEQYLAGRADDAPLFLGCRGARINRRTVA--QLVKRWASGIPAFRSISPHTLRHTFATHML
XERC_AZOVD      PIGSKAREALRAWLSLRAQARPADGALFVGRTRRLTPRAVQLRVRQAGVRELGQHLHPHMLRHSFASHLL
XERC_PELPB      PVGQQAVDALKKYFEVRRDAGELLHVFVTKSGKKLYPMLVQRLTRKLTSVTDQKKKNPHLLRHTFATHLL
XERC_CHLP8      PLGEPAVEALRKYFEERTGESSRVFVTSRGR-QLYPMLVQRMTKRYLTPVSESEKKNPHILRHSFATHML
XERD_RICPR      VINDQAVLSIIKYLEIRDFFNKAKSKNLIYLFPSSAVAGYMTRLKSVALYTGLNPEHPHILRHSFASHLL
XERC_THETN      YLNEACIKAISDYLKVRKDK-KALF--LSKRLKRISVKTVQYLVKKHLKHANLEKYSAHKLRHTAATLMY
XERC_NEIMB      PLVGKSVEALKNYLPLRQTASDGKALFTGRNGTRLSQRQIQKRLAQWAAQNGDRHVSPHMMRHSYAGHLL
XERD_CORGL      PFGSMAQQAVREYLLSKGKSHALFLNQRGGPLSRQSAWAV---LKKTVERAGLDKISPHTLRHSFATHLL
XERD_SHEON      PMGEMAITEVEHYLTSARHEHIQSDVVFPSKSQMMTRQTFWHRIKLYASRAGIEELSPHTLRHAFATHLL
XERC_XYLFT      PVGSYALSALREWASSGGGAQQPVFPGRYGGP--ISARAVQVRIKQLAQRQGMAKVHPHMLRHSFASHLL
XERC_XYLF2      PVGSYALSALREWASSGGGAQQPVFPGRYGGP--ISARAVQVRIKQLAQRQGMAKVHPHMLRHSFASHLL
XERC_PSEAE      PVGKAARQALEAWLPLRTQAAPEDGAVFIGRSKRLTPRAIQLRVRQAGVRELGQHLHPHMLRHSFASHLL
XERC_PSEA7      PVGKAARQALEAWLPLRAQATPEDGAVFIGRGKRLTPRAVQLRVRQAGVRELGQHLHPHMLRHSFASHLL
XERC_PSEAB      PVGKAARQALEAWLPLRAQAAPEDGAVFIGRGKRLTPRAIQLRVRQAGVRELGQHLHPHMLRHSFASHLL
XERC_PSEA8      PVGKAARQALEAWLPLRAQAAPEDGAVFIGRGKRLTPRAIQLRVRQAGVRELGQHLHPHMLRHSFASHLL
XERD_RALSO      PFGAEAGDWLRRYLRDGRTAADALFVTARGDGMTR--QAFWYLIKRYAQRADIHALSPHTLRHAFATHLL
XERS_STRPI      NVAAFAKPYLENYLAIRNQRYTALFLTLYGVPNRIDASSVEKMVAKYSEDFKV-RVTPHKLRHTLATRLY
XERD_VIBCH      PMGENAIEWIETFLQQGRSTSDIVFPSSRGQQMTRQTFWHRIKHYAVIAGIDVEKLSPHVLRHAFATHLL
XERC_THEAB      PLPDKVIPILKKYIDLE---NPKIFVFENGK-KHVHPSTVFRWLKEGVKRANIKKVHPHTLRHSYATHLI
XERC_MYCS2      PFGEPAHAALTAWLTEGRPSIPESXXXXXXXXXXXXXXXXQARTQTVSAVNGAPDIGPHGLRHSAATHLL
XERS_STRZT      NVAAFAKPYLENYLAIRNQRYTALFLTLYGVPNRIDASSVEKMVAKYSEDFKV-RVTPHKLRHTLATRLY
XERS_STRZP      NVAAFAKPYLENYLAIRNQRYTALFLTLYGVPNRIDASSVEKMVAKYSEDFKV-RVTPHKLRHTLATRLY
XERS_STRZJ      NVAAFAKPYLENYLAIRNQRYTALFLTLYGVPNRIDASSVEKMVAKYSEDFKV-RVTPHKLRHTLATRLY
XERS_STRR6      NVAAFAKPYLENYLAIRNQRYTALFLTLYGVPNRIDASSVEKMVAKYSEDFKV-RVTPHKLRHTLATRLY
XERS_STRPS      NVAAFAKPYLENYLAIRNQRYTALFLTLYGVPNRIDASSVEKMVAKYSEDFKV-RVTPHKLRHTLATRLY
XERS_STRPJ      NVAAFAKPYLENYLAIRNQRYTALFLTLYGVPNRIDASSVEKMVAKYSEDFKV-RVTPHKLRHTLATRLY
XERS_STRP7      NVAAFAKPYLENYLAIRNQRYTALFLTLYGVPNRIDASSVEKMVAKYSEDFKV-RVTPHKLRHTLATRLY
XERS_STRP4      NVAAFAKPYLENYLAIRNQRYTALFLTLYGVPNRIDASSVEKMVAKYSEDFKV-RVTPHKLRHTLATRLY
XERS_STRP2      NVAAFAKPYLENYLAIRNQRYTALFLTLYGVPNRIDASSVEKMVAKYSEDFKV-RVTPHKLRHTLATRLY
XERS_STRPN      NVAAFAKPYLENYLAIRNQRYTALFLTLYGVPNRIDASSVEKMVAKYSEDFKV-RVTPHKLRHTLATRLY
XERD_VIBVY      PMGENAIDWIETFI---KQGRPALLVFPSKRARQMTRQTFWHRIKFYAVIAGIDTDHPHVLRHAFATHLL
XERD_VIBVU      PMGENAIDWIETFI---KQGRPALLVFPSKRARQMTRQTFWHRIKFYAVIAGIDTDHPHVLRHAFATHLL
XERD_MYCTU      PV-GRPAVHLDAYLRGRPDGRGTAAIFLNARGGRLSRQSAWQVLQDAAERAGITAVSPHMLRHSFATHLL
XERD_MYCBO      PV-GRPAVHLDAYLRGRPDGRGTAAIFLNARGGRLSRQSAWQVLQDAAERAGITAVSPHMLRHSFATHLL
XERC_BACHD      PIGSFACDAIQEYIENGREKKKSKSVDLPGRGGPLTERGVRKILHQALDQAALSRVSPHSLRHSFATHLL
XERS_STRA5      NVASFAKPYLANYLDIRKNRYKALFLSYRGVPNRIDASSVEKMVAKYSQDFKV-RVTPHKLRHTLATRLY
XERS_STRA3      NVASFAKPYLANYLDIRKNRYKALFLSYRGVPNRIDASSVEKMVAKYSQDFKV-RVTPHKLRHTLATRLY
XERS_STRA1      NVASFAKPYLANYLDIRKNRYKALFLSYRGVPNRIDASSVEKMVAKYSQDFKV-RVTPHKLRHTLATRLY
XERC_MYCSS      PFGEPAEQALRAWLTSGRPALATAESXXXXXXXXXXXXXXXXQARTVGAVAGAPDIGPHGLRHSAATHLL
XERC_MYCSK      PFGEPAEQALRAWLTSGRPALATAESXXXXXXXXXXXXXXXXQARTVGAVAGAPDIGPHGLRHSAATHLL
XERC_MYCSJ      PFGEPAEQALRAWLTSGRPALATAESXXXXXXXXXXXXXXXXQARTVGAVAGAPDIGPHGLRHSAATHLL
XERC_MYCTU      PFGQPAADALHAWL---VDGRRALVTAESGHXXXXXXXXXXXDVRQARTAVGAPDMGPHGLRHSAATHLL
XERC_MYCTA      PFGQPAADALHAWL---VDGRRALVTAESGHXXXXXXXXXXXDVRQARTAVGAPDMGPHGLRHSAATHLL
XERC_MYCBT      PFGQPAADALHAWL---VDGRRALVTAESGHXXXXXXXXXXXDVRQARTAVGAPDMGPHGLRHSAATHLL
XERC_MYCBP      PFGQPAADALHAWL---VDGRRALVTAESGHXXXXXXXXXXXDVRQARTAVGAPDMGPHGLRHSAATHLL
XERC_MYCBO      PFGQPAADALHAWL---VDGRRALVTAESGHXXXXXXXXXXXDVRQARTAVGAPDMGPHGLRHSAATHLL
XERC2_RALSO     PVGVRALAWLDRYLLEARPQREALFVTDYGEP--VSPEYVASRVKRYMEFAGIQKPGAHLLRHAMATHML
XERC1_RALSO     PVGSKXXXXXXXXXXVREDAH-ALFLSARGK--RLAQRQIQTRMKRNAIAAGVPAVHPHVLRHSFATHML
XERD_RHILO      PLSAKARVAMRAWLAARAGDSPFLFPA----ASDSGYLSRQVDLKGLAARAGIAKISPHVLRHAFASHLL
XERC_PSEPG      PVGRKAREALQAWYRLRGIGNPAVFITRQGN--RISPQAVRLRVKAAGERELGQHLHPHMLRHSFASHVL
XERCL_PYRAB     XPISESLLEIKRYLESRNDDSPYLFVEMKRKRKKLSPKTVWRLVKKYGRKAGVE-LTPHQLRHSFATHML
XERS_STRT2      NMASFARPYLENYLSIRNKRYKALFLTYRGVPNRIDASSIEKMVAKYSQDFKI-RVTPHKLRHTLATRLY
