[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for spne4:ACF55614.1

[Show Plain Result]


## Summary of Sequence Search
    1::226
    1::226     e-114 100%  226 aa  RADC_STRZT RecName: Full=DNA repair protein radC homolog;
    1::226     e-114 100%  226 aa  RADC_STRZP RecName: Full=DNA repair protein radC homolog;
    1::226     e-114 100%  226 aa  RADC_STRPN RecName: Full=DNA repair protein radC homolog;
    1::226     e-114 100%  226 aa  RADC_STRPJ RecName: Full=DNA repair protein radC homolog;
    1::226     e-114 100%  226 aa  RADC_STRPI RecName: Full=DNA repair protein radC homolog;
    1::226     e-114 100%  226 aa  RADC_STRP7 RecName: Full=DNA repair protein radC homolog;
    1::226     e-114 100%  226 aa  RADC_STRP4 RecName: Full=DNA repair protein radC homolog;
    1::226     e-114 100%  226 aa  RADC_STRR6 RecName: Full=DNA repair protein radC homolog;
    1::226     e-114 100%  226 aa  RADC_STRP2 RecName: Full=DNA repair protein radC homolog;
    1::226     e-114 100%  226 aa  RADC_STRZJ RecName: Full=DNA repair protein radC homolog;
    1::226     9e-86  76%  226 aa  RADC_STRGC RecName: Full=DNA repair protein radC homolog;
    1::227     1e-83  65%  227 aa  RADC_STRSV RecName: Full=DNA repair protein radC homolog;
    1::226     7e-72  59%  246 aa  RADC_STRS2 RecName: Full=DNA repair protein radC homolog;
    1::226     3e-69  55%  226 aa  RADC_STRA5 RecName: Full=DNA repair protein radC homolog;
    1::226     3e-69  55%  226 aa  RADC_STRA1 RecName: Full=DNA repair protein radC homolog;
    1::226     3e-69  55%  226 aa  RADC_STRA3 RecName: Full=DNA repair protein radC homolog;
    1::225     3e-68  56%  226 aa  RADC_STRU0 RecName: Full=DNA repair protein radC homolog;
    1::224     2e-66  55%  228 aa  RADC_STRTD RecName: Full=DNA repair protein radC homolog;
    1::224     8e-66  55%  228 aa  RADC_STRT2 RecName: Full=DNA repair protein radC homolog;
    1::224     2e-65  54%  228 aa  RADC_STRT1 RecName: Full=DNA repair protein radC homolog;
    1::225     3e-61  52%  226 aa  RADC_STRPZ RecName: Full=DNA repair protein radC homolog;
    1::225     3e-61  52%  226 aa  RADC_STRPM RecName: Full=DNA repair protein radC homolog;
    1::225     3e-61  52%  226 aa  RADC_STRPG RecName: Full=DNA repair protein radC homolog;
    1::225     3e-61  52%  226 aa  RADC_STRPF RecName: Full=DNA repair protein radC homolog;
    1::225     3e-61  52%  226 aa  RADC_STRPD RecName: Full=DNA repair protein radC homolog;
    1::225     3e-61  52%  226 aa  RADC_STRPC RecName: Full=DNA repair protein radC homolog;
    1::225     3e-61  52%  226 aa  RADC_STRPB RecName: Full=DNA repair protein radC homolog;
    1::225     3e-61  52%  226 aa  RADC_STRP8 RecName: Full=DNA repair protein radC homolog;
    1::225     3e-61  52%  226 aa  RADC_STRP1 RecName: Full=DNA repair protein radC homolog;
    1::225     4e-61  52%  226 aa  RADC_STRP6 RecName: Full=DNA repair protein radC homolog;
    1::225     6e-61  52%  226 aa  RADC_STRP3 RecName: Full=DNA repair protein radC homolog;
    1::224     4e-57  51%  225 aa  RADC_STRS7 RecName: Full=DNA repair protein radC homolog;
    1::224     9e-57  51%  225 aa  RADC_STREM RecName: Full=DNA repair protein radC homolog;
    1::224     2e-56  51%  225 aa  RADC_STRE4 RecName: Full=DNA repair protein radC homolog;
   16::226     1e-49  46%  232 aa  RADC_ENTFA RecName: Full=DNA repair protein radC homolog;
    1::222     6e-47  42%  226 aa  RADC_LACLA RecName: Full=DNA repair protein radC homolog;
   14::223     8e-44  42%  226 aa  RADC_GEOKA RecName: Full=DNA repair protein radC homolog;
   14::223     1e-43  44%  226 aa  RADC_GEOTN RecName: Full=DNA repair protein radC homolog;
    5::223     1e-43  40%  224 aa  RADC_LACSS RecName: Full=DNA repair protein radC homolog;
   14::223     2e-43  42%  230 aa  RADC_BACSK RecName: Full=DNA repair protein radC homolog;
    8::221     2e-43  42%  224 aa  RADC_BACLD RecName: Full=DNA repair protein radC homolog;
   19::228     4e-43  44%  231 aa  RADC_BACSU RecName: Full=DNA repair protein radC homolog;
   17::229     4e-43  42%  232 aa  RADC_BACHD RecName: Full=DNA repair protein radC homolog;
   19::228     4e-43  45%  231 aa  RADC_BACA2 RecName: Full=DNA repair protein radC homolog;
   14::223     2e-42  43%  226 aa  RADC_GEOSW RecName: Full=DNA repair protein radC homolog;
   13::222     3e-42  42%  225 aa  RADC_BACHK RecName: Full=DNA repair protein radC homolog;
   13::222     3e-42  42%  225 aa  RADC_BACC3 RecName: Full=DNA repair protein radC homolog;
   13::222     3e-42  42%  225 aa  RADC_BACAN RecName: Full=DNA repair protein radC homolog;
   13::222     3e-42  42%  225 aa  RADC_BACAC RecName: Full=DNA repair protein radC homolog;
   13::222     3e-42  42%  225 aa  RADC_BACAA RecName: Full=DNA repair protein radC homolog;
    1::222     5e-42  38%  227 aa  RADC_LACLM RecName: Full=DNA repair protein radC homolog;
   13::222     5e-42  42%  225 aa  RADC_BACCZ RecName: Full=DNA repair protein radC homolog;
   13::222     8e-42  42%  225 aa  RADC_BACCQ RecName: Full=DNA repair protein radC homolog;
   13::222     8e-42  42%  225 aa  RADC_BACC7 RecName: Full=DNA repair protein radC homolog;
   13::222     8e-42  42%  225 aa  RADC_BACC1 RecName: Full=DNA repair protein radC homolog;
   12::220     3e-40  41%  226 aa  RADC_STAES RecName: Full=DNA repair protein radC homolog;
   12::221     7e-40  40%  224 aa  RADC_BACP2 RecName: Full=DNA repair protein radC homolog;
   21::222     6e-39  41%  225 aa  RADC_BACC2 RecName: Full=DNA repair protein radC homolog;
   21::222     1e-38  41%  225 aa  RADC_BACC4 RecName: Full=DNA repair protein radC homolog;
    8::222     2e-38  40%  222 aa  RADC_THEMA RecName: Full=DNA repair protein radC homolog;
    7::222     4e-38  40%  222 aa  RADC_THEP1 RecName: Full=DNA repair protein radC homolog;
   12::218     4e-38  40%  222 aa  RADC_CHLP8 RecName: Full=DNA repair protein radC homolog;
   21::222     4e-38  40%  225 aa  RADC_BACWK RecName: Full=DNA repair protein radC homolog;
    9::221     5e-38  38%  228 aa  RADC_STAHJ RecName: Full=DNA repair protein radC homolog;
   16::225     7e-38  38%  228 aa  RADC_CLOK5 RecName: Full=DNA repair protein radC homolog;
   16::225     7e-38  38%  228 aa  RADC_CLOK1 RecName: Full=DNA repair protein radC homolog;
   12::218     9e-38  40%  223 aa  RADC_PROA2 RecName: Full=DNA repair protein radC homolog;
   12::218     9e-38  38%  222 aa  RADC_CHLTE RecName: Full=DNA repair protein radC homolog;
   12::222     2e-37  39%  223 aa  RADC_PROVI RecName: Full=DNA repair protein radC homolog;
   19::230     2e-36  38%  232 aa  RADC_ALKMQ RecName: Full=DNA repair protein radC homolog;
   12::218     2e-36  38%  222 aa  RADC_PELPB RecName: Full=DNA repair protein radC homolog;
   17::223     2e-36  36%  229 aa  RADC_FLAJ1 RecName: Full=DNA repair protein radC homolog;
   16::225     2e-36  37%  228 aa  RADC_CLOTE RecName: Full=DNA repair protein radC homolog;
   12::221     4e-36  36%  224 aa  RADC_LISMH RecName: Full=DNA repair protein radC homolog;
   16::224     4e-36  37%  227 aa  RADC_CLOPS RecName: Full=DNA repair protein radC homolog;
   17::226     5e-36  36%  229 aa  RADC_CLOAB RecName: Full=DNA repair protein radC homolog;
   12::221     6e-36  36%  224 aa  RADC_LISMO RecName: Full=DNA repair protein radC homolog;
   12::221     8e-36  36%  224 aa  RADC_LISMF RecName: Full=DNA repair protein radC homolog;
   12::221     8e-36  36%  224 aa  RADC_LISMC RecName: Full=DNA repair protein radC homolog;
   16::224     1e-35  37%  227 aa  RADC_CLOPE RecName: Full=DNA repair protein radC homolog;
   16::224     1e-35  37%  227 aa  RADC_CLOP1 RecName: Full=DNA repair protein radC homolog;
    5::218     2e-35  34%  221 aa  RADC_SALAR RecName: Full=DNA repair protein radC;
    4::218     2e-35  35%  221 aa  RADC_ENT38 RecName: Full=DNA repair protein radC homolog;
    6::217     2e-35  35%  220 aa  RADC_ACTPJ RecName: Full=DNA repair protein radC homolog;
    6::217     2e-35  35%  220 aa  RADC_ACTP7 RecName: Full=DNA repair protein radC homolog;
    6::217     2e-35  35%  220 aa  RADC_ACTP2 RecName: Full=DNA repair protein radC homolog;
   12::221     4e-35  35%  224 aa  RADC_LISIN RecName: Full=DNA repair protein radC homolog;
    8::219     9e-35  35%  223 aa  RADC_FINM2 RecName: Full=DNA repair protein radC homolog;
   16::226     9e-35  35%  229 aa  RADC_CLOBA RecName: Full=DNA repair protein radC homolog;
    9::232     1e-34  37%  235 aa  RADC_SYNWW RecName: Full=DNA repair protein radC homolog;
    5::218     3e-34  34%  221 aa  RADC_SALTY RecName: Full=DNA repair protein radC;
    5::218     3e-34  34%  221 aa  RADC_SALTI RecName: Full=DNA repair protein radC;
    5::218     3e-34  34%  221 aa  RADC_SALSV RecName: Full=DNA repair protein radC;
    5::218     3e-34  34%  221 aa  RADC_SALPK RecName: Full=DNA repair protein radC;
    5::218     3e-34  34%  221 aa  RADC_SALPC RecName: Full=DNA repair protein radC;
    5::218     3e-34  34%  221 aa  RADC_SALPA RecName: Full=DNA repair protein radC;
    5::218     3e-34  34%  221 aa  RADC_SALHS RecName: Full=DNA repair protein radC;
    5::218     3e-34  34%  221 aa  RADC_SALG2 RecName: Full=DNA repair protein radC;
    5::218     3e-34  34%  221 aa  RADC_SALEP RecName: Full=DNA repair protein radC;
    5::218     3e-34  34%  221 aa  RADC_SALDC RecName: Full=DNA repair protein radC;
    5::218     3e-34  34%  221 aa  RADC_SALCH RecName: Full=DNA repair protein radC;
    5::218     3e-34  34%  221 aa  RADC_SALA4 RecName: Full=DNA repair protein radC;
   19::233     3e-34  37%  235 aa  RADC_COPPD RecName: Full=DNA repair protein radC homolog;
    8::219     3e-34  33%  222 aa  RADC_ECOHS RecName: Full=DNA repair protein radC;
    8::219     5e-34  33%  222 aa  RADC_SHIFL RecName: Full=DNA repair protein radC;