XERS_STRT1      NMASFARPYLENYLSIRNKRYKALFLTYRGVPNRIDASSIEKMVAKYSQDFKI-RVTPHKLRHTLATRLY
XERS_STRGC      NVAAFAKPYLEEYLSIREKTDTAFFLTYRGTPNRIDASSVEKMVAKYSEDFKV-RVTPHKLRHTLATRLY
Y4RF_RHISN      PLLEETGAALVDYIRPKVDS-PYLFLSFTPPVGAFKSAAVRKRLRHGGVELG-RVAGAHLLRHSLATQLV
XERC_PSEP1      PVGRKAREALQAWYRLRGIGNPAVFITRQGN--RISPQAVRLRVKAAGERELGQHLHPHMLRHSFASHVL
XERS_STRSV      NVAAFAKPYLEEYLSIREKTDTAFFLTYRGIPNRIDASSVEKMVAKYSEDFKV-RVTPHKLRHTLATRLY
XERD_PSEPK      PMGEEAVVWLERYQRDGRNGRPSDVLFPSQRGEQMTRQTFWHRIKHHARVAGIDKLSPHTLRHAFATHLL
XERD_PSEAE      PLGEEAIGWLERYLREARGDSDVLFPSLRGEQMTRQTFWHRIKHHAQVAAIG-TSISPHTLRHAFATHLL
XERC_PSEPK      PVGRKAREALQAWYRLRGIGNPAVFITRQGN--RISPRAVRLRVKVAGERELGQHLHPHMLRHSFASHVL
XERS_STRTD      NMASFARPYLENYLSIRNKRYKALFLTYRGVPNRIDASSIEKMVGKYSQDFKI-RVTPHKLRHTLATRLY
XERS_STRMU      NVAGFAKPYLENYITIRRGRYKAKKTDLAGVPNRMDASSIEKMVAKYSQDFKI-RVTPHKLRHTLATRLY
XERD_BRAJA      PLNEASRQAMADYLSDKKTGVAALFPSF-GESGHLTRQHFARDLKELAVASGLQAVSPHVLRHAFASHLL
XERD_XANCP      PLGEESQHWLERYLSERKDGQVPLFIDAARRPSRQQFWGLVKRYAAVAG-IDPDTVSPHGLRHSFATHLL
Y4RC_RHISN      PFAKSTTAVLRNWLKEQRGDQGILFPSARG--ERLSVHGVQYMLNKMSPSLEGKRVTVHRLRHTMAMDLL
XERD_XANAC      PLGEESQHWLERYLREARDGQVPLFIDV--SRQPLSRQQFWALVKRYAAVAGIDPVSPHGLRHSFATHLL
XERD_COREF      PYGSMARAAVDDYLVRAKGRTPVLFLNQRGGPLSRQ-SXXXXXXXXXXXXXXXXDISPHTLRHSFATHLL
XERS_STRU0      NVASFAKPYLEHYLEIRQKRYQAFFLTYRGVPNRIDASSIEKMVGKYSQDFKI-RVTPHKLRHTLATRLY
XERS_STRPG      NVAGFAKGYLESYLAVRQRRYKAFFLTYRGVPNRMDASSIEKMVGKYSEDFKI-RVTPHKLRHTLATRLY
XERS_STRP6      NVAGFAKGYLESYLAVRQRRYKAFFLTYRGVPNRMDASSIEKMVGKYSEDFKI-RVTPHKLRHTLATRLY
XERC_ERYLH      PVSGRAREALQSWMGLRGSDSPYLFPSRKAHITRVRLFQMLKELAVRAD-LNPDKVSPHVLRHAFATHLL
XERS_STRPZ      NVAGFAKGYLESYLAVRQRRYKAFFLTYRGVPNRMDASSIEKMVGKYSEDFKI-RVTPHKLRHTLATRLY
XERS_STRPM      NVAGFAKGYLESYLAVRQRRYKAFFLTYRGVPNRMDASSIEKMVGKYSEDFKI-RVTPHKLRHTLATRLY
XERS_STRPF      NVAGFAKGYLESYLAVRQRRYKAFFLTYRGVPNRMDASSIEKMVGKYSEDFKI-RVTPHKLRHTLATRLY
XERS_STRPD      NVAGFAKGYLESYLAVRQRRYKAFFLTYRGVPNRMDASSIEKMVGKYSEDFKI-RVTPHKLRHTLATRLY
XERS_STRPB      NVAGFAKGYLESYLAVRQRRYKAFFLTYRGVPNRMDASSIEKMVGKYSEDFKI-RVTPHKLRHTLATRLY
XERS_STRP8      NVAGFAKGYLESYLAVRQRRYKAFFLTYRGVPNRMDASSIEKMVGKYSEDFKI-RVTPHKLRHTLATRLY
XERS_STRP3      NVAGFAKGYLESYLAVRQRRYKAFFLTYRGVPNRMDASSIEKMVGKYSEDFKI-RVTPHKLRHTLATRLY
XERS_STRP1      NVAGFAKGYLESYLAVRQRRYKAFFLTYRGVPNRMDASSIEKMVGKYSEDFKI-RVTPHKLRHTLATRLY
XERD_XYLFT      PLGEESQHWLQRYLEQARPSLAALFINT--NLKRLSRQQFWRWIKHYAALVGINKVSPHVLRHSFATHLL
XERC_PSEE4      PVGRKACEALQEWFRLRGIAAPAVFITRQGN--RLSTRAIQMRVKTFGERELGQHLHPHMLRHSFASHLL
XERC_PELTS      PLGSMAVEALQAYLSVAKKINNALFLNCRG--ERLSARGIRKILDKYVEKVSLEKISPHTLRHSFATHLL
XERS_STRPC      NVAGFAKGYLESYLAVRQRRYKAFFLTYRGVPNRMDASSIEKMVGKYSEDFKI-RVTPHKLRHTLATRLY
XERC_RICPR      PWLPLTKNLITKYLEIKLDENEPIFRGRQGKKLQPSVFNRE--LIKLKRIYGLPELTAHSFRHSFASHLL
XERD_CAUCR      PLNDAARAAVKAYLVERKDS-PWLFPSR-GATGRLTPRRVGQLLEDAAIAAGIQKVSPHVLRHAFATHLL
XERC_RICAE      PWLPIAKNLITQYLEKLGDNEP-IFRGKQGKKLQPPVFNRE--LIKLKHFYGLQHLTAHSFRHSFASHLL
XERC_RICPU      PWLPIAKNLITQYLEKLGDNEP-IFRGKQGKELQPSVFNRE--LIKLKHFYGLQHLTAHSFRHSFASHLL
XERC_RICFE      PWLPIAKNLITQYLEKLGDNEP-IFRGKQGKKLQPPVFNRE--LIKLKHFYGLQHLTAHSFRHSFASHLL
Y367_METJA      VCSSDTLELLRNYVNVRQGSDDYLFQNSQGGRVRKEWISEVFRLKEEGKIPKNRRIVIHSIRHGRAVDLL
XERD_CHLPN      PLGSRAREAIDAYLCPFRDQYQKLFLSTRG--HKLERSCVWRRIHNYAKQVTSKPVSPHSLRHAFATHLL
XERDL_THETN     PIGSYAVAALQEYIEKGRKGEKALFLNLRGK--RLTRQGCWKIIKEYADKISPGPLTPNILRKSFAQHML
XERC_RICCN      PWLPIAKNLITQYLEKLGDNEP-IFRGKQGKKLQPPVFNRE--LIKLKHFYGLQHLTAHSFRHSFASHLL
XERD_XYLFA      PLGEESQHWLQRYLEQARPSLAALFINTTLK--RLSRQQFWRWIKHYAALAGINKVSPHVLRHSFATHLL
XERC_RICM5      PWLPIAKNLITQYLEKLGDNEP-IFRGKQGKKLQPPVFNRE--LIKLKHFYGLQHLTAHSFRHSFASHLL
XERC_BRAJA      PVLQNVLALVQEYVSMCPYPLPAEGPIFVGRGGPLSPRIIQLAMERLRGALGLDSATPHALRHSFATHLL
XERS_STRS7      NVAAFAKPHLEAYLSVRKDRYQAFFLTAYGLPNRIDASSIEKMVGKYSESFKI-RVTPHKLRHTLATRLY
XERS_STREM      NVAAFAKPHLEAYLSVRKDRYQAFFLTAYGLPNRIDASSIEKMVGKYSESFKI-RVTPHKLRHTLATRLY
XERD_CHLTR      PISIKAKQAIDAYLSSFRDSEEHVFLSIRGK--KLDRSCVWKRITFYAKLVTTKRISPHSLRHAFATHLL
XERS_STRE4      NVAAFAKPHLEAYLSVRKDRYQAFFLTAYGLPNRIDASSIEKMVGKYSEGFKI-RVTPHKLRHTLATRLY
XERD_MYCLE      PVGRPAVQALDAYLSDLARRGPGMLATLNARGGRLSRQSAWQVLQDAAEHAGITSVSPHMLRHSFATHLL
XERC_RICRS      PWLPIAKNLITQYLEKLGDNEP-IFRGKQGKKLQPPVFNRE--LIKLKHFYGLQHLTAHSFRHSFASHLL
XERC_RICRO      PWLPIAKNLITQYLEKLGDNEP-IFRGKQGKKLQPPVFNRE--LIKLKHFYGLQHLTAHSFRHSFASHLL
XERC_RHOCS      PVLPXXXXXXXXXXXXXPWGGGRAAPLFVGKGDRLSPDVARRQMRHLRALLGLDSTTPHALRHSFATHLL
TNPE_STAAU      SKEVVLLIKVREYLFPRKDGSPLKQETFRGELNKLAYE------QNIVDKLGIYRFHAHAFRHSVGTRTI