    8::219     5e-34  33%  222 aa  RADC_SHIF8 RecName: Full=DNA repair protein radC;
    8::219     5e-34  33%  222 aa  RADC_SHIDS RecName: Full=DNA repair protein radC;
    8::219     5e-34  33%  222 aa  RADC_SHIBS RecName: Full=DNA repair protein radC;
    5::218     5e-34  34%  221 aa  RADC_SALNS RecName: Full=DNA repair protein radC;
    8::219     5e-34  33%  222 aa  RADC_ESCF3 RecName: Full=DNA repair protein radC;
    8::219     5e-34  33%  222 aa  RADC_ECOUT RecName: Full=DNA repair protein radC;
    8::219     5e-34  33%  222 aa  RADC_ECOSM RecName: Full=DNA repair protein radC;
    8::219     5e-34  33%  222 aa  RADC_ECOLU RecName: Full=DNA repair protein radC;
    8::219     5e-34  33%  222 aa  RADC_ECOLI RecName: Full=DNA repair protein radC;
    8::219     5e-34  33%  222 aa  RADC_ECOL6 RecName: Full=DNA repair protein radC;
    8::219     5e-34  33%  222 aa  RADC_ECOL5 RecName: Full=DNA repair protein radC;
    8::219     5e-34  33%  222 aa  RADC_ECOK1 RecName: Full=DNA repair protein radC;
    8::219     5e-34  33%  222 aa  RADC_ECODH RecName: Full=DNA repair protein radC;
    8::219     5e-34  33%  222 aa  RADC_ECOBW RecName: Full=DNA repair protein radC;
    8::219     5e-34  33%  222 aa  RADC_ECO8A RecName: Full=DNA repair protein radC;
    8::219     5e-34  33%  222 aa  RADC_ECO81 RecName: Full=DNA repair protein radC;
    8::219     5e-34  33%  222 aa  RADC_ECO7I RecName: Full=DNA repair protein radC;
    8::219     5e-34  33%  222 aa  RADC_ECO5E RecName: Full=DNA repair protein radC;
    8::219     5e-34  33%  222 aa  RADC_ECO57 RecName: Full=DNA repair protein radC;
    8::219     5e-34  33%  222 aa  RADC_ECO55 RecName: Full=DNA repair protein radC;
    8::219     5e-34  33%  222 aa  RADC_ECO45 RecName: Full=DNA repair protein radC;
    8::219     5e-34  33%  222 aa  RADC_ECO27 RecName: Full=DNA repair protein radC;
    8::219     5e-34  33%  222 aa  RADC_ECO24 RecName: Full=DNA repair protein radC;
   16::226     5e-34  35%  229 aa  RADC_CLOBB RecName: Full=DNA repair protein radC homolog;
   16::235     6e-34  40%  243 aa  RADC_SYNP2 RecName: Full=DNA repair protein radC homolog;
    5::217     6e-34  37%  221 aa  RADC_HAEIE RecName: Full=DNA repair protein radC homolog;
   19::228     6e-34  36%  232 aa  RADC_ALKOO RecName: Full=DNA repair protein radC homolog;
    3::218     1e-33  33%  221 aa  RADC_KLEP3 RecName: Full=DNA repair protein radC homolog;
   16::228     1e-33  36%  228 aa  RADC_CLONN RecName: Full=DNA repair protein radC homolog;
   12::221     1e-33  34%  226 aa  RADC_STAS1 RecName: Full=DNA repair protein radC homolog;
    2::221     2e-33  33%  224 aa  RADC_NITEC RecName: Full=DNA repair protein radC homolog;
    5::217     2e-33  37%  221 aa  RADC_HAEI8 RecName: Full=DNA repair protein radC homolog;
   15::224     3e-33  36%  229 aa  RADC_CHLSY RecName: Full=DNA repair protein radC homolog;
   15::224     3e-33  36%  229 aa  RADC_CHLAA RecName: Full=DNA repair protein radC homolog;
    4::219     4e-33  35%  222 aa  RADC_HAES2 RecName: Full=DNA repair protein radC homolog;
    4::219     4e-33  35%  222 aa  RADC_HAES1 RecName: Full=DNA repair protein radC homolog;
    8::219     5e-33  33%  222 aa  RADC_SHIB3 RecName: Full=DNA repair protein radC;
    2::221     9e-33  34%  224 aa  RADC_NITEU RecName: Full=DNA repair protein radC homolog;
    2::217     9e-33  35%  220 aa  RADC_ACTSZ RecName: Full=DNA repair protein radC homolog;
    9::220     1e-32  35%  224 aa  RADC_PASMU RecName: Full=DNA repair protein radC homolog;
   17::225     1e-32  34%  229 aa  RADC_METBU RecName: Full=DNA repair protein radC homolog;
    5::218     1e-32  32%  221 aa  RADC_KLEP7 RecName: Full=DNA repair protein radC homolog;
   12::224     1e-32  37%  227 aa  RADC_PORGI RecName: Full=DNA repair protein radC homolog;
   16::235     1e-32  39%  243 aa  RADC_MICAN RecName: Full=DNA repair protein radC homolog;
   12::220     2e-32  36%  226 aa  RADC_STACT RecName: Full=DNA repair protein radC homolog;
    6::217     2e-32  34%  223 aa  RADC_HAEDU RecName: Full=DNA repair protein radC homolog;
   16::226     2e-32  33%  229 aa  RADC_CLOB8 RecName: Full=DNA repair protein radC homolog;
   18::227     3e-32  32%  230 aa  RADC_ENTS8 RecName: Full=DNA repair protein radC homolog;
    5::217     4e-32  36%  221 aa  RADC_HAEIN RecName: Full=DNA repair protein radC homolog;
   14::224     6e-32  36%  235 aa  RADC_ACIBT RecName: Full=DNA repair protein radC homolog;
   14::224     6e-32  36%  235 aa  RADC_ACIB5 RecName: Full=DNA repair protein radC homolog;
   14::224     6e-32  36%  235 aa  RADC_ACIB3 RecName: Full=DNA repair protein radC homolog;
    9::195     9e-32  40%  228 aa  RADC_STAAW RecName: Full=DNA repair protein radC homolog;
    9::195     9e-32  40%  228 aa  RADC_STAAS RecName: Full=DNA repair protein radC homolog;
    9::195     9e-32  40%  228 aa  RADC_STAAE RecName: Full=DNA repair protein radC homolog;
    9::195     9e-32  40%  228 aa  RADC_STAAC RecName: Full=DNA repair protein radC homolog;
    1::185     1e-31  39%  218 aa  RADC_STAA8 RecName: Full=DNA repair protein radC homolog;AltName:
    1::185     1e-31  39%  218 aa  RADC_STAA3 RecName: Full=DNA repair protein radC homolog;
   12::221     2e-31  35%  224 aa  RADC_VIBF1 RecName: Full=DNA repair protein radC homolog;
   14::223     2e-31  33%  229 aa  RADC_GEOSL RecName: Full=DNA repair protein radC homolog;
   12::221     3e-31  34%  225 aa  RADC_SHEHH RecName: Full=DNA repair protein radC homolog;
   26::225     3e-31  35%  230 aa  RADC_DESAP RecName: Full=DNA repair protein radC homolog;
    5::217     3e-31  32%  220 aa  RADC_CITK8 RecName: Full=DNA repair protein radC homolog;
   12::219     3e-31  33%  222 aa  RADC_CHLCH RecName: Full=DNA repair protein radC homolog;
   12::221     4e-31  32%  224 aa  RADC_TOLAT RecName: Full=DNA repair protein radC homolog;
    9::196     4e-31  39%  228 aa  RADC_STAAB RecName: Full=DNA repair protein radC homolog;
   12::221     4e-31  34%  225 aa  RADC_SHEPW RecName: Full=DNA repair protein radC homolog;
   12::221     4e-31  34%  225 aa  RADC_SHEPA RecName: Full=DNA repair protein radC homolog;
   12::221     5e-31  34%  224 aa  RADC_VIBFM RecName: Full=DNA repair protein radC homolog;
   12::221     6e-31  35%  224 aa  RADC_PSEA6 RecName: Full=DNA repair protein radC homolog;
   12::220     6e-31  35%  224 aa  RADC_JANMA RecName: Full=DNA repair protein radC homolog;
   12::224     6e-31  33%  224 aa  RADC_HERAR RecName: Full=DNA repair protein radC homolog;
   12::221     6e-31  34%  224 aa  RADC_ALISL RecName: Full=DNA repair protein radC homolog;
   12::221     8e-31  32%  224 aa  RADC_METFK RecName: Full=DNA repair protein radC homolog;
   11::221     1e-30  35%  224 aa  RADC_VIBVY RecName: Full=DNA repair protein radC homolog;
   11::221     1e-30  35%  224 aa  RADC_VIBVU RecName: Full=DNA repair protein radC homolog;
   15::227     1e-30  37%  230 aa  RADC_PHOLL RecName: Full=DNA repair protein radC homolog;
   12::218     1e-30  35%  223 aa  RADC_CHLPB RecName: Full=DNA repair protein radC homolog;
   19::239     1e-30  35%  271 aa  RADC_ACIAD RecName: Full=DNA repair protein radC homolog;
   12::218     1e-30  34%  223 aa  RADC_CHLPD RecName: Full=DNA repair protein radC homolog;
   40::247     1e-30  33%  253 aa  RADC_BURXL RecName: Full=DNA repair protein radC homolog;
   16::235     2e-30  35%  243 aa  RADC_SYNY3 RecName: Full=DNA repair protein radC homolog;
   17::230     2e-30  32%  231 aa  RADC_PARUW RecName: Full=DNA repair protein radC homolog;
   15::224     2e-30  35%  229 aa  RADC_CHLAD RecName: Full=DNA repair protein radC homolog;
   12::220     2e-30  34%  224 aa  RADC_RALSO RecName: Full=DNA repair protein radC homolog;
   12::221     3e-30  35%  225 aa  RADC_SHELP RecName: Full=DNA repair protein radC homolog;
   12::221     3e-30  33%  224 aa  RADC_SACD2 RecName: Full=DNA repair protein radC homolog;
   16::235     3e-30  36%  242 aa  RADC_CYAA5 RecName: Full=DNA repair protein radC homolog;
   11::221     5e-30  32%  224 aa  RADC_VIBCM RecName: Full=DNA repair protein radC homolog;
   11::221     5e-30  32%  224 aa  RADC_VIBCH RecName: Full=DNA repair protein radC homolog;
   11::221     5e-30  32%  224 aa  RADC_VIBC3 RecName: Full=DNA repair protein radC homolog;
   12::220     5e-30  32%  224 aa  RADC_RALPJ RecName: Full=DNA repair protein radC homolog;
    2::221     7e-30  35%  224 aa  RADC_PHOPR RecName: Full=DNA repair protein radC homolog;
    2::221     7e-30  34%  224 aa  RADC_CELJU RecName: Full=DNA repair protein radC homolog;
   12::221     9e-30  32%  225 aa  RADC_SHEFN RecName: Full=DNA repair protein radC homolog;
   12::224     9e-30  34%  228 aa  RADC_RALEJ RecName: Full=DNA repair protein radC homolog;
   12::220     9e-30  36%  224 aa  RADC_PSEA7 RecName: Full=DNA repair protein radC homolog;
   12::221     1e-29  31%  224 aa  RADC_MARAV RecName: Full=DNA repair protein radC homolog;
   21::201     1e-29  36%  227 aa  RADC_DESRM RecName: Full=DNA repair protein radC homolog;
   10::219     2e-29  35%  222 aa  RADC_YERE8 RecName: Full=DNA repair protein radC homolog;
   24::235     2e-29  38%  243 aa  RADC_CYAP7 RecName: Full=DNA repair protein radC homolog;
    2::220     2e-29  33%  224 aa  RADC_COXBN RecName: Full=DNA repair protein radC homolog;
    2::220     2e-29  33%  224 aa  RADC_COXB1 RecName: Full=DNA repair protein radC homolog;
   12::220     3e-29  35%  224 aa  RADC_PSEAE RecName: Full=DNA repair protein radC homolog;
   12::220     3e-29  35%  224 aa  RADC_PSEAB RecName: Full=DNA repair protein radC homolog;
   12::220     3e-29  35%  224 aa  RADC_PSEA8 RecName: Full=DNA repair protein radC homolog;
   12::220     3e-29  35%  225 aa  RADC_NEIMB RecName: Full=DNA repair protein radC homolog;