TNPB_STAAU      SKEVALLIKVREYLFPRKDGSPLKQETFRGELNKLAYE------QNIVDKSGIYRFHAHAFRHTVGTRMI
TNPB_STAAN      SKEVALLIKVREYLFPRKDGSPLKQETFRGELNKLAYE------QNIVDKSGIYRFHAHAFRHTVGTRMI
TNPB_STAAM      SKEVALLIKVREYLFPRKDGSPLKQETFRGELNKLAYE------QNIVDKSGIYRFHAHAFRHTVGTRMI
XERC_NITWN      LQNVLALIH--EYVAMCPHSLPPIFVGARGGPLRARI--IQLVMARMRGALGLDSATPHALRHSFATHLL
XERCL_THETN     EQIPKTKNSIRTYLNDVEKGY--VFTTELGNT--IDASNLLKTYKKILNRAGVPYRKFHAIRHTYATKLF
XERS_STRSY      NVAGFAKPYLEAYMGIRQQRYKAFLSEYRGLPNRIDASSIEKMVAKYSADFKI-RVTPHKLRHTLATRLY
XERS_STRS2      NVAGFAKPYLEAYMGIRQQRYKAFLSEYRGLPNRIDASSIEKMVAKYSADFKI-RVTPHKLRHTLATRLY
XERD_BRUSU      PLSRKARDALQKFLTLRSDDNPWLFPAFSESGHARQVFXXXXXXXXXXXXXXXSSVSPHVLRHAFASHLL
XERD_BRUME      PLSRKARDALQKFLTLRSDDNPWLFPAFSESGHARQVFXXXXXXXXXXXXXXXSSVSPHVLRHAFASHLL
XERC_SYNE7      SLSVEMVQALQDWLRWHPKAEPELFTALDRRSQQLSDQAVYLLVKRSAEKLG-KRLSPHRIRHSAITAAL
XERD_CHLMU      SIKARQTIDFRERFQKKNPSEEHVFLSIRGK--KLERSCVWKRITFYAKLVTTKHISPHSLRHAFATHLL
XERC_RICCK      PWLPIVKNLITQYLEIKLGENEPIFRGKQGKKLQPTVFNRE--LIKLKRFYGLEHLTAHSFRHSFASHLL
TNPA_STAAU      HVSKELMSLYTDYLYSEELEHDYVFISLFGKP--LKYQSVLDLVRRIVKRTGIEFTS-HMLRHTHATQLI
TNPA_STAAN      HVSKELMSLYTDYLYSEELEHDYVFISLFGKP--LKYQSVLDLVRRIVKRTGIEFTS-HMLRHTHATQLI
TNPA_STAAM      HVSKELMSLYTDYLYSEELEHDYVFISLFGKP--LKYQSVLDLVRRIVKRTGIEFTS-HMLRHTHATQLI
Y4RA_RHISN      PADVGEAI--ADYLWRARPRNASRRVFLRDKAPIRGFSGLGSIVRRSLKRTGIDSPTKHQFRHGLASEML
XERC_RICTY      PWLPFARNLITKYLGIKLDENEPIFRGKHGKKLQPSVFNRE--LIKLKRVYGLPELTAHSFRHSFASHLL
XERD_BRUAB      PLSRKARDALQKFLTLRSDDNPWLFPAFSESGHARQVFXXXXXXXXXXXXXXXXXXXPHVLRHAFASHLL
XERD_BRUA2      PLSRKARDALQKFLTLRSDDNPWLFPAFSESGHARQVFXXXXXXXXXXXXXXXXXXXPHVLRHAFASHLL
XERC_AGRT5      PLLAVVTEAVDTY---RKLCPYALAADLGARGGKLQPAIIQREMQKLRGAFGLENATPHALRHSFATHLL
XERCL_PSEAE     FVVPITEPHLSRLLQEAEKAGFADDDQLFNKSKTMNSDQVEAMYRKLTEKVGV-RMTPHRFRHTLATKAP
Y4QK_RHISN      MLSPKLLEILRDYWRDRA-GHP---ITRDAVGQACAKAHDLSRLSK--------PVTPHSLRHAFAVHLL
XERC_RICAH      PWLPIAKNLITQYLEKLGDNEP-IFRGKRGKKLQPQVFNRE--LIKLKHFYGLQHLTAHSFRHSFASHLL
XERD_AGRT5      LLSRAAIEAMEKYEAGRXXTDTAESPWLFPSNSKEGHLPRQVFARDLKDGLTASAVSPHVLRHAFASHLL
XERC_RHIME      PMIAAAAEAVETY---RKHIEPEEPIFRGARGAKLQPAIIQREMQKLRAALGLDSATPHALRHSFATHLL
INT2_SALTI      MLPESLAPSLREWLKDQAESGVALPDALERKYPRAGHSGVVRRFKRAVEQAGITKATPHTLRHSFATALL
INT2_PSEAE      MLPESLAPSLREWLKDQAESGVALPDALERKYPRAGHSGVVRRFKRAVEQAGITKATPHTLRHSFATALL
INT2_ECOLX      MLPESLAPSLREWLKDQAESGVALPDALERKYPRAGHSGVVRRFKRAVEQAGITKATPHTLRHSFATALL
XERC_UREPA      FFVKQTFEQLQKFYENLKGFETT-------KTLRLYIK-----------KIIGKNFTPHSLRRSFATFML
XERC_BRUME      LLPAVHKAVAQYRALCPFDLSAGQLLFRGAKGGPLHAAIIQREMQKLRAGLGLDSATPHALRHSFATHLL
XERC_BRUSU      PLLPAVHKAVAQYRADLSAGQPLF---RGAKGGPLHAAIIQREMQKLRAGLGLDSATPHALRHSFATHLL
YOEC_BACSU      LILESLKQEIYEYTKDMKENE-YLFKSVRTRKPISRIQAYRI-LREAAAACGLEEIGTHTLRKTFGYHFY
Y4EF_RHISN      MLSPKLLEILRDYWRDRA-GHP---ITRYAVGQACVKPHDLSRLSK--------PVTPHSLRHAFVVHLL
XERS_LACLS      PFAPFAKTYFERYLEVRSQRYKAFFVTLYRDASRIDPSSVEKLVAKYSQAFKV-RVTPHKLRHTLATRLY
XERS_LACLM      PFAPFAKTYFERYLEVRSQRYKAFFVTLYRDASRIDPSSVEKLVAKYSQAFKV-RVTPHKLRHTLATRLY
Y4RE_RHISN      PVHATTQTALCRYARERDAAFPAFF--LSSRGNRLSATGLQAQVRKFAGLDDGKTLRPHDLRHRFA----
XERC_RHILO      LPVARAIAEYRRLCPYHLDPKGLLFRGARGGP--LNPAIIQRDMAKLRSALNLDTATPHALRHSFATHLL
XERS_LACLA      YFERYLEVRSQRYKTTAKDT--AFFVTLYRDVSRIDPSSVEKLVAKYSQAFKV-RVTPHKLRHTLATRLY
Y4GC_RHISN      LLPLTEPVAILVYLRSGRPATDALFVRTRAPYRKLDYSMVRRRLRDAGVK-PRGKRGPHIFRHARATELL
YZ09_AQUAE      YFERLKKLKPEDFFFTYAVKYPVKVFTLTDKTAKWFYWKLEKELREKGYEI---EVNAHRFRNTYITKLA
FIME_SHIFL      RFDEREAVE--RWTQERADRTDAIFISRRGS--RLSRQQAYRIIRDAGIEAGVTQTHPHMLRHACGYELA
FIME_ECOLI      RFDEREAVE--RWTQERADRTDAIFISRRGS--RLSRQQAYRIIRDAGIEAGVTQTHPHMLRHACGYELA
FIME_ECOL6      RFDEREAVE--RWTQERADRTDAIFISRRGS--RLSRQQAYRIIRDAGIEAGVTQTHPHMLRHACGYELA
XERC_METS4      PVIAPVQAALAEYLAACPYALAPDGPLFVGKGGPLSPRVVQLAVASLRGALGLDSATPHALRHSFATHLL
XERC_SYNY3      TLSAKGMALINQWLTPRPKNEP-LFCTLATFGHRLSGNAIYNLVRTSAESAGIHKVSPHRVRHSAITAAL
Y4RB_RHISN      PMHASTCAVLRDYLKRRRQASPYLFTSQLG--NRLDVGDIHRTFYALSRQIGLRGARLHDMRHVFATNTL
XERC_METNO      XXXXXXXXXXXDYLAVCPHPLPPDGPLFVGKGGPLSPRIVQLAVASLRGALGLDSATPHALRHSFATHLL
GP8D_CHLPS      FYPQKFMKLLQDYVGERKG---LVFITKKGRG--VGLKQLAGTFAKAGIKAHIPKVTPHVLRATAVTEYK
VINT_BPML5      TVPPHVAEMIRAHMKDRMNKGPEAFLVTTTQGNRLSKSAFTKSLKRGYAKIGRPELRIHDLRXXXXXXXX
VINT_BPMD2      TVPPHVAAMIREHMADRMNKGPEALLVTTTRGQRLSKSAFTRSLKKGYAKIGRPDLRIHDLRXXXXXXXX
VINT_BPMFR      TVPPHVAAMIRAHMADRMNKGPEALLVTTTRGQRLSKSAFTRSLKKGYAKIGRPDLRIHDLRXXXXXXXX