   12::220     3e-29  35%  225 aa  RADC_NEIMF RecName: Full=DNA repair protein radC homolog;
   12::213     3e-29  36%  226 aa  RADC_DELAS RecName: Full=DNA repair protein radC homolog;
   46::253     4e-29  33%  259 aa  RADC_BURPP RecName: Full=DNA repair protein radC homolog;
   12::221     4e-29  34%  224 aa  RADC_AERHH RecName: Full=DNA repair protein radC homolog;
   12::220     6e-29  35%  225 aa  RADC_NEIMA RecName: Full=DNA repair protein radC homolog;
   12::220     6e-29  35%  225 aa  RADC_NEIM0 RecName: Full=DNA repair protein radC homolog;
   17::239     8e-29  37%  250 aa  RADC_THEEB RecName: Full=DNA repair protein radC homolog;
   12::221     8e-29  32%  224 aa  RADC_TERTT RecName: Full=DNA repair protein radC homolog;
    4::218     8e-29  31%  221 aa  RADC_PECCP RecName: Full=DNA repair protein radC homolog;
   25::225     8e-29  30%  229 aa  RADC_METBF RecName: Full=DNA repair protein radC homolog;
   15::226     1e-28  33%  230 aa  RADC_GEOLS RecName: Full=DNA repair protein radC homolog;
   23::231     1e-28  31%  235 aa  RADC_CLOD6 RecName: Full=DNA repair protein radC homolog;
   16::225     1e-28  32%  228 aa  RADC_CLOBH RecName: Full=DNA repair protein radC homolog;
   16::225     1e-28  32%  228 aa  RADC_CLOB6 RecName: Full=DNA repair protein radC homolog;
   16::225     1e-28  32%  228 aa  RADC_CLOB1 RecName: Full=DNA repair protein radC homolog;
   10::219     1e-28  34%  222 aa  RADC_YERPY RecName: Full=DNA repair protein radC homolog;
   10::219     1e-28  34%  222 aa  RADC_YERPS RecName: Full=DNA repair protein radC homolog;
   10::219     1e-28  34%  222 aa  RADC_YERPP RecName: Full=DNA repair protein radC homolog;
   10::219     1e-28  34%  222 aa  RADC_YERPN RecName: Full=DNA repair protein radC homolog;
   10::219     1e-28  34%  222 aa  RADC_YERPG RecName: Full=DNA repair protein radC homolog;
   10::219     1e-28  34%  222 aa  RADC_YERPE RecName: Full=DNA repair protein radC homolog;
   10::219     1e-28  34%  222 aa  RADC_YERPB RecName: Full=DNA repair protein radC homolog;
   10::219     1e-28  34%  222 aa  RADC_YERPA RecName: Full=DNA repair protein radC homolog;
   10::219     1e-28  34%  222 aa  RADC_YERP3 RecName: Full=DNA repair protein radC homolog;
   12::221     1e-28  32%  225 aa  RADC_SHEAM RecName: Full=DNA repair protein radC homolog;
   16::225     1e-28  32%  228 aa  RADC_CLOBL RecName: Full=DNA repair protein radC homolog;
   16::225     1e-28  32%  228 aa  RADC_CLOBK RecName: Full=DNA repair protein radC homolog;
   16::225     1e-28  32%  228 aa  RADC_CLOBJ RecName: Full=DNA repair protein radC homolog;
   12::231     2e-28  34%  234 aa  RADC_RHOFD RecName: Full=DNA repair protein radC homolog;
   12::222     2e-28  30%  225 aa  RADC_THICR RecName: Full=DNA repair protein radC homolog;
   12::221     2e-28  35%  224 aa  RADC_AZOVD RecName: Full=DNA repair protein radC homolog;
   12::220     3e-28  35%  224 aa  RADC_PSEU5 RecName: Full=DNA repair protein radC homolog;
    8::221     3e-28  32%  224 aa  RADC_LISW6 RecName: Full=DNA repair protein radC homolog;
   16::225     3e-28  31%  228 aa  RADC_CLOBM RecName: Full=DNA repair protein radC homolog;
    8::221     4e-28  33%  224 aa  RADC_PSEHT RecName: Full=DNA repair protein radC homolog;
   12::222     5e-28  32%  225 aa  RADC_AZOSB RecName: Full=DNA repair protein radC homolog;
   18::227     6e-28  32%  233 aa  RADC_THETN RecName: Full=DNA repair protein radC homolog;
   12::221     6e-28  31%  225 aa  RADC_SHEWM RecName: Full=DNA repair protein radC homolog;
   34::228     6e-28  34%  231 aa  RADC_AQUAE RecName: Full=DNA repair protein radC homolog;
   12::220     8e-28  34%  224 aa  RADC_PSEMY RecName: Full=DNA repair protein radC homolog;
    4::218     8e-28  30%  221 aa  RADC_ERWCT RecName: Full=DNA repair protein radC homolog;
   16::235     8e-28  35%  243 aa  RADC_CYAP4 RecName: Full=DNA repair protein radC homolog;
   12::220     1e-27  33%  226 aa  RADC_PSEPK RecName: Full=DNA repair protein radC homolog;
   12::220     1e-27  33%  224 aa  RADC_PSEFS RecName: Full=DNA repair protein radC homolog;
   13::212     1e-27  32%  225 aa  RADC_BORPE RecName: Full=DNA repair protein radC homolog;
   12::221     2e-27  33%  225 aa  RADC_SHESH RecName: Full=DNA repair protein radC homolog;
   12::220     2e-27  33%  226 aa  RADC_PSEP1 RecName: Full=DNA repair protein radC homolog;
   13::224     2e-27  30%  227 aa  RADC_PELCD RecName: Full=DNA repair protein radC homolog;
   12::222     4e-27  30%  227 aa  RADC_PSYCK RecName: Full=DNA repair protein radC homolog;
   12::196     4e-27  36%  224 aa  RADC_PSE14 RecName: Full=DNA repair protein radC homolog;
   16::235     5e-27  35%  243 aa  RADC_TRIEI RecName: Full=DNA repair protein radC homolog;
   12::221     7e-27  30%  225 aa  RADC_SHEDO RecName: Full=DNA repair protein radC homolog;
   12::217     7e-27  34%  220 aa  RADC_AERS4 RecName: Full=DNA repair protein radC homolog;
   12::220     9e-27  32%  226 aa  RADC_PSEE4 RecName: Full=DNA repair protein radC homolog;
   26::226     9e-27  35%  229 aa  RADC_MOOTA RecName: Full=DNA repair protein radC homolog;
   17::199     9e-27  33%  229 aa  RADC_METAC RecName: Full=DNA repair protein radC homolog;
   12::220     2e-26  29%  226 aa  RADC_PSYWF RecName: Full=DNA repair protein radC homolog;
   12::221     2e-26  33%  226 aa  RADC_PSEPW RecName: Full=DNA repair protein radC homolog;
   13::221     3e-26  30%  225 aa  RADC_PSYIN RecName: Full=DNA repair protein radC homolog;
   12::196     3e-26  37%  224 aa  RADC_PSEU2 RecName: Full=DNA repair protein radC homolog;
   12::220     5e-26  30%  227 aa  RADC_PSYA2 RecName: Full=DNA repair protein radC homolog;
   12::218     5e-26  32%  223 aa  RADC_PELLD RecName: Full=DNA repair protein radC homolog;
   12::196     6e-26  35%  224 aa  RADC_PSESM RecName: Full=DNA repair protein radC homolog;
    2::196     6e-26  34%  224 aa  RADC_MARMS RecName: Full=DNA repair protein radC homolog;
   12::221     6e-26  32%  224 aa  RADC_ACIF5 RecName: Full=DNA repair protein radC homolog;
   12::221     6e-26  32%  224 aa  RADC_ACIF2 RecName: Full=DNA repair protein radC homolog;
   12::220     1e-25  32%  224 aa  RADC_PSEPF RecName: Full=DNA repair protein radC homolog;
   23::224     1e-25  35%  227 aa  RADC_DESHY RecName: Full=DNA repair protein radC homolog;
   23::224     1e-25  35%  227 aa  RADC_DESHD RecName: Full=DNA repair protein radC homolog;
   14::225     1e-25  29%  228 aa  RADC_GEOUR RecName: Full=DNA repair protein radC homolog;
    2::221     2e-25  31%  224 aa  RADC_NITMU RecName: Full=DNA repair protein radC homolog;
   12::222     2e-25  32%  225 aa  RADC_AZOSE RecName: Full=DNA repair protein radC homolog;
   12::211     5e-25  32%  228 aa  RADC_RALEH RecName: Full=DNA repair protein radC homolog;
   12::220     7e-25  32%  225 aa  RADC_NEIG2 RecName: Full=DNA repair protein radC homolog;
   12::220     7e-25  32%  225 aa  RADC_NEIG1 RecName: Full=DNA repair protein radC homolog;
   22::221     7e-25  32%  226 aa  RADC_CARHZ RecName: Full=DNA repair protein radC homolog;
    2::221     9e-25  30%  225 aa  RADC_ALTMD RecName: Full=DNA repair protein radC homolog;
   11::221     1e-24  31%  224 aa  RADC_VIBSL RecName: Full=DNA repair protein radC homolog;
   12::212     1e-24  34%  226 aa  RADC_DECAR RecName: Full=DNA repair protein radC homolog;
   53::229     3e-24  33%  257 aa  RADC_BURCH RecName: Full=DNA repair protein radC homolog;
   53::229     3e-24  33%  257 aa  RADC_BURCC RecName: Full=DNA repair protein radC homolog;
   53::229     3e-24  33%  257 aa  RADC_BURCA RecName: Full=DNA repair protein radC homolog;
   44::252     3e-24  34%  258 aa  RADC_BURVG RecName: Full=DNA repair protein radC homolog;
   11::221     4e-24  30%  224 aa  RADC_VIBPA RecName: Full=DNA repair protein radC homolog;
   35::222     6e-24  30%  225 aa  RADC_VARPS RecName: Full=DNA repair protein radC homolog;
   12::221     6e-24  28%  224 aa  RADC_HAHCH RecName: Full=DNA repair protein radC homolog;
   14::229     6e-24  29%  232 aa  RADC_FUSNN RecName: Full=DNA repair protein radC homolog;
   16::235     7e-24  33%  243 aa  RADC_NOSP7 RecName: Full=DNA repair protein radC homolog;
   12::220     1e-23  32%  224 aa  RADC_PSEF5 RecName: Full=DNA repair protein radC homolog;
   16::235     1e-23  33%  243 aa  RADC_ANAVT RecName: Full=DNA repair protein radC homolog;
   11::221     2e-23  30%  224 aa  RADC_VIBHB RecName: Full=DNA repair protein radC homolog;
   16::235     2e-23  33%  243 aa  RADC_ANASP RecName: Full=DNA repair protein radC homolog;
   12::221     4e-23  30%  225 aa  RADC_XANCP RecName: Full=DNA repair protein radC homolog;
   12::221     4e-23  30%  225 aa  RADC_XANC8 RecName: Full=DNA repair protein radC homolog;
   12::221     4e-23  27%  224 aa  RADC_IDILO RecName: Full=DNA repair protein radC homolog;
   13::219     5e-23  29%  224 aa  RADC_SILPO RecName: Full=DNA repair protein radC homolog;
    6::224     5e-23  29%  227 aa  RADC_SERP5 RecName: Full=DNA repair protein radC homolog;
   12::221     5e-23  31%  224 aa  RADC_NITOC RecName: Full=DNA repair protein radC homolog;
   12::221     8e-23  32%  225 aa  RADC_XANC5 RecName: Full=DNA repair protein radC homolog;
   53::223     1e-22  34%  257 aa  RADC_BURS3 RecName: Full=DNA repair protein radC homolog;
   12::221     1e-22  30%  224 aa  RADC_ALHEH RecName: Full=DNA repair protein radC homolog;
   12::213     2e-22  30%  223 aa  RADC_THISH RecName: Full=DNA repair protein radC homolog;
   14::226     2e-22  28%  229 aa  RADC_PELPD RecName: Full=DNA repair protein radC homolog;
   12::221     2e-22  31%  225 aa  RADC_XANAC RecName: Full=DNA repair protein radC homolog;
   12::220     2e-22  34%  226 aa  RADC_LARHH RecName: Full=DNA repair protein radC homolog;