REDM_ECOLX      -------------------------------------------------------VTPHTFRHSYAMHML
REDF_ECOLI      -------------------------------------------------------VTPHTFRHSYAMHML
XERC_PSESX      ----------REFMIPIPDGLMPHLVLVMDTAKKVGFSGVEAMYKKLTNMTG-TRMTPHRFRHTIASELM
VINT_BPP22      IGVALNDTACRVLKKQIGNHHKWVFVYKESSTKPDGTKSPVVRKMRYDKRAGIEDFRFHDLRHTWASWLV
INTD_ECOLI      IGVALNDTACKVLRDQIGKHHKWVFVHTKAAKRADGTSTPAVRKMRIDSKTGIEDFRFHDLRHTWASWLI
GP8D_CHLTR      TYPQKFMHFLQEYIGQRRGF---VFVTRSGKM--VGLRQIARTFSQAGLQAAIPKITPHVLRATAVTEYK
VINT_BPPH8      HIDAAVNL-VRNHLKKINTNH------LVTSQRKIGIKDSPVHARSIWNGTGMAEWSLHDMRRTIATNLS
FIMB_ECOLI      THPLLNKEALKNWLSIRT-SYPSEWVFLSRKGNPLSRQQFYHIISTSGGNAGLSEIHPHMLRHSCGFALA
FIMB_ECO57      THPLLNKEALKNWLSIRT-SYPSEWVFLSRKGNPLSRQQFYHIISTSGGNAGLSEIHPHMLRHSCGFALA
VLF1_NPVOP      TIGLKRKRSRKNTLNNIKTKPLELAREIYARNPTVNTSTPFKDFRRLLDEAGVEMERPNMIRHYLSSNLY
GP8D_CHLMU      TYPQKFMHALREYIGPRRG---LVFVTSSGKM--VGLRQIARTFSQAGLQASIPKITPHVLRATAVTEYK
VINT_BP434      ----------------------------------------------------------------------
INTR_STRAM      ---------------DKWEEHGLVFSSAVGKP--LDATNVRRAFRQLKDANGINADEPRELRHSFVSLLS


                         .         *         .         .         .         .         +:350
query           DKGMPIEQVQKLLGHSKIDTTLAYAMVNQNNVKHSHQKFIS
XERC_STAAB      NQGADLRTVQSLLGHVNLSTTGKYTHVSNQQLR--------
XERC_OCEIH      NEGADLRSVQELLGHESLSSTQIYTHVTKDHLREAYMK---
XERC_STAAN      NQGADLRTVQSLLGHVNLSTTGKYTHVSNQQLR--------
XERC_STAAM      NQGADLRTVQSLLGHVNLSTTGKYTHVSNQQLR--------
XERC_STAA9      NQGADLRTVQSLLGHVNLSTTGKYTHVSNQQLR--------
XERC_STAA2      NQGADLRTVQSLLGHVNLSTTGKYTHVSNQQLR--------
XERC_STAA1      NQGADLRTVQSLLGHVNLSTTGKYTHVSNQQLR--------
XERC_STAAT      NQGADLRTVQSLLGHVNLSTTGKYTHVSNQQLR--------
XERC_STAAR      NQGADLRTVQSLLGHVNLSTTGKYTHVSNQQLR--------
XERC_STAAE      NQGADLRTVQSLLGHVNLSTTGKYTHVSNQQLR--------
XERC_STAAC      NQGADLRTVQSLLGHVNLSTTGKYTHVSNQQLR--------
XERC_STAA8      NQGADLRTVQSLLGHVNLSTTGKYTHVSNQQLR--------
XERC_STAA3      NQGADLRTVQSLLGHVNLSTTGKYTHVSNQQLR--------
XERC_LEPIN      DAGAEIRAVQELLGHSSLSTTQIYLSVSKEKIKEVYRK---
XERC_LEPIC      DAGAEIRAVQELLGHSSLSTTQIYLSVSKEKIKEVYRK---
XERC_STAAW      NQGADLRTVQSLLGHVNLSTTGKYTHVSNQQLR--------
XERC_STAAS      NQGADLRTVQSLLGHVNLSTTGKYTHVSNQQLR--------
XERC_STAAU      NQGADLRTVQSLLGHVNLSTTGKYTHVSNQQLR--------
XERC_CORGL      DGGADLRQVQELLGHSSMQTTQIYTHVSNKRLLEAFNK---
XERCL_PYRHO     ERGVDIRIIQELLGHANLSTTQIYTKVTTKHLREAIEK---
XERC_PYRFU      ERGIDIRIIQELLGHASLSTTQIYTRVTAKHLKEAVER---
XERC_HERA2      NRGKDLREVQELLGHASISTTQIYTHVNDRAVKY-------
XERC_STAS1      NQGADLRTVQSLLGHVNLSTTGRYTHVTNEQLR--------
XERC_PEDPA      NNGADLRTVQELLGHSSLSTTQIYTHVTKEKLQESYRKY--
XERC_ANOFW      NEGADLRSVQELLGHAHLSSTQVYTHVTKDHLRHSHPR---
XERC_BACSU      NEGADLRSVQELLGHSNLSSTQIYTHVSKEMLRNTY-----
XERC_HAEDU      EASTDLRAVQELLGHSSLSTTQIY-----------------
XERC_BACP2      NEGADLRSVQELLGHSNLSSTQVYTHVSKDSLRKTY-----
XERC_CHLTR      ERGMDLKTIQLLLGHTSLETTTIYTHVSMKLKKQIHDE---
XERC_CHLTB      ERGMDLKTIQLLLGHTSLETTTIYTHVSMKLKKQIHDE---
XERC_CHLTA      ERGMDLKTIQLLLGHTSLETTTIYTHVSMKLKKQIHDE---
XERC_CHLT2      ERGMDLKTIQLLLGHTSLETTTIYTHVSMKLKKQIHDE---
XERC_LISIN      NNGADMRTVQELLGHASLSSTQIYTHVTKEHLKSTYMK---
XERC_LISMO      NNGADMRTVQELLGHASLSSTQIYTHVTKEHLKSTYMK---
XERC_THEYD      MEGADLRVIQELLGHASLSTTQIYTHVDLKHLIEVYDK---
XERC_STAHJ      NQGADLRTVQSLLGHVNLSTTGRYTHVSNQQLR--------
XERC_LISW6      NNGADMRTVQELLGHASLSSTQIYTHVTKEHLKSTYMK---
XERC_STAES      NQGADLRTVQSLLGHVNLSTTGRYTHVSNQQLR--------
XERC_STAEQ      NQGADLRTVQSLLGHVNLSTTGRYTHVSNQQLR--------
XERC_LISMF      NNGADMRTVQELLGHASLSSTQIYTHVTKEHLKSTYMK---
XERC_LISMC      NNGADMRTVQELLGHASLSSTQIYTHVTKEHLKSTYMK---
XERC_LISMH      NNGADMRTVQELLGHASLASTQIYTHVTKEHLKSTYMK---
XERC_CHLMU      ERGMDLKTIQLLLGHTSLETTTIYTHVSMKLKKQIHDE---
XERD_BACHD      ENGADLRAVQEMLGHADISTTQIYTHVTKTRMRDVYAHF--
XERC_PSE14      ESSQDLRAVQELLGHADIKTTQIY-----------------
XERC_COREF      DGGADLRQVQEMLGHSSLQTTQIYTHVSSQRL---------
XERCL_METTH     KNGVDIRAIQQLLGHSNLSTTQIYTSVDMQTLKNVYDR---
XERD_LEPIN      ENHADLKSVQELLGHIDIATTQIYTHMANKTLREVHKKF--
XERD_LEPIC      ENHADLKSVQELLGHIDIATTQIYTHMANKTLREVHKKF--
XERC_PSESM      ESSQDLRAVQELLGHADIKTTQIY-----------------
XERC_CHLAB      ENGMDLKTIQALLGHSSLETTTIYTHVSMKLKKQTHNE---
XERC_PSEU2      ESSQDLRAVQELLGHADIKTTQIY-----------------
XERC_CHLCV      ENGMDLKTIQALLGHSSLETTTIYTHVSMKLKKQTHEE---
XERC_PASMU      EASSDLRAVQELLGHSNLSTTQIYTHLN-------------
XERD_OCEIH      ENGADLRLVQEMLGHADISTTQVYTHVTKARLKDMYQSY--
XERC_MANSM      EASSDLRAVQELLGHSNLSTTQIYTHLN-------------