   27::229     3e-22  33%  234 aa  RADC_SYMTH RecName: Full=DNA repair protein radC homolog;
   16::235     4e-22  33%  243 aa  RADC_ACAM1 RecName: Full=DNA repair protein radC homolog;
   51::257     5e-22  28%  262 aa  RADC_RHIME RecName: Full=DNA repair protein radC homolog;
   12::217     5e-22  30%  224 aa  RADC_ALCBS RecName: Full=DNA repair protein radC homolog;
    3::209     9e-22  29%  214 aa  RADC_RHOCA RecName: Full=DNA repair protein radC homolog;
   12::221     1e-21  27%  225 aa  RADC_SHEB9 RecName: Full=DNA repair protein radC homolog;
   12::221     1e-21  27%  225 aa  RADC_SHEB5 RecName: Full=DNA repair protein radC homolog;
   12::221     1e-21  27%  225 aa  RADC_SHEB2 RecName: Full=DNA repair protein radC homolog;
   15::220     1e-21  33%  225 aa  RADC_METHJ RecName: Full=DNA repair protein radC homolog;
   12::221     2e-21  27%  225 aa  RADC_SHEB8 RecName: Full=DNA repair protein radC homolog;
   12::220     2e-21  27%  226 aa  RADC_PSEPG RecName: Full=DNA repair protein radC homolog;
   13::212     2e-21  28%  225 aa  RADC_BORPA RecName: Full=DNA repair protein radC homolog;
   13::212     2e-21  28%  225 aa  RADC_BORBR RecName: Full=DNA repair protein radC homolog;
   12::220     2e-21  29%  224 aa  RADC_XYLFT RecName: Full=DNA repair protein radC homolog;
   12::221     3e-21  27%  225 aa  RADC_SHESW RecName: Full=DNA repair protein radC homolog;
   12::221     3e-21  27%  225 aa  RADC_SHEPC RecName: Full=DNA repair protein radC homolog;
   12::220     3e-21  29%  224 aa  RADC_XYLFA RecName: Full=DNA repair protein radC homolog;
   52::260     3e-21  29%  263 aa  RADC_PARDP RecName: Full=DNA repair protein radC homolog;
   12::221     4e-21  27%  225 aa  RADC_SHESR RecName: Full=DNA repair protein radC homolog;
   12::221     4e-21  27%  225 aa  RADC_SHESA RecName: Full=DNA repair protein radC homolog;
   12::221     4e-21  27%  225 aa  RADC_SHEON RecName: Full=DNA repair protein radC homolog;
   12::221     6e-21  27%  225 aa  RADC_SHESM RecName: Full=DNA repair protein radC homolog;
   64::270     8e-21  27%  275 aa  RADC_RHILW RecName: Full=DNA repair protein radC homolog;
   63::269     1e-20  27%  274 aa  RADC_RHIE6 RecName: Full=DNA repair protein radC homolog;
   12::235     1e-20  31%  238 aa  RADC_DIAST RecName: Full=DNA repair protein radC homolog;
   12::222     1e-20  28%  234 aa  RADC_STRM5 RecName: Full=DNA repair protein radC homolog;
   13::222     2e-20  31%  225 aa  RADC_BORA1 RecName: Full=DNA repair protein radC homolog;
   12::222     2e-20  28%  234 aa  RADC_STRMK RecName: Full=DNA repair protein radC homolog;
   64::270     2e-20  26%  275 aa  RADC_RHIL3 RecName: Full=DNA repair protein radC homolog;
   21::199     2e-20  30%  229 aa  RADC_METMA RecName: Full=DNA repair protein radC homolog;
   39::245     4e-20  27%  250 aa  RADC_RHOP2 RecName: Full=DNA repair protein radC homolog;
   63::269     4e-20  27%  274 aa  RADC_RHIEC RecName: Full=DNA repair protein radC homolog;
   12::223     4e-20  26%  228 aa  RADC_CUPTR RecName: Full=DNA repair protein radC homolog;
   49::255     5e-20  28%  260 aa  RADC_SINMW RecName: Full=DNA repair protein radC homolog;
   52::258     5e-20  26%  263 aa  RADC_RHISN RecName: Full=DNA repair protein radC homolog;
   12::234     6e-20  31%  237 aa  RADC_ACIAC RecName: Full=DNA repair protein radC homolog;
   13::217     8e-20  27%  227 aa  RADC_LEGPH RecName: Full=DNA repair protein radC homolog;
   13::217     8e-20  25%  227 aa  RADC_LEGPC RecName: Full=DNA repair protein radC homolog;
   13::217     1e-19  26%  227 aa  RADC_LEGPA RecName: Full=DNA repair protein radC homolog;
   13::217     1e-19  25%  227 aa  RADC_LEGPL RecName: Full=DNA repair protein radC homolog;
   12::220     2e-19  27%  224 aa  RADC_THIDA RecName: Full=DNA repair protein radC homolog;
   36::223     3e-19  29%  227 aa  RADC_RUBXD RecName: Full=DNA repair protein radC homolog;
   35::244     3e-19  28%  249 aa  RADC_OCHA4 RecName: Full=DNA repair protein radC homolog;
    2::221     3e-19  26%  224 aa  RADC_CHRVO RecName: Full=DNA repair protein radC homolog;
   49::258     9e-19  28%  262 aa  RADC_BURTA RecName: Full=DNA repair protein radC homolog;
   12::221     1e-18  27%  225 aa  RADC_XANOM RecName: Full=DNA repair protein radC homolog;
   12::221     2e-18  27%  225 aa  RADC_XANOR RecName: Full=DNA repair protein radC homolog;
   12::221     2e-18  27%  225 aa  RADC_XANOP RecName: Full=DNA repair protein radC homolog;
   12::221     3e-18  27%  224 aa  RADC_CHRSD RecName: Full=DNA repair protein radC homolog;
    1::229     3e-18  30%  233 aa  RADC_SALRD RecName: Full=DNA repair protein radC homolog;
   65::274     5e-18  28%  278 aa  RADC_BURP6 RecName: Full=DNA repair protein radC homolog;
   65::274     5e-18  28%  278 aa  RADC_BURP1 RecName: Full=DNA repair protein radC homolog;
   65::274     5e-18  28%  278 aa  RADC_BURP0 RecName: Full=DNA repair protein radC homolog;
   65::274     5e-18  28%  278 aa  RADC_BURMS RecName: Full=DNA repair protein radC homolog;
   65::274     5e-18  28%  278 aa  RADC_BURMA RecName: Full=DNA repair protein radC homolog;
   65::274     5e-18  28%  278 aa  RADC_BURM9 RecName: Full=DNA repair protein radC homolog;
   65::274     5e-18  28%  278 aa  RADC_BURM7 RecName: Full=DNA repair protein radC homolog;
   44::252     6e-18  29%  258 aa  RADC_BURA4 RecName: Full=DNA repair protein radC homolog;
   16::221     1e-17  30%  224 aa  RADC_HALHL RecName: Full=DNA repair protein radC homolog;
   44::252     1e-17  29%  258 aa  RADC_BURCM RecName: Full=DNA repair protein radC homolog;
  102::275     3e-17  26%  280 aa  RADC_AGRT5 RecName: Full=DNA repair protein radC homolog;
   64::244     4e-17  27%  249 aa  RADC_BRUSU RecName: Full=DNA repair protein radC homolog;
   64::244     4e-17  27%  249 aa  RADC_BRUME RecName: Full=DNA repair protein radC homolog;
   64::244     4e-17  27%  249 aa  RADC_BRUMB RecName: Full=DNA repair protein radC homolog;
   64::244     4e-17  27%  249 aa  RADC_BRUC2 RecName: Full=DNA repair protein radC homolog;
   64::244     4e-17  27%  249 aa  RADC_BRUAB RecName: Full=DNA repair protein radC homolog;
   64::244     4e-17  27%  249 aa  RADC_BRUA2 RecName: Full=DNA repair protein radC homolog;
   64::244     4e-17  27%  249 aa  RADC_BRUA1 RecName: Full=DNA repair protein radC homolog;
   12::220     5e-17  24%  224 aa  RADC_POLNA RecName: Full=DNA repair protein radC homolog;
   42::226     1e-16  28%  233 aa  RADC_ROSCS RecName: Full=DNA repair protein radC homolog;
   12::233     3e-16  27%  237 aa  RADC_VEREI RecName: Full=DNA repair protein radC homolog;
   66::219     6e-16  28%  222 aa  RADC_LEPCP RecName: Full=DNA repair protein radC homolog;
   42::201     8e-15  31%  233 aa  RADC_ROSS1 RecName: Full=DNA repair protein radC homolog;
   12::235     2e-14  27%  238 aa  RADC_ACISJ RecName: Full=DNA repair protein radC homolog;
   12::220     1e-13  22%  224 aa  RADC_POLSJ RecName: Full=DNA repair protein radC homolog;
    8::219     1e-13  23%  222 aa  RADC_METPP RecName: Full=DNA repair protein radC homolog;
   41::156     2e-13  31%  160 aa  YFJY_ECOLI RecName: Full=Putative radC-like protein yfjY;
   36::221     3e-13  25%  225 aa  RADC_BORPD RecName: Full=DNA repair protein radC homolog;
   11::149     1e-12  31%  158 aa  Y1786_VIBCH RecName: Full=Putative radC-like protein VC_1786;
   39::154     9e-11  28%  158 aa  YKFG_ECOLI RecName: Full=Putative radC-like protein ykfG;
   50::143     6e-10  30%  157 aa  Y510_VIBCH RecName: Full=Putative radC-like protein VC_0510;
   45::144     4e-08  29%  148 aa  YEES_ECOLI RecName: Full=Putative radC-like protein yeeS;
  527::622     1e-04  27%  720 aa  DNLJ_AQUAE RecName: Full=DNA ligase;         EC=6.5.1.2;AltName:
    1::226

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MYSISFQEDSLLPRERLAKEGVEALSNQELLAILLRTGTRQASVFEIAQKVLNNLSSLTDLKKMTLQELQ
RADC_STRZT      MYSISFQEDSLLPRERLAKEGVEALSNQELLAILLRTGTRQASVFEIAQKVLNNLSSLTDLKKMTLQELQ
RADC_STRZP      MYSISFQEDSLLPRERLAKEGVEALSNQELLAILLRTGTRQASVFEIAQKVLNNLSSLTDLKKMTLQELQ
RADC_STRPN      MYSISFQEDSLLPRERLAKEGVEALSNQELLAILLRTGTRQASVFEIAQKVLNNLSSLTDLKKMTLQELQ
RADC_STRPJ      MYSISFQEDSLLPRERLAKEGVEALSNQELLAILLRTGTRQASVFEIAQKVLNNLSSLTDLKKMTLQELQ
RADC_STRPI      MYSISFQEDSLLPRERLAKEGVEALSNQELLAILLRTGTRQASVFEIAQKVLNNLSSLTDLKKMTLQELQ
RADC_STRP7      MYSISFQEDSLLPRERLAKEGVEALSNQELLAILLRTGTRQASVFEIAQKVLNNLSSLTDLKKMTLQELQ
RADC_STRP4      MYSISFQEDSLLPRERLAKEGVEALSNQELLAILLRTGTRQASVFEIAQKVLNNLSSLTDLKKMTLQELQ
RADC_STRR6      MYSISFQEDSLLPRERLAKEGVEALSNQELLAILLRTGTRQASVFEIAQKVLNNLSSLTDLKKMTLQELQ
RADC_STRP2      MYSISFQEDSLLPRERLAKEGVEALSNQELLAILLRTGTRQASVFEIAQKVLNNLSSLTDLKKMTLQELQ
RADC_STRZJ      MYSISFQEDSLLPRERLAKEGVEALSNQELLAILLRTGTRQVSVFEIAQKVLNNLSSLTDLKKMTLQELQ
RADC_STRGC      MYSISFQEESLLPRERLVRLGAEQLSNQELLSILIRTGNKKENVFQIASKILSSVSSLTELRHMTLSELQ
RADC_STRSV      MYSISFQDDSMMPRERLMREGAEKLSNQELLSIFLRTGNKKETVFQVSQRILSSISSLNDLKYLTLQELQ
RADC_STRS2      MYQIEFKEEAFLPRERLVEVGAERLSNQELLAIFIRTGTKKEPVSILSNKLLNRLESLAALRELSIEELQ
RADC_STRA5      MYHIELKKEALLPRERLVDLGADRLSNQELLAILLRTGIKEKPVLEISTQILENISSLADFGQLSLQELQ
RADC_STRA1      MYHIELKKEALLPRERLVDLGADRLSNQELLAILLRTGIKEKPVLEISTQILENISSLADFGQLSLQELQ
RADC_STRA3      MYHIELKKEALLPRERLVDLGADRLSNQELLAILLRTGIKEKPVLEISTQILENISSLADFGQLSLQELQ
RADC_STRU0      MYAVKLNKDTLLPREKLVQYGVEQLSHQELLAILLRTGNKEKHVMELASHILHCLESLADFDKLSLQELQ
RADC_STRTD      MYSIVAEESGLLPRERLLQKGAEVLSDQELLAIVLRTGTRSESVLSMANRILKGMTSLADLSRLSLNELQ
RADC_STRT2      MYSIVAEESGLLPRERLLQKGAEVLSDQELLAIVLRTGTRSESVLSMANRILKGMTSLADLSRLSLNELQ
RADC_STRT1      MYSIVAEESGLLPRERLLQKGAEVLSDQELLAIVLRTGTKSESVLSMANRILKGMTSLADLSRLSLNELQ
RADC_STRPZ      MYSIKCDDNKAMPRERLMRLGAESLSNQELLAILLRTGNKEKHVXXXXXXXXXXXXXXADFKKMSLQELQ
RADC_STRPM      MYSIKCDDNKAMPRERLMRLGAESLSNQELLAILLRTGNKEKHVXXXXXXXXXXXXXXADFKKMSLQELQ
RADC_STRPG      MYSIKCDDNKAMPRERLMRLGAESLSNQELLAILLRTGNKEKHVXXXXXXXXXXXXXXADFKKMSLQELQ
RADC_STRPF      MYSIKCDDNKAMPRERLMRLGAESLSNQELLAILLRTGNKEKHVXXXXXXXXXXXXXXADFKKMSLQELQ
RADC_STRPD      MYSIKCDDNKAMPRERLMRLGAESLSNQELLAILLRTGNKEKHVXXXXXXXXXXXXXXADFKKMSLQELQ
RADC_STRPC      MYSIKCDDNKAMPRERLMRLGAESLSNQELLAILLRTGNKEKHVXXXXXXXXXXXXXXADFKKMSLQELQ
RADC_STRPB      MYSIKCDDNKAMPRERLMRLGAESLSNQELLAILLRTGNKEKHVXXXXXXXXXXXXXXADFKKMSLQELQ
RADC_STRP8      MYSIKCDDNKAMPRERLMRLGAESLSNQELLAILLRTGNKEKHVXXXXXXXXXXXXXXADFKKMSLQELQ
RADC_STRP1      MYSIKCDDNKAMPRERLMRLGAESLSNQELLAILLRTGNKEKHVXXXXXXXXXXXXXXADFKKMSLQELQ
RADC_STRP6      MYSIKCDDNKAMPRERLMRLGAESLSNQELLAILLRTGNKEKHVXXXXXXXXXXXXXXADFKKMSLQELQ
RADC_STRP3      MYSIKCDDNKVMPRERLMRLGAESLSNQELLAILLRTGNKEKHVXXXXXXXXXXXXXXADFKKMSLQELQ
RADC_STRS7      MYSIK-TDHKLMPRERLIRLGPEKLSNQELLAILLRTGNKEKHVXXXXXXXXXXXXXXXXXXXXXXQELQ
RADC_STREM      MYSIK-TDHKLMPRERLIRLGPEKLSNQELLAILLRTGNKEKHVXXXXXXXXXXXXXXXXXXXXXXQELQ
RADC_STRE4      MYSIK-TDHKLMPRERLIRLGPEKLSNQEQLAILLRTGNKEKHVXXXXXXXXXXXXXXXXXXXXXXQELQ
RADC_ENTFA      -----------LPRERLLAIGEKALSNQELLAILLRTGSKEADVMTVAATLLKQFKQLSYLQQATLNELM
RADC_LACLA      MYELKENPYPMQPRERLEFLGEECLSDVELLAILLRTGTKKYSSLNLALEILQHFETLDNLRKASINELR
RADC_GEOKA      ------------PRERLLSSGPESLSDHELIAILLRTGTKEESVVQLAQRLLRHFEGLRPLKDATVEEMT
RADC_GEOTN      ------------PRERLLASGPESLSDHELLAILLRTGTKDESVVQLAQRVLQHFEGLRLLKDATVEEMT
RADC_LACSS      -------QSKLQPREQVALYGAASLSDEQLATVILRSGTQHLPVEVVAQRLLQRYPDFQDLEQADLVQLR
RADC_BACSK      ------------PRERFIREGAKALSNQEIVAILLRTGTKQSSALHVASTLLSQFPTLAMFSEAPLEEIQ
RADC_BACLD      --------DEERPRERLLNTGAESLSNHELLAILLRTGTKKESVLQLSSRLLQTFDGLRLLKEASAEELS
RADC_BACSU      ------------PRERLLKVGAENLANHELLAILLRTGTKHESVLDLSNRLLRSFDGLRLLKEASVEELS
RADC_BACHD      ------------PRERLLHEGAHALSNQEIVAIMLRTGTKNESVLQLAQHVLCHFDGLRLLREATVEELT
RADC_BACA2      ------------PRERLLHFGAEHLSNNELLAILLRTGTKHESVMNLAHRLLRTFDGLRLLKGASAQELS
RADC_GEOSW      ------------PRERLLSSGPESLADHELLAILLRTGTKEESVLQLAHRLLKHFEGLRLLKDATIEEIT
RADC_BACHK      ------------PRERLLLEGAGSLSNRELLAVLLRTGSKEESVLKLSDKILHHFDGLRMLKDATLEELV
RADC_BACC3      ------------PRERLLLEGAGSLSNRELLAVLLRTGSKEESVLKLSDKILHHFDGLRMLKDATLEELV
RADC_BACAN      ------------PRERLLLEGAGSLSNRELLAVLLRTGSKEESVLKLSDKILHHFDGLRMLKDATLEELV
RADC_BACAC      ------------PRERLLLEGAGSLSNRELLAVLLRTGSKEESVLKLSDKILHHFDGLRMLKDATLEELV
RADC_BACAA      ------------PRERLLLEGAGSLSNRELLAVLLRTGSKEESVLKLSDKILHHFDGLRMLKDATLEELV
RADC_LACLM      MYELKEKSYPMQPXXXXXXXXXXXXSDVELLAILLRTGRKKYSSLNLALELLQHFGTLDNFRKASISELK
RADC_BACCZ      ------------PRERLLLEGAGSLSNRELLAVLLRTGSKEESVLKLSDKILHHFDGLRMLKDATLEELV
RADC_BACCQ      ------------PRERLLLEGAGSLSNRELLAVLLRTGSKDETVLKLSDKILHHFDGLRMLKDATLEELV
RADC_BACC7      ------------PRERLLLEGAGSLSNRELLAVLLRTGSKDETVLKLSDKILHHFDGLRMLKDATLEELV
RADC_BACC1      ------------PRERLLLEGAGSLSNRELLAVLLRTGSKEETVLKLSDKILHHFDGLRMLKDATLEELV
RADC_STAES      ------------PRERLITYGAKSLSNVELLAILLNTGRKGFSSIDIANELLKQQSTIRDLKKLSINDLL
RADC_BACP2      ------------PRERFIKYGPSSLSNHELVAILLRTGTKKESVLQISARLLQTFGGLRSVREATIEEMS
RADC_BACC2      --------------------GAGSLSNRELLAVLLRTGSKEETVLKLSDKILHQFDGLRMLKDATLEELI
RADC_BACC4      --------------------GAGSLSNRELLAVLLRTGSKEETVLKLSDKILHQFDGLRMLKDATLEELI
RADC_THEMA      ----------LLPRERMIKAGPESLSVEELVAIVLRTGKKGKHVLELSKDLLERFDSLIKLSNASLEEIA
RADC_THEP1      ---------SLLPRERMIKAGPESLSVEELVAIVLRTGKKGKHVLELSKDLLERFDSLIKLSNAGLEEIA
RADC_CHLP8      ------------PRERFLRSGKEALSPAELLALILRSGTPNLNIIDTCNQLIAE-HSLEGLADLSLHELQ
RADC_BACWK      --------------------GAGSLSNRELLAVLLRTGSKEETVLTLSDNILHHFDGLRMLKDATLEEMM
RADC_STAHJ      ---------SELPRERLIHNGAKSLSNSELLAILINTGRHGFSSLDIANELLISFNGLKELKHLSINDLT
RADC_CLOK5      ------------PRERLFRYGSEALSNSELLAVILGTGIKGENIVSLSNRIIKDNGGLNGIFNSDLEDFV
RADC_CLOK1      ------------PRERLFRYGSEALSNSELLAVILGTGIKGENIVSLSNRIIKDNGGLNGIFNSDLEDFV
RADC_PROA2      ------------PRERFLRSGVSALSSAELMALILKTGTKKHNIIETCQEMLS-IYGLEKLADLSLAELQ
RADC_CHLTE      ------------PRERFLRSGKESLSPAELLALILRSGTAGLNIIDTCNKLISE-HGLERLADLSIQELQ
RADC_PROVI      ------------PRERFIAHGPAALSSAELLAIVLRTGTRKNNILDTCNTLLS-LHGLEALANMNLKELQ
RADC_ALKMQ      ------------PREKLLNYGPESLSNPELLAIILSTGTKEMSAIDLATHVLSSEEGLRHLKNCEIEELQ
RADC_PELPB      ------------PRERLLRSGAASLSPAELLAIILRTGTKNLNIVDTCNELIARYS-LEKLANITLEELK
RADC_FLAJ1      ------------PREKLMLKGKEALSDAELMAILIGSGSRNESAVALSQRILASAKNLNSLWKMSVSQLI
RADC_CLOTE      ------------PREKLTRYGVESLSNIELLALILRTGNKSENVISLCARILERCGGLNGLFNANRGELL
RADC_LISMH      ------------PREKLLNYGIESLSSSELVALIIETGTKNESVLTIANRIIMKFKNVAEMQYASIEEFQ
RADC_CLOPS      ------------PREKLLFYGAQCLSNEELLAIILRTGNKDSNVVELSYRIIHSVGGLNGLFKASAKELM
RADC_CLOAB      ------------PRERLLRYGSEVLSNSELLAIILRTGTLHENIINLSSRILKESGGLNGVLNLSFEELK
RADC_LISMO      ------------PREKLQNYGIEALSSSELVALIIETGTKNESVLTIANRIIMKFKNVGEMQYASIEEFQ
RADC_LISMF      ------------PREKLQNYGIEALSSSELVALIIETGTKNESVLTIANRIIMKFKNVGEMQYASIEEFQ
RADC_LISMC      ------------PREKLQNYGIEALSSSELVALIIETGTKNESVLTIANRIIMKFKNVGEMQYASIEEFQ
RADC_CLOPE      ------------PREKLLFYGAQFLSNEELLAIILRTGNKDSNVVELSYRIIHSVGGLNGLFKASAKELM
RADC_CLOP1      ------------PREKLLFYGAQFLSNEELLAIILRTGNKDSNVVELSYRIIHSVGGLNGLFKASAKELM
RADC_SALAR      --------DELLPREKMLRSGIASLSDVELLALFLRTGTPGKDVITLAKEMLQRFGSLYGLLSADFAQFR
RADC_ENT38      -------ELTLLPREKMLSFGITSLTDAELLALFLRTGTSGKSVFVLAQELLQHFGSLHGLLNANLDEFR
RADC_ACTPJ      ----------LMPREKLLASGAESLTDQELLAIFLRTGIKGMPVMQLSQEVLNGFGSLRELLSADLATFC
RADC_ACTP7      ----------LMPREKLLASGAESLTDQELLAIFLRTGIKGMPVMQLSQEVLNGFGSLRELLSADLATFC
RADC_ACTP2      ----------LMPREKLLASGAESLTDQELLAIFLRTGIKGMPVMQLSQEVLNGFGSLRELLSADLATFC
RADC_LISIN      ------------PREKLQNYGIEALSTSELVALIIETGTKTESVLTIANRIMMKFKHIAEMQYASIEEFQ
RADC_FINM2      --------ESLRPREKMKINGISSMSDEELMQIILKTGIKEEGVEILSKRVIDYINE-NDYKDLCVEELM
RADC_CLOBA      ------------PKEKLLSYGADTLNNSELLAIILRTGTKGENVLQLSNRLLSEFQGLDGILEASLDDIT
RADC_SYNWW      --NIKEMPETMRPREKLIARGEDKLDEAELLAIVLGSGTREMNALELARQLLRHGGSLRFLMSATLEELT
RADC_SALTY      --------DELLPREKMLRSGIASLSDVELLALFLRTGTPGKDVMTLAKEILQHFGSLYGLLSADFAQFR
RADC_SALTI      --------DELLPREKMLRSGIASLSDVELLALFLRTGTPGKDVMTLAKEILQHFGSLYGLLSADFAQFR
RADC_SALSV      --------DELLPREKMLRSGIASLSDVELLALFLRTGTPGKDVMTLAKEILQHFGSLYGLLSADFAQFR
RADC_SALPK      --------DELLPREKMLRSGIASLSDVELLALFLRTGTPGKDVMTLAKEILQHFGSLYGLLSADFAQFR
RADC_SALPC      --------DELLPREKMLRSGIASLSDVELLALFLRTGTPGKDVMTLAKEILQHFGSLYGLLSADFAQFR
RADC_SALPA      --------DELLPREKMLRSGIASLSDVELLALFLRTGTPGKDVMTLAKEILQHFGSLYGLLSADFAQFR
RADC_SALHS      --------DELLPREKMLRSGIASLSDVELLALFLRTGTPGKDVMTLAKEILQHFGSLYGLLSADFAQFR
RADC_SALG2      --------DELLPREKMLRSGIASLSDVELLALFLRTGTPGKDVMTLAKEILQHFGSLYGLLSADFAQFR
RADC_SALEP      --------DELLPREKMLRSGIASLSDVELLALFLRTGTPGKDVMTLAKEILQHFGSLYGLLSADFAQFR
RADC_SALDC      --------DELLPREKMLRSGIASLSDVELLALFLRTGTPGKDVMTLAKEILQHFGSLYGLLSADFAQFR
RADC_SALCH      --------DELLPREKMLRSGIASLSDVELLALFLRTGTPGKDVMTLAKEILQHFGSLYGLLSADFAQFR
RADC_SALA4      --------DELLPREKMLRSGIASLSDVELLALFLRTGTPGKDVMTLAKEILQHFGSLYGLLSADFAQFR
RADC_COPPD      ------------PRELLLSKGPEHLPDAKLLAIILRTGNKEETAEDLARRLLNTFGGFTGLYRASVEELL
RADC_ECOHS      ----------LMPREKMLKFGISALTDVELLALFLRTGTRGKDVLTLAKEMLENFGSLYGLLTSEYEQFS
RADC_SHIFL      ----------LMPREKMLKFGISALTDVELLALFLRTGTRGKDVLTLAKEMLENFGSLYGLLTSEYEQFS
RADC_SHIF8      ----------LMPREKMLKFGISALTDVELLALFLRTGTRGKDVLTLAKEMLENFGSLYGLLTSEYEQFS
RADC_SHIDS      ----------LMPREKMLKFGISALTDVELLALFLRTGTRGKDVLTLAKEMLENFGSLYGLLTSEYEQFS
RADC_SHIBS      ----------LMPREKMLKFGISALTDVELLALFLRTGTRGKDVLTLAKEMLENFGSLYGLLTSEYEQFS
RADC_SALNS      --------DELLPREKMLRSGIASLSDVELLALFLRTGTPGKDVMTLAKEILQHFGSLYGLLSADFAQFR
RADC_ESCF3      ----------LMPREKMLKFGISALTDVELLALFLRTGTRGKDVLTLAKEMLENFGSLYGLLTSEYEQFS
RADC_ECOUT      ----------LMPREKMLKFGISALTDVELLALFLRTGTRGKDVLTLAKEMLENFGSLYGLLTSEYEQFS
RADC_ECOSM      ----------LMPREKMLKFGISALTDVELLALFLRTGTRGKDVLTLAKEMLENFGSLYGLLTSEYEQFS
RADC_ECOLU      ----------LMPREKMLKFGISALTDVELLALFLRTGTRGKDVLTLAKEMLENFGSLYGLLTSEYEQFS
RADC_ECOLI      ----------LMPREKMLKFGISALTDVELLALFLRTGTRGKDVLTLAKEMLENFGSLYGLLTSEYEQFS
RADC_ECOL6      ----------LMPREKMLKFGISALTDVELLALFLRTGTRGKDVLTLAKEMLENFGSLYGLLTSEYEQFS
RADC_ECOL5      ----------LMPREKMLKFGISALTDVELLALFLRTGTRGKDVLTLAKEMLENFGSLYGLLTSEYEQFS
RADC_ECOK1      ----------LMPREKMLKFGISALTDVELLALFLRTGTRGKDVLTLAKEMLENFGSLYGLLTSEYEQFS
RADC_ECODH      ----------LMPREKMLKFGISALTDVELLALFLRTGTRGKDVLTLAKEMLENFGSLYGLLTSEYEQFS
RADC_ECOBW      ----------LMPREKMLKFGISALTDVELLALFLRTGTRGKDVLTLAKEMLENFGSLYGLLTSEYEQFS
RADC_ECO8A      ----------LMPREKMLKFGISALTDVELLALFLRTGTRGKDVLTLAKEMLENFGSLYGLLTSEYEQFS
RADC_ECO81      ----------LMPREKMLKFGISALTDVELLALFLRTGTRGKDVLTLAKEMLENFGSLYGLLTSEYEQFS
RADC_ECO7I      ----------LMPREKMLKFGISALTDVELLALFLRTGTRGKDVLTLAKEMLENFGSLYGLLTSEYEQFS
RADC_ECO5E      ----------LMPREKMLKFGISALTDVELLALFLRTGTRGKDVLTLAKEMLENFGSLYGLLTSEYEQFS
RADC_ECO57      ----------LMPREKMLKFGISALTDVELLALFLRTGTRGKDVLTLAKEMLENFGSLYGLLTSEYEQFS
RADC_ECO55      ----------LMPREKMLKFGISALTDVELLALFLRTGTRGKDVLTLAKEMLENFGSLYGLLTSEYEQFS
RADC_ECO45      ----------LMPREKMLKFGISALTDVELLALFLRTGTRGKDVLTLAKEMLENFGSLYGLLTSEYEQFS
RADC_ECO27      ----------LMPREKMLKFGISALTDVELLALFLRTGTRGKDVLTLAKEMLENFGSLYGLLTSEYEQFS
RADC_ECO24      ----------LMPREKMLKFGISALTDVELLALFLRTGTRGKDVLTLAKEMLENFGSLYGLLTSEYEQFS
RADC_CLOBB      ------------PKEKLLSYGADTLNNSELLAIILRTGTKGENVLQLSNRLLSKFQGLDGVLEASLDDIT
RADC_SYNP2      ------------PRERLVAVGAKYLSNAELIAILISTGDRHRSAVGLAQFILQTCSQFDMLRHTTPQELT
RADC_HAEIE      --------DDLMPREKLLASGAKALSDYELLAIFLRTGIKGCPVISLSKNVLTHFGSLHALLSSDKKAFC
RADC_ALKOO      ------------PREKLLSFGSQSLSNAELLAIILSTGTKDRTAIDLARSILNSTEGLRGLKDCTIEELS
RADC_KLEP3      ------ETENLMPREKMLQYGIEALTDVELLALFLRVGTRRQDVLSYAQALLQRFGSLYALLSADKAQLI
RADC_CLONN      ------------PRERLIKYGSQALSNSELIAIILGTGGRNENVLSLSSRILKQCEGLNGLLTLTPEEIM