XERC_CHLFF      ENGMDLKTIQALLGHSSLETTTIYTHVSMKLKKQTHNE---
XERC_STACT      NEGADLRTVQSLLGHVNLSTTGRYTHVSNQQLR--------
XERC_SHESW      ESSADLRAVQELLGHANLSTTQIYTSLD-------------
XERC_SHEPC      ESSADLRAVQELLGHANLSTTQIYTSLD-------------
XERCL_THEON     ENGVDIRAIQELLGHSNLSTTQIYTKVTVEHLRKAQEK---
XERC_LACLE      NNGADLRSVQELLGHEDLSTTQIYTHVSMQHLTAEYRQ---
XERC_SHEON      ESSADLRAVQELLGHENLSTTQIYTSLD-------------
XERC_LACDB      NNGADLRSVQELLGHEDLSTTQIYTHVSMQHL---------
XERC_LACDA      NNGADLRSVQELLGHEDLSTTQIYTHVSMQHL---------
XERC_ACTP7      EASGDLRAVQELLGHSNLATTQIY-----------------
XERD_BACSU      ENGADLRAVQEMLGHADISTTQIYTHVTKTRLKDVYKQF--
XERC_BACLD      NEGADLRSVQELLGHSNLSSTQVYTHVSKDMLRKTY-----
XERCL_PYRKO     EEGVDIRAIQELLGHSNLSTTQIYTKVTVEHLRKAQEK---
XERD_STAEQ      ENGADLRAVQEMLGHSDISTTQLYTHVSKSQIRKMYTQF--
XERD_LISIN      ENGADLRSVQELLGHADISTTQIYTHVTKLRLKDVYKQF--
XERD_STAES      ENGADLRAVQEMLGHSDISTTQLYTHVSKSQIRKMYTQF--
XERC_BIFLI      DGGADLREVQEMLGHSSLKTTQRYTHVSIEQLKNRY-----
XERC_BIFLD      DGGADLREVQEMLGHSSLKTTQRYTHVSIEQLKNRY-----
XERC_VIBPA      ESSNNLRAVQELLGHENISTTQIYTHLDFQHLAQAYDQ---
XERC_VIBCM      ESSNNLRAVQELLGHENIATTQIY-----------------
XERC_VIBCH      ESSNNLRAVQELLGHENIATTQIY-----------------
XERC_VIBC3      ESSNNLRAVQELLGHENIATTQIY-----------------
XERC_SHESR      ESSADLRAVQELLGHENLSTTQIYTSLD-------------
XERC_SHESM      ESSADLRAVQELLGHENLSTTQIYTSLD-------------
XERC_SHESA      ESSADLRAVQELLGHENLSTTQIYTSLD-------------
XERC_NATTJ      EGGADLRAVQELLGHVNISTTQIYTHVNQARMTEVYNKY--
XERC_CHRVO      QSSGDLRAVQELLGHANLSSTQIYTALD-------------
XERC_CHLPN      ESGMDLKTIQALLGHSSLETTTVYTQVSVKLKKQTHQE---
XERC_VIBHB      ESSNNLRAVQELLGHENISTTQIYTHLDFQHLAQAYDQ---
XERC_ROSCS      NAGFDLRAVQELLGHTSISTTQIYTHLNSSHTPHAH-----
XERC_HAES2      ENSSDLRAVQELLGHSNLSTTQIYTHLDFQHLAQVYDK---
XERC_VIBVY      ESSNNLRAVQELLGHENISTTQIY-----------------
XERC_VIBVU      ESSNNLRAVQELLGHENISTTQIY-----------------
XERC_LACCB      DHGADLRTVQELLGHASLSTTQIYTHVTMAHLKNEYMKY--
XERC_LACC3      DHGADLRTVQELLGHASLSTTQIYTHVTMAHLKNEYMKY--
XERD_LISMO      ENGADLRSVQELLGHADISTTQIYTHVTKLRLKDVYKQF--
XERD_LISMF      ENGADLRSVQELLGHADISTTQIYTHVTKLRLKDVYKQF--
XERC_TREDE      TRGADIRVVQELLGHESVSTTQRYTHITQNLYKTAH-----
XERC_PSEF5      ESSQDLRAVQELLGHSDIKTTQIY-----------------
XERC_HAEIN      EASSDLRAVQELLGHSNLSTTQIYTHLN-------------
XERC_HAEIE      EASSDLRAVQELLGHSNLSTTQIYTHLN-------------
XERC_HAEI8      EASSDLRAVQELLGHSNLSTTQIYTHLN-------------
XERC_PSEPF      ESSQDLRAVQELLGHSDIKTTQIY-----------------
XERC_PSEFL      ESSQDLRAVQELLGHSDIKTTQIY-----------------
XERD_STAHJ      ENGADLRAVQEMLGHSDISTTQLYTHVSKTQIRQMYNQF--
XERC_SHEAM      ESSGDLRAVQELLGHANLATTQIYTSLD-------------
XERC_ALCBS      ESSGDLRAVQELLGHADLATTQVY-----------------
TNRI_BACTU      EKGFSIHEVANQAGHSNIHTTLLYTNPNQLQLKN-------
XERD_RHIME      ANGADLRAVQELLGHSDISTTQIYTHV--------------
XERC_SYNAS      DAGADLRSIQELLGHESLSTTQKYTAVSVNRL---------
XERC_PSEU5      ESSQDLRSVQELLGHADIGTTQIYTHLDFQHLDHAHPR---
VINT_BPL2       ENGLNIDDLQKIFDHSRIETTIKYVQHNEKRALQEYKKY--
XERD_STAS1      ENGADLRAVQEMLGHSDISTTQLYTHVSKSQIRKMYNEF--
XERC_PSEFS      ESSQDLRAVQELLGHSDIKTTQIY-----------------
XERC_PROMI      ESSGDLRAVQELLGHANLSTTQVY-----------------
XERC_SHIF8      ESSGDLRGVQELLGHANLSTTQIY-----------------
XERC_ECO27      ESSGDLRGVQELLGHANLSTTQIY-----------------
XERC_VIBSL      ESSQNLRAVQELLGHENISTTQVYTHLDFQHLAQAYDQ---
XERC_SHISS      ESSGDLRGVQELLGHANLSTTQIY-----------------
XERC_SHIFL      ESSGDLRGVQELLGHANLSTTQIY-----------------
XERC_SHIDS      ESSGDLRGVQELLGHANLSTTQIY-----------------
XERC_SHIBS      ESSGDLRGVQELLGHANLSTTQIY-----------------
XERC_SHIB3      ESSGDLRGVQELLGHANLSTTQIY-----------------
XERC_ESCF3      ESSGDLRGVQELLGHANLSTTQIY-----------------
XERC_ECOUT      ESSGDLRGVQELLGHANLSTTQIY-----------------
XERC_ECOSM      ESSGDLRGVQELLGHANLSTTQIY-----------------
XERC_ECOSE      ESSGDLRGVQELLGHANLSTTQIY-----------------
XERC_ECOLU      ESSGDLRGVQELLGHANLSTTQIY-----------------
XERC_ECOLI      ESSGDLRGVQELLGHANLSTTQIY-----------------
XERC_ECOLC      ESSGDLRGVQELLGHANLSTTQIY-----------------
XERC_ECOL6      ESSGDLRGVQELLGHANLSTTQIY-----------------
XERC_ECOL5      ESSGDLRGVQELLGHANLSTTQIY-----------------
XERC_ECOK1      ESSGDLRGVQELLGHANLSTTQIY-----------------
XERC_ECOHS      ESSGDLRGVQELLGHANLSTTQIY-----------------
XERC_ECODH      ESSGDLRGVQELLGHANLSTTQIY-----------------
XERC_ECOBW      ESSGDLRGVQELLGHANLSTTQIY-----------------
XERC_ECO8A      ESSGDLRGVQELLGHANLSTTQIY-----------------
XERC_ECO81      ESSGDLRGVQELLGHANLSTTQIY-----------------