RADC_STAS1      ------------PRERMLNYGASHLSHAELLAILINTGRKGYSSLDIANELLKSIVNLKELKHLSINDLN
RADC_NITEC      --AISDWPEAERPREKLIQKGATVLSDAELLAIFLRTGITGKSAVELARNLLTHFGSLTKLCAANLHEFS
RADC_HAEI8      --------DELMPREKLLAFGAKALSDYELLAIFLRTGIKDCPVMSLSKNVLTHFGSLHALLSADKKAFC
RADC_CHLSY      ------------PRERLARQGAGALSDAELLAILLRVGTNGTNVLQLAQQLLAESGGLQGLQRLDFQELC
RADC_CHLAA      ------------PRERLARQGAGALSDAELLAILLRVGTNGTNVLQLAQQLLAESGGLQGLQRLDFQELC
RADC_HAES2      ------QNTTLMPREKLLKYGASSLDDKELLAIFLRTGIKNCPVMQLSELVLAHFSSLRGLINADQKHFC
RADC_HAES1      ------QNTTLMPREKLLKYGASSLDDKELLAIFLRTGIKNCPVMQLSELVLAHFSSLRGLINADQKHFC
RADC_SHIB3      ----------LMPREKMLKFGISALTDVELLALFLRTGTRGKDVLTLAKEMLENFGSLYGLLTSEYEQFS
RADC_NITEU      --AISDWPEAERPREKLIEKGAAALSDAELLAIFLRTGITGVSAVELARKLLTHFGSLTKLCAASLHEFS
RADC_ACTSZ      ------ENQSLMPREKLLKSGAETLENYELLAIFLRTGIKNCPVIQLSQAVLRYFGSLRGLISADQEQFC
RADC_PASMU      ---------SLMPREKLLRFGAPALTDEELLAIFLRTGIKGCSVMQLSRHVLQHFHSLRGLMSATQTEFC
RADC_METBU      ------------PRERLLKHGPGFLSNAELLSVILRTGSKDENVVSMSSRILSEYN-LKQLSQANISQLT
RADC_KLEP7      --------ENLMPREKMLQYGIETLTDVELLALFLRVGTRRQDVLSYAQALLQRFGSLYALLSADKAQLI
RADC_PORGI      ------------PREKMIRLGARCLTDAELLAILIGSGNDRQTAIQLAQEILAKMNSLPRLAKCDIQELT
RADC_MICAN      ------------PRERLISVGAKNLSNAELLAILLATGQGKGSAVGLGQHILNELSKLDVLRDIHPQELT
RADC_STACT      ------------PKEKLIAKGAAHLADSELLAILINTGRKGHSSIEVAQDLIKMARSLKELKLLSLNDIM
RADC_HAEDU      ----------LMPREKLLTYGANALTDQELLAIFLRTGIKGLPVMQLANQVLTTFGSLRALLTADLNAFC
RADC_CLOB8      ------------PKEKLLTYGAESLSNSELLAIIIRTGTQGENVLQLCSRLLSELEGLNGILDASFDDII
RADC_ENTS8      ------------PREKLMRYGAADLSDEELLAIFLRTGTPGMDVMTLAKRLLAHFGSLYGLLSADIRPFR
RADC_HAEIN      --------DELMPREKLLAFGAKALSDYELLAIFLRTGIKGCPVMSLSKNVLTHFGPLHALLSADKKAFC
RADC_ACIBT      ------------PRERLLQQGPQSLSDSELLAIFLRSGSRQHSAVELARLLIQQFGSLNAVFDASYNELA
RADC_ACIB5      ------------PRERLLQQGPQSLSDSELLAIFLRSGSRQHSAVELARLLIQQFGSLNAVFDASYNELA
RADC_ACIB3      ------------PRERLLQQGPQSLSDSELLAIFLRSGSRQHSAVELARLLIQQFGSLNAVFDASYNELA
RADC_STAAW      ---------SEMPRERLLSHGAKSLSNTELLAILINTGRKGFSSIDISNELLKSASNLNELKKSSINDLI
RADC_STAAS      ---------SEMPRERLLSHGAKSLSNTELLAILINTGRKGFSSIDISNELLKSASNLNELKKSSINDLI
RADC_STAAE      ---------SEMPRERLLSHGAKSLSNTELLAILINTGRKGFSSIDISNELLKSASNLNELKKSSINDLI
RADC_STAAC      ---------SEMPRERLLSHGAKSLSNTELLAILINTGRKGFSSIDISNELLKSASNLNELKKSSINDLI
RADC_STAA8      -----------MPRERLLSHGAKSLSNTELLAILINTGRKGFSSIDISNELLKSASNLNELKKSSINDLI
RADC_STAA3      -----------MPRERLLSHGAKSLSNTELLAILINTGRKGFSSIDISNELLKSASNLNELKKSSINDLI
RADC_VIBF1      ------------PREKLLALGPKSLTDAELLAIFLRTGTQGMNAIELADKLLKEFGSLRKLLSSDENEFC
RADC_GEOSL      ------------PREKLLRRGAPVLSDAELLALIIRTGDSVTSAIDLGRALLQECGDLRTLAGATVSELC
RADC_SHEHH      ------------PREKLLNQGVKQLSDAELLAVLLRVGLKGLSAVELARTMINEFGGLRGLLAASQTQVC
RADC_DESAP      --------------------GVQSLSDAELLAILLRSGTVTTTAIDLANQILSRFGGLRGLAEAGIEELQ
RADC_CITK8      --------ERLMPREKMLKSGIGSLTDVELLALFLRTGVPGKDVMALAHETLQRSGSLYGLLSADFAQFR
RADC_CHLCH      ------------PRERFLQHGXXXXXXXXXXXXXXRSGSQQYNILDTCHHIINRFS-LEKLSDVSLKELQ
RADC_TOLAT      ------------PREKLLQRGASALSDAELLAIFLRTGVAGCNAIELARNLLQEFGSLRALLGAEQAQFC
RADC_STAAB      ---------SEMPRERLLSHGAKSLSNTELLAILINTGRKGFLSIDISNELLKSASNLNELKKSSINDLI
RADC_SHEPW      ------------PREKLLLDGAEQLSDAELLAVLLRVGLKGLSAVELARMMITEFGGLRSLLTASQAQVC
RADC_SHEPA      ------------PREKLLSQGVKQLSDAELLAVLLRVGLKGLSAVELARIMINEFGGLRSLLNASQAQVC
RADC_VIBFM      ------------PREKLLALGPKSLTDAELLAIFLRTGIQGMNAIELADKLLKEFGSLRKLLSSDENEFC
RADC_PSEA6      ------------PREKLLTQGPDALSDAELLAIFLRTGIKGLSAVDLARNLLNTFGSLRGLISASQQDFC
RADC_JANMA      ------------PRERLIKHGAAILTDAELLAIFLRLGVAGKSAVDLARDMLNHFGSLHALFSASLDDFS
RADC_HERAR      ------------PRERLIRHGAAILSDAELLAVFLRVGVTGKSAVDLGRDMVAHFGSLNGLFSATLNDFS
RADC_ALISL      ------------PREKLLALGPKSLTDAELLAIFLRTGIKGMNAIELADKLLKEFGSLRKLLGSNENEFC
RADC_METFK      ------------PREKLRAAGAMALSDAELLAIFLRTGVAGKSAVDLARELLKRFSSLNGIFAASAEEIC
RADC_VIBVY      -----------MPREKLLQRGPQSLSDAELLAIFLRTGTQGMNVIELADFLLRDFGSLRKLFSADEQSFC
RADC_VIBVU      -----------MPREKLLQRGPQSLSDAELLAIFLRTGTQGMNVIELADFLLRDFGSLRKLFSADEQSFC
RADC_PHOLL      ---------NLAPREKLLAYGSVSLTDAELLAIFLRTGTRGLPVLRMAEFLLKEFGSLYHLLSADYDTFC
RADC_CHLPB      ------------PRERFMISGVXXXXXXXXXXXIIKTGTKRKNILETCQDLINGLEKLADL---SMRELQ
RADC_ACIAD      --SIKFWPEQERPRERLLHSGPESLSDAELLAIFLRTGSKQHSAVELARLMIQHFGGLNPVFDASLQELS
RADC_CHLPD      ------------PRERFLRTGXXXXXXXXXXXXXXRSGTRNNNIIDTCNALIARFG-LERLADIPLSELQ
RADC_BURXL      -----------MPRERLIEQGASVLSDTELIVLILGSGLPGHDVFDVARTLLDRFGSLRAMLDATYTDFA
RADC_SYNY3      ------------PREKLLKYGAKHLGNAELIAILLATGQGKGKLSAVXXXXXNRQDPMDVLRNIHPQELI
RADC_PARUW      ------------PRERLIRHGADXXXXXXXXXXXXXXXXKVASVLEVSRALVTRFGGLEALMQATLTELL
RADC_CHLAD      ------------PRERLARLGAGALSDAELLAILLRVGISGTNVLQLAQQLLGEYGGWIGLQVADYNDLC
RADC_RALSO      ------------PREKLLTQGPAALSDAELLAIFLRVGMPGKSAVDLARELLAHFGSLGRLCHASRREFS
RADC_SHELP      ------------PREKLLRSGVAQLSDAELLAVLLRNGLKGQSAVSLARVMLTHFGGLRALFSASLSELC
RADC_SACD2      ------------PREKLLNRGAHALSDAELLAIFLRTGVKGKSAVDLARELLAYFGGLRPLLEASQQDFC
RADC_CYAA5      ------------PRERLMAVGAKNLATAELLAILLGTGQGKGSAVGLGHHILQELSKLDILRDISPHELM
RADC_VIBCM      -----------MPREKLLQRGPQSLSDAELLAIFLRTGTQGMNVLALADLLLRDFGSLRALFCASKEQFC
RADC_VIBCH      -----------MPREKLLQRGPQSLSDAELLAIFLRTGTQGMNVLALADLLLRDFGSLRALFCASKEQFC
RADC_VIBC3      -----------MPREKLLQRGPQSLSDAELLAIFLRTGTQGMNVLALADLLLRDFGSLRALFCASKEQFC
RADC_RALPJ      ------------PREKLLAHGPAALSDAELLAIFLRVGVPGKSAVDLARELLAHFGSLARLCHASQQEFS
RADC_PHOPR      --SLKLLPEESRPREKLLTRGAKALSDAELLAIFLRTGIKGMNAVELATHLLAEFGSLRALFAADQTLFC
RADC_CELJU      --SISKWPASERPREKLLSMGAPALSDAELLAIFLRIGCVGKSAVDVARELLQQFGGLRPLLEASQKEFC
RADC_SHEFN      ------------PREKLLLKGAGHLSDAELLAVILRNGLAGQNAVDLARNMINQFGGLRSLLSASKSQVC
RADC_RALEJ      ------------PREKLQECGAAALSDAELLAVFLRVGATGKSAVELARDLMVRFGSLTRLFTADARAVL
RADC_PSEA7      ------------PREKLLEQGAATLSDAELLAIFLRTGVTGCSAVELARRLLGEFGSLRALLESDLAAFC
RADC_MARAV      ------------PRERLLAHGAQSLSDAELLAIFLRTGTTGMPVMALARHLIDEFSGLRGLMTASRRQFL
RADC_DESRM      ------------------KEGAGSLTEIDLLAIMLRTGTSKVSVLELAAELFSHFKDLRALSQATIEELS
RADC_YERE8      ------------PREKLLKYGAAVLTDAELLAIFLRTGIPGMHVMQMAEYLIEEFGSLYGLISADYQALC
RADC_CYAP7      --------------------GAQSLSNAELLAILLATGQGKGSAVGLGQHILKELSQLDVLRDMSPQELM
RADC_COXBN      --SITQWPTSERPREKLLREDAHILSDAELIAVIIQKGVRGCNAVELAREWLNHLGGLASLLNADFHRLS
RADC_COXB1      --SITQWPTSERPREKLLREDAHILSDAELIAVIIQKGVRGCNAVELAREWLNHLGGLASLLNADFHRLS
RADC_PSEAE      ------------PREKLLEQGAAALSDAELLAIFLRTGVTGCSAVELSRRLLSEFGGLRALLEADLASFC
RADC_PSEAB      ------------PREKLLEQGAAALSDAELLAIFLRTGVTGCSAVELSRRLLSEFGGLRALLEADLASFC
RADC_PSEA8      ------------PREKLLEQGAAALSDAELLAIFLRTGVTGCSAVELSRRLLSEFGGLRALLEADLASFC
RADC_NEIMB      ------------PREKLLERGAAALSDAELLAILLRVGTRGMSAVDLARYLLQEFGSLGRLMSAEVGKLS
RADC_NEIMF      ------------PREKLLERGAAALSDAELLAILLRVGTRGMSAVDLARYLLQEFGSLGRLMSAEVGKLS
RADC_DELAS      ------------PREKLAARGPSALSDIELLAIVLRTGMAGKGVLQLAQELLQGRAGLSGLLQAGHADLK
RADC_BURPP      -----------MPRERLLRQGPGVLSDTEMIVLILGSGLPGHDVFSVARELLDRFGSLRAMLDATYTDFD
RADC_AERHH      ------------PREKLLRQGPGGLSDAELLAIFLRTGVSGLSAVDLSRHLLQQFGSLRALLGAEQRAFC
RADC_NEIMA      ------------PREKLLERGAAALSDAELLAILLRVGTRGMSAVDLARYLLQEFGSLGRLMSAEVGKLS
RADC_NEIM0      ------------PREKLLERGAAALSDAELLAILLRVGTRGMSAVDLARYLLQEFGSLGRLMSAEVGKLS
RADC_THEEB      ------------PREKLLSQGARYLSSAELLAILLGTGAGKLSAVGLGQFILKQLGERTGLRDITPEELM
RADC_TERTT      ------------PREKLLERGPDALSDAELLAIFLRTGCKGRSAVDLARELLSTFGGLRALLAADCKAFC
RADC_PECCP      -------EKGLAPREKLVRLGAESLTDVELLAIFLRTGLPGVHVMQLAEDLLVQFGSLYQLMTADQSAFR
RADC_METBF      --------------------GPESLSNSELLGVILRTGSNKENVVSLSSRIFSEYS-IKQLSLANVSRLM
RADC_GEOLS      ------------PREKLLKRGXXXXXXXXXXXXXXRTGDAAASAIDLGRELLERFDNLRELAQAELNELQ
RADC_CLOD6      ------------PREKMLAKGVKSLSNAELLAILLRTGNKNKNAIELANYIINDIQGIRHLEDMTIEELC
RADC_CLOBH      ------------PQERLIRYGAEVLSNSELLAVILRTGTKNQNIMMLASSLIKETGGLDQLFNQSIEELT
RADC_CLOB6      ------------PQERLIRYGAEVLSNSELLAVILRTGTKNQNIMMLASSLIKETGGLDQLFNQSIEELT
RADC_CLOB1      ------------PQERLIRYGAEVLSNSELLAVILRTGTKNQNIMMLASSLIKETGGLDQLFNQSIEELT
RADC_YERPY      ------------PREKLLKYGAAVLTDAELLAIFLRTGIPGMHVMKMAEYLIETFGSLHGLISADYQTLC
RADC_YERPS      ------------PREKLLKYGAAVLTDAELLAIFLRTGIPGMHVMKMAEYLIETFGSLHGLISADYQTLC
RADC_YERPP      ------------PREKLLKYGAAVLTDAELLAIFLRTGIPGMHVMKMAEYLIETFGSLHGLISADYQTLC
RADC_YERPN      ------------PREKLLKYGAAVLTDAELLAIFLRTGIPGMHVMKMAEYLIETFGSLHGLISADYQTLC
RADC_YERPG      ------------PREKLLKYGAAVLTDAELLAIFLRTGIPGMHVMKMAEYLIETFGSLHGLISADYQTLC
RADC_YERPE      ------------PREKLLKYGAAVLTDAELLAIFLRTGIPGMHVMKMAEYLIETFGSLHGLISADYQTLC
RADC_YERPB      ------------PREKLLKYGAAVLTDAELLAIFLRTGIPGMHVMKMAEYLIETFGSLHGLISADYQTLC
RADC_YERPA      ------------PREKLLKYGAAVLTDAELLAIFLRTGIPGMHVMKMAEYLIETFGSLHGLISADYQTLC
RADC_YERP3      ------------PREKLLKYGAAVLTDAELLAIFLRTGIPGMHVMKMAEYLIETFGSLHGLISADYQTLC
RADC_SHEAM      ------------PREKLLQRGAAHLSDAELLAVLLRNGVSGQNAVDLARELIGEFGGLRPLFSATKQQVC
RADC_CLOBL      ------------PQERLIRYGAEVLSNSELLAVILRTGTKNQNIMMLASSLIKETGGLDQLFNQSIEELT
RADC_CLOBK      ------------PQERLIRYGAEVLSNSELLAVILRTGTKNQNIMMLASSLIKETGGLDQLFNQSIEELT
RADC_CLOBJ      ------------PQERLIRYGAEVLSNSELLAVILRTGTKNQNIMMLASSLIKETGGLDQLFNQSIEELT
RADC_RHOFD      ------------PREKLLARGPGALSDVELLAVLLRTGIKGKGVLQMARELLELKKSGSDLLHATSDDLK
RADC_THICR      ------------PREKLLKFGAPHLSDAELLAIFLRVGVKGKSAVELAQDLLDHFGSLERLLNADEAAFC
RADC_AZOVD      ------------PREKLLEQGASALSDAELLAIFLRTGVAGQTAVDLARHLLNDFGGLRALLEADRAAFS
RADC_PSEU5      ------------PREKLLDQGAAALSDAELLAIFLRTGVAGKSAVDLARYLLAEFGSLRALLEADLDQFS
RADC_LISW6      --------ESEKPREKLQNYGIEALSSSELVALIIETGTKNESVLTIANRIIMKFKHVAEMQYASIEEFQ
RADC_CLOBM      ------------PQERLIRYGAEVLSNSELLAVILRTGTKNQNIMMLASSLIKETGGLDQLFNQSIEELT
RADC_PSEHT      --------NSQRPREKLIEKGAKALSDAELLAIFLRTGLPGMNVIELAQHLLNENKTLHNLFNASMEEFC
RADC_AZOSB      ------------PREKLLSRGANALSDAELLALFLRVGIRGRTAVDLARDLIARFGTLTRLCSATSSEFA
RADC_THETN      ------------PRERLIKYGPQVLSNAELIAIIIGTGSRRENAISLAQKLITEERGLKFIVNSSVEKLA
RADC_SHEWM      ------------PRDRLIKFGVSQLSDAEVLAVLLRNGSQGLNAVELARNLINEFGGLREVLAASQSQVC
RADC_AQUAE      ----------------------ENLSDEELLAVILGSGSKGADVLSLSKELIK--MGWXXXXXXXXXXXX
RADC_PSEMY      ------------PREKLLAQGAAALTDAELLAIFLRTGVAGCSAVDLARRLLAEFGSLRALLEAELPDFS
RADC_ERWCT      -------EKGLAPREKLVRLGAESLTDAELLAIFLRTGLPGVHVMQLAENLLAQFGSLYQLMTAEQSAFH
RADC_CYAP4      ------------PREKLLAQGARYLTSAELIAILLGTGQGAGKLSAIXXXXXXXXDPLAVLREITPQELM
RADC_PSEPK      ------------PREKLLQRGAGSLTDTELLAVFLGSGVRGCNVVELSRGLLVKFGSLRRLLEADREAFV
RADC_PSEFS      ------------PREKLLEWGAASLSDAELLAIFLRTGVSGRSAVDLARHLLAQFGGLRPLLEASQALFN
RADC_BORPE      ------------PRERLLRHGAATLSDPELLALALRTGVAGCNAVQXXXXXXXXXXXXXXXXXTSPAELQ
RADC_SHESH      ------------PREKLLKLGVGPLSDAELLAVVLRNGVQGLSAVELARNLIGQFGGLRELLTASEIEVC
RADC_PSEP1      ------------PREKLLQRGAGSLTDTELLAVFLGSGVRGRNVVELSRGLLVKFGSLRRLLEADREAFV
RADC_PELCD      ------------PREKLLHRGXXXXXXXXXXXXXXRSGDAASSALDQGRLLIQQFDTLRQMATATTSELQ
RADC_PSYCK      ------------PREKLLKFGAAHLSDAEILAIFLRTGTQSQSAIELARHLIEQFGSLAELLAAPQETVL
RADC_PSE14      ------------PRERLLELGAGSLSDAELLAIFLRTGVAGKSAVDLARHLLNQFDGLRSLLDADLSTFT
RADC_TRIEI      ------------PRERLIACGSQSLSTAELIAILLGTGQGKGSAVGLGQYILNQLSQLSILRNITVQELT
RADC_SHEDO      ------------PRDKLLQQGAARLSDAELLAVLIRNGISGQNALTTGRLLLSHFGGLRSLMTATEDKVC
RADC_AERS4      ------------PREKLLRQGPATLSDAELLAIFLRTGVNGLSAVDLSRQLLQQFGSLRALLGADQGAFC
RADC_PSEE4      ------------PREKLLNRGAGSLSDAELLAVFLGSGVKGRNVLELARGLLVKFGGLRQVLEADRQAFL
RADC_MOOTA      --------------------GVQALSNAELLAILLRTGTRTESALDVARRLLSGPDGLQFLAGATLEELQ
RADC_METAC      ------------PRERLIRSGPESLSNAELLGIVLRTGSKEENVISLCSRILAEYN-IKQLSLANVSRLT
RADC_PSYWF      ------------PREKLLNLGAEYLTDAEILAIFLRTGSKQQSAIELARSLIDHFGGIAELLAAPKEAVL
RADC_PSEPW      ------------PREKLMQRGVGSLSDAELLAVFLGSGVRGRNVVELARGLLVKFGGLRQLLEADRDAFV
RADC_PSYIN      ------------PREKLLQKGTAALSDAELLAIFLRTGCRGVDVVTLSKQLLSQFGSLHALFAASESDFC
RADC_PSEU2      ------------PRERLLELGAASLSDAELLAIFLRTGVAGKSAVDLARHLLNQFDGLRPLLDADLSAFT
RADC_PSYA2      ------------PREKLLKFGAAHLSDAEILAIFLRTGTQSQSAIDLARHLIEQFGSLAELLAAPQETVL
RADC_PELLD      ------------PRERFXXXXXXXXXXXXXXXXXXXXGTRHLNIVDTCQRIIAE-NGLERLASMTLGELQ
RADC_PSESM      ------------PRERLLELGAASLSDAELLAIFLRTGVAGKSAVDLARHLLNQFDGLRSLLDADQPAFT
RADC_MARMS      --SIKHWPEQERPREKLIQQGAGALSDSELLAIFLRTGTQGISAVELARQLLAQFGGLRSLMSASREEFC
RADC_ACIF5      ------------PRERLLQKGAATLSDAELLAIFLRVGVVGKSAVDLAREMLLNFGSLRALLTASHHDFC
RADC_ACIF2      ------------PRERLLQKGAATLSDAELLAIFLRVGVVGKSAVDLAREMLLNFGSLRALLTASHHDFC
RADC_PSEPF      ------------PRERLLEQGSASLSDAELLAIFLRTGVPGKSAVDLARHLLNQFGSLRLLLEADQEAFS
RADC_DESHY      --------------------GADALSNREILAILLRTGVKGENVLDFSERLLTETGGLSGLARLTVHELT
RADC_DESHD      --------------------GADALSNREILAILLRTGVKGENVLDFSERLLTETGGLSGLARLTVHELT
RADC_GEOUR      ------------PREKLLKRGAKALSDAELLALIIGTGDSSSSALDIGREMLQDFGGLRNLAHATASEIC
RADC_NITMU      --SISDWPEAERPREKLLKNGPAYLSDAELLAIFLRTGIAGKSAVDLARELLKRFRGLTGLFAADQGAFC
RADC_AZOSE      ------------PREKLLTRGTAALSDAELLALFLRVGMRGKSAVDLARDLLQQFGSLTRLCAASAAEFS
RADC_RALEH      ------------PREKLMESGAAALSDAELLAILLRVGAAGKSAVDLARELLHRFGSLTALFAAEGRALT
RADC_NEIG2      ------------PREKLLERGAAALSDAELLAILLRVGTRGMSAVDLARYLLQEFGSLGRLMSAEVGKLS
RADC_NEIG1      ------------PREKLLERGAAALSDAELLAILLRVGTRGMSAVDLARYLLQEFGSLGRLMSAEVGKLS
RADC_CARHZ      --------------------GPESLNPAELLAVLLGSGTPQENALELALRLLTTFGGLKGLIEVHPEQLK
RADC_ALTMD      --SIKVWPKSERPREKLLQYGAENLSDAELIAVLLGKGVKGKNAVSVAHELLNELGCLRGVVTATKDEFA
RADC_VIBSL      -----------MPREKLLSRGPDSLSDAELLAIFLRTGTQGMNVLELSDKLIKDFGSLRHLFSATEAEFC
RADC_DECAR      ------------PRERLLAHGPAALSDAELLAIYLRVGVRGKSAVDLARDLLHRFDGLGTLAEASLEELA
RADC_BURCH      --------------------GPAALTDDELIALLLGTGKPGHDVFVTARALVDQFGTLHGLLEATADDFE
RADC_BURCC      --------------------GPAALTDDELIALLLGTGKPGHDVFVTARALVDQFGTLHGLLEATADDFE
RADC_BURCA      --------------------GPAALTDDELIALLLGTGKPGHDVFVTARALVDQFGTLHGLLEATADDFE
RADC_BURVG      -----------LPRERLLERGPAALTDAELVAXXXXXXXXXRDVFDSARALLARFGSLRDMLDAQPGVFT
RADC_VIBPA      -----------MPREKLLQRGPQALTDAELLAIFLRTGTQGMNVIELADFLIQDFGSLRQLFSASEQEFC
RADC_VARPS      -----------------------------------RTGVAGKNVLQLAQELLDHFGGLSGLLQTSAEDLK
RADC_HAHCH      ------------PREKLIAHGSSKLSETELLAIFFRTGTRGRSAVDLARDTINHFGGLRPLLDASFEEFR
RADC_FUSNN      -------------REKFFNNGIDGFAEYEILELLLTYCIPRKDTKPIAKELLNKFKSLDNVFKASFDKLS
RADC_NOSP7      ------------PRERLMTHGXXXXXXXXXXXXXXGTGQGKLSAVGLGQFILSELGKLAVLREVSPAELM
RADC_PSEF5      ------------PRERLLEQGAISLSDAELLAIFLRTGVAGKSAVDLAXXXXXXXXXXXXXXEADQLTFT
RADC_ANAVT      ------------PRERLMTHGPKVLATAELIAILLGTGQGKLSAVGLGQYLLQELGKLAVLREVTPAELM
RADC_VIBHB      -----------MPREKLLQRGPQALSDAELLAIFLRTGTQGMNVIELSDFLIQDFGSLRQLFSASEKEFC
RADC_ANASP      ------------PRERLMTHGPKVLATAELIAILLGTGQGKLSAVGLGQYLLQELGKLAVLREVTPAELM
RADC_XANCP      ------------PREKLLARGAAVLSDAELLAIFVGSGLRGQDAVRTARDLLHRHGPLRCLLDRPAKALA
RADC_XANC8      ------------PREKLLARGAAVLSDAELLAIFVGSGLRGQDAVRTARDLLHRHGPLRCLLDRPAKALA
RADC_IDILO      ------------PREKLQTQGAEYLSDAEXXXXXXXXXXXXQDVVSFARRLLSDFGGVGALLTATPEQLL
RADC_SILPO      -------------RERFMTGGAAALPDYELLELVLFRSIPRQDVKPLARLLLDTFGDFNRVLTAPVERLA
RADC_SERP5      ---ITLWPDTLAPREKLLRYGASALSDAELLAIFLRTGFPGVHVMQLAEQLLEQFGSLYHLMSADHSVFC
RADC_NITOC      ------------PREKLLQRGPNALSDAELLAIFLRTGVAGKTAVDLARELLESFGSLRALLEADLKQFC
RADC_XANC5      ------------PREKLLARGATALSDAELLAIFVGSGLRGQDAVQTAXXXXXXXXXXXXXXXXXAKTLA
RADC_BURS3      --------------------GPAALTDDELIALLLGTGKPGHDVFATARVLVTQFKSLHGLLEATADDFE
RADC_ALHEH      ------------PREKLLERGAGALSDAELLAIFLRTGRQGLSAVDLARELLEAFGGLRPLLEADLDRFC
RADC_THISH      ------------PREKLLSRGAAALSDAELLAIFLRTGVAGKTAVDLARELLSRFGGLRPLLQADLVSFS
RADC_PELPD      ------------PREKMLRKGXXXXXXXXXXXXIIRTGDTATSAIDLGRELISLFSSLRELGSADMAEIT
RADC_XANAC      ------------PREKLLARGATALSDAELLAILVGSGLRGQDAVQTAXXXXXXXXXXXXXXXXXAKALT
RADC_LARHH      ------------PREKLLARGPEALSDAELLAILLRTGMAGKTVLDVARQXXXXXXXXXXXXXXPVTELV
RADC_SYMTH      -------------------------SDVELLAILLGTGSRGRSVIEVARDLLHHLRALLHLRDAERSEL-
RADC_ACAM1      ------------PRERLIAQGAKYLTHAELLAILLGTGQGKLSAVGLGQHVLQHFSELTVLRDVNASELT
RADC_RHIME      -------------RARYREHGDAALADYEILELILFRLIPRRDTKPIAKALLDRFGTLAAVFGAPLHLLQ
RADC_ALCBS      ------------PREKLLARGAQALSDAELLAIFLRTGQQGLTAVDLARRQLVSSGGLRAMLDLSPERMA
RADC_RHOCA      -------------RERFLTGGAEAMPDYELLELILFRALPRQDVKPLARRLLDVFGSFGHVLAAPPARLT
RADC_SHEB9      ------------PRDKLLQKGAGQLSDAELLAVLLRNGLAGLNAVDLARSLISEFGGLRNLLCAPRNQVC
RADC_SHEB5      ------------PRDKLLQKGAGQLSDAELLAVLLRNGLAGLNAVDLARSLISEFGGLRNLLCAPRNQVC
RADC_SHEB2      ------------PRDKLLQKGAGQLSDAELLAVLLRNGLAGLNAVDLARSLISEFGGLRNLLCAPRNQVC
RADC_METHJ      ------------PREKIEKKGASALKDSELIAAILGKGTKNNDILTISSQVADLL------KKDNLPSYD
RADC_SHEB8      ------------PRDKLLQKGAGQLSDAELLAVLLRNGLAGLNAVDLARSLISEFGGLRNLLCAPRNQVC
RADC_PSEPG      ------------PREKLLQRGAVVLTDAEXXXXXXXXXXXXRNVLDLARGLLVRFGGLRQFLEAEREAVL
RADC_BORPA      ------------PRERLLRHGAATLSDPELLALALRTGVAGCNAVQXXXXXXXXXXXXXXXXXTSPAELQ
RADC_BORBR      ------------PRERLLRHGAATLSDPELLALALRTGVAGCNAVQXXXXXXXXXXXXXXXXXTSPAELQ
RADC_XYLFT      ------------PREKLLAHGAATLSDAELLAIFLGSGLRGHDAVQTARNLLHTHGPLRELLDRPPGDLM
RADC_SHESW      ------------PRDKLLQKGAAYLSDAELLAVLLRNGLAGLNAVDLARSLISEFGGLRNLLCAPKNQVC
RADC_SHEPC      ------------PRDKLLQKGAAYLSDAELLAVLLRNGLAGLNAVDLARSLISEFGGLRNLLCAPKNQVC
RADC_XYLFA      ------------PREKLLAHGAATLSDAELLAIFLGSGLRGHDAVQTARNLLHTHGPLRELLDRPPGDLM
RADC_PARDP      -------------RERFMQGGAAAMPDYELLELVLFRAIPRQDVKPLARRLLDRFGDFNRVLSAPPARLA
RADC_SHESR      ------------PRDKLLVKGAAHLSDAELLAVLLRNGLSGLNAVDLARSLIHEFGGLRSLLCAPKHQVC
RADC_SHESA      ------------PRDKLLVKGAAHLSDAELLAVLLRNGLSGLNAVDLARSLIHEFGGLRSLLCAPKHQVC
RADC_SHEON      ------------PRDKLLLKGASHLSDAELLAVLLRNGLSGLNAVDLARSLIQEFGGLRSLLCAPKHQVC
RADC_SHESM      ------------PRDKLLVKGAAHLSDAELLAVLLRNGLSGLNAVDLARSLIQEFGGLRSLLCAPKHQVC
RADC_RHILW      -------------RDRFREQGDTALADYEILELLLFRLIPRRDTKPIAKALIERFGSLAGVFGAPAALLT
RADC_RHIE6      -------------RDRFREQGDTALADYEILELLLFRLIPRRDTKPIAKALIDRFGSLSGVFGAPAGLLT
RADC_DIAST      ------------PREKLLARGPAALSDAELLAILLRTGLAGKGVLQLAQELLDDXXXXXXLLHASSQDLQ
RADC_STRM5      ------------PREKLMARGPTALSDAEXXXXXXXXXXXXRDAVQTARDLLQAHGPLRVLLDRPARELA
RADC_BORA1      ------------PRERLLRLGXXXXXXXXXXXXXXRTGRHGCNALELAQRLLTRHGGLRGIFALSAQELC
RADC_STRMK      ------------PREKLIARGPTALSDAEXXXXXXXXXXXXRDAVQTARDLLQAHGPLRVLLDRPAAELA
RADC_RHIL3      -------------RDRFREQGDAALADYEILELLLFRLIPRRDTKPIAKALIERFGSLAGVFGAPQALLM
RADC_METMA      ----------------LIKNGPESLSNAELLGIVLRTGSREENVISLCSRILMEYN-IKQLSLANVSKLM
RADC_RHOP2      -------------RERFREAGAAALSDYELLELVLFRALPRRDVKPLAKALIARFGSFAETMQAPEPRLR
RADC_RHIEC      -------------RDRFRELGDTALADYEILELLLFRLIPRRDTKPIAKALIERFGSLAGVFGAPAALLT
RADC_CUPTR      ------------PREKLLESGAAALSDXXXXXXXXXXXXXXKSAVDLARELLHRFGSLTXXXXXXXXXXX
RADC_SINMW      -------------RARYREYGDAALADYEILELILFRLIPRRDTKPIAKALLARFGTLAGVFGAPLHLLH
RADC_RHISN      -------------RARYREQGDAALADYDILELILFRLIPRRDTKPIAKELLARFGTLSGVFGAPQHLLQ
RADC_ACIAC      ------------PRERLLARGPSSLSDTELLAILLRTGIVGKGVMQMAQELLS--PALPDXXQADADALK
RADC_LEGPH      -------------REKLLTNGVHSLSDIELLAVFISSGNNKKSCLQLAYELTKHLGNLRNILNADLQSFK
RADC_LEGPC      -------------REKLLTNGVHSLSDIELLAVFISSGNNKKSCLQLAYELTKHLGNLRNILNADLQSFK
RADC_LEGPA      -------------REKLLTNGVHSLSDIELLAIFISSGNNRKSCLQLAYELTKHLGNLRNILNADLQSFK
RADC_LEGPL      -------------REKLLTNGVHSLSDIELLAVFISSGNNKKSCLQLAYELTKHLGNLRNILNADLQSFK
RADC_THIDA      ------------PREKLLKQGAAALTDAELVAVFLRTGVAGKSAVDLGRDLIERFGGLGALCRADRVAAC