XERC_ECO7I      ESSGDLRGVQELLGHANLSTTQIY-----------------
XERC_ECO55      ESSGDLRGVQELLGHANLSTTQIY-----------------
XERC_ECO45      ESSGDLRGVQELLGHANLSTTQIY-----------------
XERC_ECO24      ESSGDLRGVQELLGHANLSTTQIY-----------------
XERD_STAAW      ENGADLRAVQEMLGHSDISTTQLYTHVSKSQIRKMYNQF--
XERD_STAAU      ENGADLRAVQEMLGHSDISTTQLYTHVSKSQIRKMYNQF--
XERD_STAAS      ENGADLRAVQEMLGHSDISTTQLYTHVSKSQIRKMYNQF--
XERD_STAAR      ENGADLRAVQEMLGHSDISTTQLYTHVSKSQIRKMYNQF--
XERD_STAAN      ENGADLRAVQEMLGHSDISTTQLYTHVSKSQIRKMYNQF--
XERD_STAAM      ENGADLRAVQEMLGHSDISTTQLYTHVSKSQIRKMYNQF--
XERD_STAAC      ENGADLRAVQEMLGHSDISTTQLYTHVSKSQIRKMYNQF--
XERC_MYCLE      EGGADLRVVQELLGHSSLATTQLYTHVAVSRLRVVHDQ---
XERC_ECO5E      ESSGDLRGVQELLGHANLSTTQIY-----------------
XERC_ECO57      ESSGDLRGVQELLGHANLSTTQIY-----------------
XERD_SALTY      NHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQ---
XERD_SALTI      NHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQ---
XERD_PASMU      NHGADLRVVQMLLGHSDLSTTQIYTHVAKERLKHLHERY--
XERD_ECO57      NHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQ---
XERC_YERPE      ESSGDLRAVQELLGHANLTTTQIY-----------------
XERC_ROSS1      NAGADLRAVQELLGHTSISTTQIYTHIN-------------
XERD_PROMI      NHGADLRVVQMLLGHSDLSTTQIYTHVATERLKVLHQQ---
XERD_CHLTE      EGGADLRVVQEMLGHSSIIATQIYTHIDRSFIKEVHKTF--
XERC_SALTY      ESSGDLRGVQELLGHANLSTTQIY-----------------
XERC_SALTI      ESSGDLRGVQELLGHANLSTTQIY-----------------
XERD_SHIFL      NHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQ---
XERD_ECOLI      NHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQ---
XERD_ECOL6      NHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQ---
XERC_XANCP      ESSGDLRGVQELLGHSDIATTQIY-----------------
XERC_XANCB      ESSGDLRGVQELLGHSDIATTQIY-----------------
XERC_XANC8      ESSGDLRGVQELLGHSDIATTQIY-----------------
XERD_YERPE      NHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQ---
XERC_XANAC      ESSGDLRGVQELLGHSDIATTQIY-----------------
XERD_NEIMB      RHGLDLRVVQDMLGHADLNTTQIYTHVAQGVVKEHHSR---
XERD_NEIMA      QHGLDLRVVQDMLGHADLNTTQIYTHVAQGVVKEHHSR---
XERC_THELT      QKGVNIRVVQDLLGHSNLSTTSVYLHV--------------
XERC_CHRSD      ESSQDLRAVQELLGHANLSTTQVYTRLDWQHLADAYDQ---
XERD_HAEDU      NHGADLRVVQMLLGHSDLSTTQIYTHVAKTRLKSIHKQF--
XERC_SERMA      ESSGDLRAVQELLGHANLTTTQIY-----------------
XERC_PSYIN      ESSGNLRAVQTLLGHADLATTQIY-----------------
XERC_MYXXD      GGGADIRSIQELLGHSSLSTTQRYTQV--------------
XERC_MYXXA      GGGADIRSIQELLGHSSLSTTQRYTQV--------------
XERC_ACTSZ      EASADLRAVQELLGHSNLATTQIY-----------------
XERC_NEIMA      QASRDIRAVQELLGHSSLSTTQIYTKLDFDHI---------
XERD_CLOAB      QNGADIKTIQELLGHSDMATTQIYSMYRKTRIAEVYKK---
XERD_BIFLO      QGGADVRTVQELLGHASVTTTQIYTHVS-------------
XERC_PSEPW      ESSQDLRAVQEMLGHADISTTQIY-----------------
XERD_RICCN      EGGADLRVIQELLGHADISTTQIYTHLQTNHLK--------
XERD_HAEIN      NHGADLRVVQMLLGHTDLSTTQIYTHVAKERLKRLHERF--
XERC_CHLTE      NGGADLKSVSEMLGHSNLTTTELYTHVTFNRLRDAYTK---
XERC_NEIMF      QASRDIRAVQELLGHSSLSTTQIYTKLDFDHI---------
XERC_MYCGI      EGGADLRVVQELLGHSSLATTQLYTHVTVARLRAVHDQ---
XERC_PELPD      EGGADLRAIQELLGHASLSTTQKYTHVSLDRLMEVYDK---
XERC_NEIG2      QASRDIRAVQELLGHSSLSTTQIYTKLDFDHI---------
XERC_NEIG1      QASRDIRAVQELLGHSSLSTTQIYTKLDFDHI---------
XERD_RICBR      EGGADLRVIQELLGHADISTTQIYTHLQTNHLK--------
XERC_EUBR3      EADVDIRYIQEMLGHSSINITQIYTHV--------------
XERD_RICFE      EGGADLRVIQGLLGHADISTTQIYTHLQTNHLK--------
XERC_RALPJ      QSSGDLRAVQELLGHASIASTQVYTSLD-------------
XERC_NEIM0      QASRDIRAVQELLGHSSLSTTQIYTKLDFDHI---------
XERD_LACCA      ENGADLRVVQELLGHSDISTTQIYTLSNQHLVAVYHK----
XERC_XYLFA      ESSGDLRGVQELLGHADITTTQIY-----------------
XERC_SYNFM      NSGADLRAIQEMLGHSNLSTTQRYTHVH-------------
XERC_GEOLS      EGGADLRSIQELLGHSSLSTTQKYTHVGLDRLLEVYDK---
XERC_AZOVD      ESSQDLRAVQELLGHADIATTQIY-----------------
XERC_PELPB      NSGADLNSVSDMLGHSNLSTTEIYTHVTFERLKEVYRK---
XERC_CHLP8      NGGADLKSVSEMLGHSSLTTTELYTHVTFSRLKEIYDK---
XERD_RICPR      EGGADLRVIQELLGHADISTTQIYTHLHTNHLK--------
XERC_THETN      RYGVDIRTLQKLLGHSNVSTTQIYTHVDDSQLREAVNK---
XERC_NEIMB      QASRDIRAVQELLGHSSLSTTQIYTKLDFDHI---------
XERD_CORGL      EGGADVRVVQELLGHSSVTTTQIYTHITADSLR--------
XERD_SHEON      NHGADLRVVQLLLGHSDLSTTQIYTHVARARLQELHQQ---
XERC_XYLFT      ESSGDLRGVQELLGHADITTTQIY-----------------
XERC_XYLF2      ESSGDLRGVQELLGHADITTTQIY-----------------
XERC_PSEAE      ESSGDLRAVQELLGHADIATTQIY-----------------
XERC_PSEA7      ESSGDLRAVQELLGHADIATTQIY-----------------
XERC_PSEAB      ESSGDLRAVQELLGHADIATTQIY-----------------
XERC_PSEA8      ESSGDLRAVQELLGHADIATTQIY-----------------
XERD_RALSO      NHGADLRVVQMLLGHADISTTQIYTHVARERLRTLH-----
XERS_STRPI      DATKSQVLVSHQLGHASTQVTDLYTHIVNDEQKNA------
XERD_VIBCH      NYGADLRVVQMLLGHSDLSTTQIYTHVATERLKQLHNE---
XERC_THEAB      RKGVNIKVVQELLGHTNLSTTSIYLHV--------------
XERC_MYCS2      EGGADLRIVQELLGHTSLATTQLYTHVTVERLRAVHDQ---
XERS_STRZT      DATKSQVLVSHQLGHASTQVTDLYTHIVNDEQKNA------
XERS_STRZP      DATKSQVLVSHQLGHASTQVTDLYTHIVNDEQKNA------
XERS_STRZJ      DATKSQVLVSHQLGHASTQVTDLYTHIVNDEQKNA------
XERS_STRR6      DATKSQVLVSHQLGHASTQVTDLYTHIVNDEQKNA------
XERS_STRPS      DATKSQVLVSHQLGHASTQVTDLYTHIVNDEQKNA------
XERS_STRPJ      DATKSQVLVSHQLGHASTQVTDLYTHIVSDEQKNA------
XERS_STRP7      DATKSQVLVSHQLGHASTQVTDLYTHIVSDEQKNA------
XERS_STRP4      DATKSQVLVSHQLGHASTQVTDLYTHIVNDEQKNA------
XERS_STRP2      DATKSQVLVSHQLGHASTQVTDLYTHIVNDEQKNA------
XERS_STRPN      DATKSQVLVSHQLGHASTQVTDLYTHIVSDEQKNA------
XERD_VIBVY      NYGADLRVVQMLLGHSDLSTTQIYTHVATERLKQIHSQ---
XERD_VIBVU      NYGADLRVVQMLLGHSDLSTTQIYTHVATERLKQIHSQ---
XERD_MYCTU      EGGADVRVVQELLGHASVTTTQIYTLV--------------
XERD_MYCBO      EGGADVRVVQELLGHASVTTTQIYTLV--------------
XERC_BACHD      NNGADLRVVQDLLGHENLSTTQVYTHVTKDRLR--------
XERS_STRA5      DATKSQVLVSHQLGHASTQVTDLYTHIVNDEQKNALDK---
XERS_STRA3      DATKSQVLVSHQLGHASTQVTDLYTHIVNDEQKNALDK---
XERS_STRA1      DATKSQVLVSHQLGHASTQVTDLYTHIVNDEQKNALDK---
XERC_MYCSS      EGGADLRIVQELLGHSTLATTQLYTHVTVARLRAVHDQ---
XERC_MYCSK      EGGADLRIVQELLGHSTLATTQLYTHVTVARLRAVHDQ---
XERC_MYCSJ      EGGADLRIVQELLGHSTLATTQLYTHVTVARLRAVHDQ---
XERC_MYCTU      EGGADLRVVQELLGHSSLATTQLYTHVAVARLRAVHER---
XERC_MYCTA      EGGADLRVVQELLGHSSLATTQLYTHVAVARLRAVHER---
XERC_MYCBT      EGGADLRVVQELLGHSSLATTQLYTHVAVARLRAVHER---
XERC_MYCBP      EGGADLRVVQELLGHSSLATTQLYTHVAVARLRAVHER---
XERC_MYCBO      EGGADLRVVQELLGHSSLATTQLYTHVAVARLRAVHER---
XERC2_RALSO     EAGADVRVLQALLGHAQLNTTEIYTHVSIEHLRAIH-----
XERC1_RALSO     QSSGDLRAVQELLGHASIASTQVYTSLD-------------
XERD_RHILO      QNGADLRAVQQLLGHADISTTQIYTHV--------------
XERC_PSEPG      ESSQDLRAVQELLGHADISTTQIY-----------------
XERCL_PYRAB     ERGIDIRIIQELLGHSNLSTTQIYTKVSTKHLKEAVKK---
XERS_STRT2      DATKSQVLVSHQLGHASTQVTDLYTHIVNDEQKNA------
XERS_STRT1      DATKSQVLVSHQLGHASTQVTDLYTHIVNDEQKNA------
XERS_STRGC      DATKSQVLVSHQLGHASTQVTDLYTHIVNDEQKNALNK---
Y4RF_RHISN      GQRRPINEVADLLGHRSINTTALYVKV--------------
XERC_PSEP1      ESSQDLRAVQEMLGHADISTTQIY-----------------
XERS_STRSV      DATKSQVLVSHQLGHASTQVTDLYTHIVNDEQKNALDK---
XERD_PSEPK      NHGADLRVVQMLLGHSDLSTTQIYTHVAKARLQQLH-----
XERD_PSEAE      NHGADLRVVQMLLGHSDLSTTQIYTHIARARLQDLHAR---
XERC_PSEPK      ESSQDLRAVQEMLGHADISTTQIY-----------------
XERS_STRTD      DATKSQVLVSHQLGHASTQVTDLYTHIVNDEQKNA------
XERS_STRMU      DATKSQVLVSHQLGHASTQVTDLYTHIVNDEQKNALDK---
XERD_BRAJA      HNGADLRIVQTLLGHTDISTTQIYTHVVEERLK--------
XERD_XANCP      NHGADLRALQMLLGHSSLSTTQIYTLVARQHLQTLHAR---
Y4RC_RHISN      QAGVDRAVIALWLGHESVETTQIY-----------------
XERD_XANAC      NHGADLRALQMLLGHSSLSTTQIYTLVARQHLQKLH-----
XERD_COREF      EGGADVRVVQELLGHSSVTTTQIYTHVTAENLR--------
XERS_STRU0      DATKSQVLVSHQLGHASTQVTDLYTHIVNDEQKNALDK---
XERS_STRPG      DATKSQVLVSHQLGHSSTQVTDLYTHIVNDEQKNA------
XERS_STRP6      DATKSQVLVSHQLGHSSTQVTDLYTHIVNDEQKNA------
XERC_ERYLH      EGGADLRVLQTLLGHADISTTQIYTHVD-------------
XERS_STRPZ      DATKSQVLVSHQLGHSSTQVTDLYTHIVNDEQKNA------
XERS_STRPM      DATKSQVLVSHQLGHSSTQVTDLYTHIVNDEQKNA------
XERS_STRPF      DATKSQVLVSHQLGHSSTQVTDLYTHIVNDEQKNA------
XERS_STRPD      DATKSQVLVSHQLGHSSTQVTDLYTHIVNDEQKNA------
XERS_STRPB      DATKSQVLVSHQLGHSSTQVTDLYTHIVNDEQKNA------
XERS_STRP8      DATKSQVLVSHQLGHSSTQVTDLYTHIVNDEQKNA------
XERS_STRP3      DATKSQVLVSHQLGHSSTQVTDLYTHIVNDEQKNA------
XERS_STRP1      DATKSQVLVSHQLGHSSTQVTDLYTHIVNDEQKNA------
XERD_XYLFT      NHGADLRALQMLLGHRSISTTQIYTLI--------------
XERC_PSEE4      ESSQDLRAVQEMLGHADISTTQIY-----------------
XERC_PELTS      NAGADLRSVQELMGHVRLSSTQVYTHVTGERLKKVYRK---
XERS_STRPC      DATKSQVLVSHQLGHSSTQVTDLYTHIVNDEQK--------
XERC_RICPR      EYGADLRSIQELLGHKSLSTTQKY---TQTSIKH-------
XERD_CAUCR      EGGADLRVIQTLLGHADIATTQIYTHVAGEHLAH-------
XERC_RICAE      EHGADLRSLQELLGHKSLSTTQSY---TKTSIKH-------
XERC_RICPU      EHGADLRSLQELLGHKSLSTTQNY---TKTSIKH-------
XERC_RICFE      EHGADLRSIQELLGHKSLSTTQNY---TKTSIKH-------
Y367_METJA      NKGVPIDIVKEYLGHKSMNTTLIYA----------------
XERD_CHLPN      DNKADLRVIQEMLGHARIASTEVYTHV--------------
XERDL_THETN     QNGADLKTVQEMLGYEVNFGNNLLSLVSRSKMKEVYNKF--
XERC_RICCN      EHGADLRSLQELLGHKSLSTTQNY---TKTSIKH-------
XERD_XYLFA      NHGADLRALQMLLGHRSISTTQIYTFI--------------
XERC_RICM5      EHGADLRSIQELLGHKSLSTTQNY---TKTSIKH-------
XERC_BRAJA      SRGGDLRAIQELLGHSSLSTTQIYTGIDSERL---------
XERS_STRS7      DTTKSQVLVSHQLGHASTQVTDLYTHIVNDEQKNALDK---
XERS_STREM      DTTKSQVLVSHQLGHASTQVTDLYTHIVNDEQKNALDK---
XERD_CHLTR      NNHADLRIIQEMLGHSRISSTEIYTHV--------------
XERS_STRE4      DTTKSQVLVSHQLGHASTQVTDLYTHIVNDEQKNALDK---
XERD_MYCLE      EGGADIRVVQELMGHASVTTTQIYTLV--------------
XERC_RICRS      EHGADLRSLQALLGHKSLSTTQNY---TKTSIKH-------
XERC_RICRO      EHGADLRSLQALLGHKSLSTTQNY---TKTSIKH-------
XERC_RHOCS      GGGADLRAIQDLLGHASLSTTQRYTDVDAEHL---------
TNPE_STAAU      NNGVPQHIVQKFLGHESPEMTSRYAHIFDETLKNEFTKF--
TNPB_STAAU      NNGMPQHIVQKFLGHESPEMTSRYAHIFDETLKNEFTKF--
TNPB_STAAN      NNGMPQHIVQKFLGHESPEMTSRYAHIFDETLKNEFTKF--
TNPB_STAAM      NNGMPQHIVQKFLGHESPEMTSRYAHIFDETLKNEFTKF--
XERC_NITWN      SRGGDLRAIQELLGHASLSTTQIYTGIDSERL---------
XERCL_THETN     ERGVPLKTVSELLGHSNISIT--------------------
XERS_STRSY      DATKSQVLVSHQLGHANTQVTDLYTHIVNDEQKNA------
XERS_STRS2      DATKSQVLVSHQLGHANTQVTDLYTHIVNDEQKNA------
XERD_BRUSU      QNGADLRTVQQLLGHADISTTQIYTHV--------------
XERD_BRUME      QNGADLRTVQQLLGHADISTTQIYTHV--------------
XERC_SYNE7      DAGGNIRLVQKLSRHSRLETLQRYDDARQD-----------
XERD_CHLMU      NNQADLRIIQEMLGHARISSTEIYTHVASESI---------
XERC_RICCK      EHGADLRSIQELLGHKSLSTTQNY---TKTSIKH-------
TNPA_STAAU      REGWDVAFVQKRLGHAHVQTTLTYVHLSDQDMKNEFNKYL-
TNPA_STAAN      REGWDVAFVQKRLGHAHVQTTLTYVHLSDQDMKNEFNKYL-
TNPA_STAAM      REGWDVAFVQKRLGHAHVQTTLTYVHLSDQDMKNEFNKYL-
Y4RA_RHISN      RGGASLGEIGEVLGHRHVQTTAIYAKVD-------------
XERC_RICTY      EYGADLRSIQELLGHKSLSTTQKY---TQTSIKH-------
XERD_BRUAB      QNGADLRTVQQLLGHADISTTQIYTHV--------------
XERD_BRUA2      QNGADLRTVQQLLGHADISTTQIYTHV--------------
XERC_AGRT5      AGGGDLRTIQELLGHASLSTTQVYTGVD-------------
XERCL_PSEAE     ERN--IHLTKCLLNHSNIQTTMSYIEADYDHMR--------
Y4QK_RHISN      EAGADVRTIQLLLGHRSLATTAHYLRIATNKV---------
XERC_RICAH      ERGAELRSIQELLGHKSLSTTQNY-----------------
XERD_AGRT5      QNGADLRAVQELLGHSDISTTQIYTHVLEERLQ--------
XERC_RHIME      AGGGDLRTIQELLGHASLSTTQVYTGVD-------------
INT2_SALTI      RSGYDIRTVQDLLGHSDVSTTMIYTHV--------------
INT2_PSEAE      RSGYDIRTVQDLLGHSDVSTTMIYTHV--------------
INT2_ECOLX      RSGYDIRTVQDLLGHSDVSTTMIYTHV--------------
XERC_UREPA      IKGANPKTVMLQMGHANIQTTFSYLNLNEQTNRRIYNKIM-
XERC_BRUME      GRGGDLRTIQELLGHASLSTTQVYTGVDTQRLLEVYDK---
XERC_BRUSU      GRGGDLRTIQELLGHASLSTTQVYTGVDTQRLLEVYDK---
YOEC_BACSU      QRTKDIAELQRILNHSSPSITMRYIGIDEDTTRAAYKVF--
Y4EF_RHISN      EAGADVRTIQPLLGHRSLATTAHYLRIATNKV---------
XERS_LACLS      AQTNSQVLVSNQLGHASTQVTDLYTHIINEEQKNA------
XERS_LACLM      AQTNSQVLVSNQLGHASTQVTDLYTHIINEEQKNA------
Y4RE_RHISN      -----------------------------------------
XERC_RHILO      GRGGDLRTIQELLGHASLSTTQIYTGVD-------------
XERS_LACLA      AQTNSQVLVSNQLGHASTQVTDLYTHIINEEQKNA------
Y4GC_RHISN      RAAVPQKIIGELLGHRSIASTAPY-----------------
YZ09_AQUAE      TKGFPVNLIADWVGHSKISTTM-------------------
FIME_SHIFL      ERGADTRLIQDYLGHRNIRHTVRYTASN-------------
FIME_ECOLI      ERGADTRLIQDYLGHRNIRHTVRYTASN-------------
FIME_ECOL6      ERGADTRLIQDYLGHRNIRHTVRYTASN-------------
XERC_METS4      ARQGDLRAIQDLLGHASLATTQIYTKVD-------------
XERC_SYNY3      EANGDTRKVQKLSRHSNLNTLMIY-----DDNRHQHQAQIT
Y4RB_RHISN      VRWYEAEQLSTYLGHVHVADTQWY-----------------
XERC_METNO      ARQGDLRAIQDLLGHASLATTQVYTKVD-------------
GP8D_CHLPS      KMGCSDSDIMKITGHSSSKMIYAY-----------------
VINT_BPML5      XXXXXXKELMARLGHTTPRMAMKYQMASE------------
VINT_BPMD2      XXXXXXKELMVRLGHTTPRMAMKYQMAS-------------
VINT_BPMFR      XXXXXXKELMVRLGHTTPRMAMKYQMAS-------------
REDM_ECOLX      YAGIPLKVLQSLMGHKSISSTEVYTKVFALDVAARHR----
REDF_ECOLI      YAGIPLKVLQSLMGHKSISSTEVYTKVFALDVAARHR----
XERC_PSESX      QPERNIHITKNLLNHSNIATTMEY-----------------
VINT_BPP22      QAGVPISVLQEMGGWESIEMVRRYAHLAPNHLEHARQ----
INTD_ECOLI      QSGVPLSVLQEMGGWESIEMVRRYAHLAPNHLTEHARK---
GP8D_CHLTR      RLGCSDSDIMKVTGHATAKMIFAY-----------------
VINT_BPPH8      ELGCPPHVIEKLLGHQMVGVMAHY-----------------
FIMB_ECOLI      NMGIDTRLIQDYLGHRNIRHTVWYTASN-------------
FIMB_ECO57      NMGIDTRLIQDYLGHRNIRHTVWYTASN-------------
VLF1_NPVOP      NSGVPLQKVARLMNHESPASTKPY-----------------
GP8D_CHLMU      RLGCSDSDIMKVTGHTTAKMVFAY-----------------
VINT_BP434      -----------------------------------------
INTR_STRAM      DRGVPLEEISRLVGHS-------------------------