RADC_RUBXD      --------------------------------VLFGIGSREKTAVELAGDVISGAGGLHNLFGASVHELK
RADC_OCHA4      -------------RDRLKRDTPDALADYELLEMLLFRAIRRADTKPLAKALLMRFGSIAEVLAAPEKLIA
RADC_CHRVO      --SIASWPESERPREKLLSQGAATLNDSELLAIFLRTGIKGVNAVELARRLLQEXXXXXXXXXXXXXXXX
RADC_BURTA      -----------LPRERLLARGPAALSDAELVALLLGSGLPGHDVFALAHTLLTRFGSLRALLDAAPDDFK
RADC_XANOM      ------------PREKLLARGATALSDAELLAIFVGSGLRGQDAVQTAXXXXXXXXXXXXXXXXXAKALE
RADC_XANOR      ------------PREKLLARGATALSDAELLAIFVGSGLRGQDAVQTAXXXXXXXXXXXXXXXXXAKALE
RADC_XANOP      ------------PREKLLARGATALSDAELLAIFVGSGLRGQDAVQTAXXXXXXXXXXXXXXXXXAKALE
RADC_CHRSD      ------------PREKXXXXXXXXXXXXXXXXIFLRVGVKGRSAVDLARDXXXXXXXXXXXXEADLARFC
RADC_SALRD      MYRVPIHEESDQPREKLLTHGPTVLSDAEVLALLLGSGTRTSSAVELGRALLQSYGSLHEVSQRKPKELT
RADC_BURP6      -----------LPRERLLARGPAALSDAELVALLLGSGLPGHDVFALAHTLLARFGSLRALLDAAPDDFK
RADC_BURP1      -----------LPRERLLARGPAALSDAELVALLLGSGLPGHDVFALAHTLLARFGSLRALLDAAPDDFK
RADC_BURP0      -----------LPRERLLARGPAALSDAELVALLLGSGLPGHDVFALAHTLLARFGSLRALLDAAPDDFK
RADC_BURMS      -----------LPRERLLARGPAALSDAELVALLLGSGLPGHDVFALAHTLLARFGSLRALLDAAPDDFK
RADC_BURMA      -----------LPRERLLARGPAALSDAELVALLLGSGLPGHDVFALAHTLLARFGSLRALLDAAPDDFK
RADC_BURM9      -----------LPRERLLARGPAALSDAELVALLLGSGLPGHDVFALAHTLLARFGSLRALLDAAPDDFK
RADC_BURM7      -----------LPRERLLARGPAALSDAELVALLLGSGLPGHDVFALAHTLLARFGSLRALLDAAPDDFK
RADC_BURA4      -----------LPRERLLERGPAALTDAELIAXXXXXXXXXRDVFASARALLARFGSLRDMLDAEPDVFA
RADC_HALHL      ----------------LIQRGPQALSDAELLAIFLRTGRRGQSAVELARELLAAFSGLRGLLEADRETFA
RADC_BURCM      -----------LPRERLLERGPAALTDAELIAXXXXXXXXXRDVFASARALLARFGSLRDMLDAEPDVFA
RADC_AGRT5      ----------------------------------------------IAKALIARFGTLGSVLGAPLPLLQ
RADC_BRUSU      ---------------------------------------RRADTKPIAKALLNRFGSIAEVLAAPENLIA
RADC_BRUME      ---------------------------------------RRADTKPIAKALLNRFGSIAEVLAAPENLIA
RADC_BRUMB      ---------------------------------------RRADTKPIAKALLNRFGSIAEVLTAPENLIA
RADC_BRUC2      ---------------------------------------RRADTKPIAKALLNRFGSIAEVLAAPENLIA
RADC_BRUAB      ---------------------------------------RRADTKPIAKALLNRFGSIAEVLAAPENLIA
RADC_BRUA2      ---------------------------------------RRADTKPIAKALLNRFGSIAEVLAAPENLIA
RADC_BRUA1      ---------------------------------------RRADTKPIAKALLNRFGSIAEVLAAPENLIA
RADC_POLNA      ------------PREKLLARGPXXXXXXXXXXXXXRTGLPGKNALQMGQELLDNFGGVAGLLHTGAEALK
RADC_ROSCS      -------------------------------------GVEGVNAIQLAQQLLVEFGGWSGLQRAGFEELA
RADC_VEREI      ------------PREKLLARGPATLADAELLAILLRTGIMGKGVLQMAQELLDGFGGIAGLLHASAADLE
RADC_LEPCP      --------------------------------------------------------------------LK
RADC_ROSS1      -------------------------------------GIEGMNAIQLAQQLLVEFGGWNGLQRAGFEELA
RADC_ACISJ      ------------PREKLLARGPAALSDAELLAILLRTGLAGKGVLQLAQELLDDXXXXXXLLHASSQDLQ
RADC_POLSJ      ------------PREKLLARGPXXXXXXXXXXXXXRTGLPGKNALQMGQELVDTFGGVAGLLHTGPEALK
RADC_METPP      ----------LRPREKLLARGPXXXXXXXXXXXXXRTXXXXXXXXXXXXXXXDRFGGLSGLLATDTAELG
YFJY_ECOLI      ----------------------------------------------------------------------
RADC_BORPD      -----------------------------------RTGTRGRTAIDMGSQLLHRYGGLRGLFAASPQELM
Y1786_VIBCH     ----------------------------------------------------------------------
YKFG_ECOLI      ----------------------------------------------------------------------
Y510_VIBCH      ----------------------------------------------------------------------
YEES_ECOLI      ----------------------------------------------------------------------
DNLJ_AQUAE      -------------------KAIEESKNRPLDRVLYGLGIRYVGQ-TTAKKIAEIINSVWDLKDIPLEKLM


                         .         .         *         .         .         .         .:140
query           SLSGIGRVKAIELQAMIELGHRIHKHETLEMESILSSQKLAKKMQQELGDKKQEHLVALYLXXXXXXXXX
RADC_STRZT      SLSGIGRVKAIELQAMIELGHRIHKHETLEMESILSSQKLAKKMQQELGDKKQEHLVALYLXXXXXXXXX
RADC_STRZP      SLSGIGRVKAIELQAMIELGHRIHKHETLEMESILSSQKLAKKMQQELGDKKQEHLVALYLXXXXXXXXX
RADC_STRPN      SLSGIGRVKAIELQAMIELGHRIHKHETLEMESILSSQKLAKKMQQELGDKKQEHLVALYLXXXXXXXXX
RADC_STRPJ      SLSGIGRVKAIELQAMIELGHRIHKHETLEMESILSSQKLAKKMQQELGDKKQEHLVALYLXXXXXXXXX
RADC_STRPI      SLSGIGRVKAIELQAMIELGHRIHKHETLEMESILSSQKLAKKMQQELGDKKQEHLVALYLXXXXXXXXX
RADC_STRP7      SLSGIGRVKAIELQAMIELGHRIHKHETLEMESILSSQKLAKKMQQELGDKKQEHLVALYLXXXXXXXXX
RADC_STRP4      SLSGIGRVKAIELQAMIELGHRIHKHETLEMESILSSQKLAKKMQQELGDKKQEHLVALYLXXXXXXXXX
RADC_STRR6      SLSGIGRVKAIELQAMIELGHRIHKHETLEMESILSSQKLAKKMQQELGDKKQEHLVALYLXXXXXXXXX
RADC_STRP2      SLSGIGRVKAIELQAMIELGHRIHKHETLEMESILSSQKLAKKMQQELGDKKQEHLVALYLXXXXXXXXX
RADC_STRZJ      SLSGIGRVKAIELQAMIELGHRIHKHETLEMESILSSQKLAKKMQQELGDKKQEHLVALYLXXXXXXXXX
RADC_STRGC      GMSGIGQVKAIELQAMIELGSRISKAENFEGERILSSQKLAKKMQQELSHKKQEHLVALYLXXXXXXXXX
RADC_STRSV      TISGIGPIKAVELQAIIELGRRINRAEVLQKEQIMGSQKLARKMQQELGDMRQECLVAIYLNSQNQILHQ
RADC_STRS2      SLTGIGRVKAIEIKAMIELGKRINQSELLLNERILGSEKLGRKMIHEIGHKKQEHLVALYLNTQNQIISQ
RADC_STRA5      SIKGIGQVKSVEIKAMLELAKRIHKAEYDRKEQILSSEQLARKMMLELGDKKQEHLVAIYMDTQNRIIEQ
RADC_STRA1      SIKGIGQVKSVEIKAMLELAKRIHKAEYDRKEQILSSEQLARKMMLELGDKKQEHLVAIYMDTQNRIIEQ
RADC_STRA3      SIKGIGQVKSVEIKAMLELAKRIHKAEYDRKEQILSSEQLARKMMLELGDKKQEHLVAIYMDTQNRIIEQ
RADC_STRU0      QLPGIGKVKAIELKAMVELCHRIQKAKSSHSIQILSSYQVAKRMMHELGDKKQEHLIAIYLDTQNRIIEE
RADC_STRTD      KIPGIGRVKSIELKAMVELAKRIEKAELARSEQIMSSQQVARRMMLDIGDKPQEHLVAIYLDTQNRIIQQ
RADC_STRT2      EIPGIGRVKSIELKAMVELAKRIEKAELARSEQIMSSQQVARRMMLDIGDKPQEHLVAIYLDTQNRIIQQ
RADC_STRT1      EIPGIGRVKSIELKAMVELAKRIEKAELARSEQIMSSQQVARRMMLDIGDKPQEHLVAIYLDTQNRIIQQ
RADC_STRPZ      HLAGIGKVKAIEIKAMIELVSRILATDKTLTDSVLTSVQVAEKMMAALGDKKQEHLVVLYLDNQNRIIEE
RADC_STRPM      HLAGIGKVKAIEIKAMIELVSRILATDKTLTDSVLTSVQVAEKMMAALGDKKQEHLVVLYLDNQNRIFEE
RADC_STRPG      HLAGIGKVKAIEIKAMIELVSRILATDKTLTDSVLTSVQVAEKMMAALGDKKQEHLVVLYLDNQNRIIEE
RADC_STRPF      HLAGIGKVKAIEIKAMIELVSRILATDKTLTDSVLTSVQVAEKMMAALGDKKQEHLVVLYLDNQNRIIEE
RADC_STRPD      HLAGIGKVKAIEIKAMIELVSRILATDKTLTDSVLTSVQVAEKMMAALGDKKQEHLVVLYLDNQNRIIEE
RADC_STRPC      HLAGIGKVKAIEIKAMIELVSRILATDKTLTDSVLTSVQVAEKMMAALGDKKQEHLVVLYLDNQNRIIEE
RADC_STRPB      HLAGIGKVKAIEIKAMIELVSRILATDKTLTDSVLTSVQVAEKMMAALGDKKQEHLVVLYLDNQNRIIEE
RADC_STRP8      HLAGIGKVKAIEIKAMIELVSRILATDKTLTDSVLTSVQVAEKMMAALGDKKQEHLVVLYLDNQNRIIEE
RADC_STRP1      HLAGIGKVKAIEIKAMIELVSRILATDKTLTDSVLTSVQVAEKMMAALGDKKQEHLVVLYLDNQNRIIEE
RADC_STRP6      HLAGIGKVKAIEIKAMIELVSRILAIDKTLTDSVLTSVQVAEKMMAALGDKKQEHLVVLYLDNQNRIIEE
RADC_STRP3      HLAGIGKVKAIEIKAMIELVSRILATDKTLTDSVLTSVQVAEKIMAALGDKKQEHLVVLYLDNQNRIFEE
RADC_STRS7      RLSGIGKVKAIEIKAMLELADRIQIAGQAVADPVLSSAQVAEKMMIELGDKQQEHLVAIYLDSQNKIIEE
RADC_STREM      RLSGIGKVKAIEIKAMLELADRIQIAGQAVAAPVLSSAQVAEKMMIELGDKQQEHLVAIYLDSQNKIIEE
RADC_STRE4      RLSGIGKVKAIEIKAMLELADRIQIAGQAVADPVLSSAQVAEKMMIELGDKQQEHLVAIYLDSQNKIIEE
RADC_ENTFA      AIKGIGQVKAIELRAAIELGCRIYQSSQIKFGKVTSSQQVAQRLLQEMKGLQQEHLICIYLNTKNDIIQQ
RADC_LACLA      EISGIGLAKSIEIRAMIEFGKRIQTTNRKRYGQVLSSREYGLSLAFEMQNFEQEHLVATYLDGQNRIIEK
RADC_GEOKA      NIKGIGPTKAVQILAALELGRRIHQSGCADRYVIRCPEDGAKYVMEDMRFLSQEHFVAIYLNTKNQVIYR
RADC_GEOTN      SIKGIGPTKAVQILAALELGRRIHQSGYNDRYVIRCPEDGAKYVMEDMRFLSQEHFVAIYLNTKNQVIHR
RADC_LACSS      QIEGIGPVKAIELQAICELSRRIQNQRTLRFGVVASSQMVGQRMIESLAGETQEQLLAVYLDVKNQIIQI
RADC_BACSK      KVPGIGMAKAIELSAAIELGRRIQRETKLVRPVISSPEDAAELVSEDMRGLQQEHFVALYLNTKNHVIKQ
RADC_BACLD      SISGIGRAKAVQILAALELGRRIHSLACKDRYVIRFPEDAANFLMGDMRFLSQEHFVCVYLNTKNQVIHK
RADC_BACSU      SIPGIGMVKAIQILAAVELGSRIHKLANEEHFVIRSPEDGANLVMEDMRFLTQEHFVCLYLNTKNQVIHK
RADC_BACHD      SIHGIGEAKAIEFCAAIELGRRIHTMQEMDRYVIRTPEDVSRFVMEEMRFLSQENFVCLYLNTKNQVLHK
RADC_BACA2      SIPGIGTVKAVQILAAIELGSRIHKTSAGEHCVIRSPEDGAKYVMEDMRFLSQEHFVCLYLNTKNQVIHK
RADC_GEOSW      SIKGIGTTKAVQILAAIELGRRISRLSYNGRYVIRSPEDGAKYVMEDMRFLSQEHFVAIYLNTKNQVIHR
RADC_BACHK      SIHGVGVAKATQLIAAFELGRRMVRLEYQNRYSIRSPEDCATYMMEEMRFLQQEHFVCLYLNTKNQVIHR
RADC_BACC3      SIHGVGVAKATQLIAAFELGRRMVRLEYQNRYSIRSPEDCATYMMEEMRFLQQEHFVCLYLNTKNQVIHR
RADC_BACAN      SIHGVGVAKATQLIAAFELGRRMVRLEYQNRYSIRSPEDCATYMMEEMRFLQQEHFVCLYLNTKNQVIHR
RADC_BACAC      SIHGVGVAKATQLIAAFELGRRMVRLEYQNRYSIRSPEDCATYMMEEMRFLQQEHFVCLYLNTKNQVIHR
RADC_BACAA      SIHGVGVAKATQLIAAFELGRRMVRLEYQNRYSIRSPEDCATYMMEEMRFLQQEHFVCLYLNTKNQVIHR
RADC_LACLM      EISGIGQTKAIELRAMIELGKRIQTTTRKRYGQVLSSKEYGMSLAFEMQNFEQEHLTATYLDGQNQIIEK
RADC_BACCZ      SIHGVGVAKASQLIAAFELGRRMVRLEYQNRYSIRNPEDCARYMMEEMRFLQQEHFVCLYLNTKNQVIHR
RADC_BACCQ      SIHGVGVAKASQLIAAFELGRRMVRLEYQNRYSIRSPEDCARYMMEEMRFLQQEHFVCLYLNTKNQVIHR
RADC_BACC7      SIHGVGVAKASQLIAAFELGRRMVRLEYQNRYSIRSPEDCARYMMEEMRFLQQEHFVCLYLNTKNQVIHR
RADC_BACC1      SIHGVGVAKATQLIAAFELGRRMVRLEYQNRYSIRSPEDCATYMMEEMRFLQQEHFVCLYLNTKNQVIHR
RADC_STAES      KIKGIGLYKAVILQAAFELGERINSTSTFDKVQITHPSDVASLMMSTMKDLEQEHFVVLLLNSKNIVTKQ
RADC_BACP2      KIRGVGKAKAISLLAALELGTRLHHQTTDNRYVIRTPEDGANFVMEDMRFLTQENFVCLYLNTKNQVLHK
RADC_BACC2      SIHGIGISKASQLMAAFELGRRMVRLEYQNRYSIRSPEDCAKYMMEEMRFLQQEHFVCLYLNTKNQVLHR
RADC_BACC4      SIHGIGISKASQLMAAFELGRRMVRLEYQNRYSIRSPEDCAKYMMEEMRFLQQEHFVCLYLNTKNQVIHR
RADC_THEMA      SVEGVGMVKAITLKAALELGKRLHRELERIPEKLDSSVKVYKYCQ-EMVYLEREIVKVICLDTKLNVIGE
RADC_THEP1      SVEGVGMVKAITLKAALELGKRLHRELERIPEKLDSSVKVYRYCQ-EMVYLEREIVKVICLDTKLNVIGE
RADC_CHLP8      KIPGIGQAKAMQIAAVFELHRRIRFAKNINRK-IQGAQDVFEYMQGRIPDESKEHLFVLFLNTKNRILSH
RADC_BACWK      SIHGVGIAKASQLMAAFELGRRMVRLEYQNRYSIRSPEDCASYMMEEMRFLQQEHFVCLYLNTKNQVIHR
RADC_STAHJ      TIKGIGLYKAVILKAAFELGERMYARDFNEKIKITSPSDVSNIMMSKMKDLTQEHFVVLLLNSKNIVIKE
RADC_CLOK5      SISGVGKAKAAKILAMAELSKRFKSYKDGDDYRICSPQDAAVLVMEEMRGMKQEHLKVILLNTKNMVIGI
RADC_CLOK1      SISGVGKAKAAKILAMAELSKRFKSYKDGDDYRICSPQDAAVLVMEEMRGMKQEHLKVILLNTKNMVIGI
RADC_PROA2      KINGIGPAKAMQIKAVFELHRRMHFRRNTN-KKIRSARDVFDYMQGRLPDEMREHLFLLNLNTKNQIIRH
RADC_CHLTE      KTPGIGEAKAMQIAAIFELQRRLHFARNMNLK-VKGARDVFEYMKGRIPDETKEHLFVLFLSTKNQILRH
RADC_PROVI      KTSGIGPSKAMQITAIFELNKRLHYKRNTNRK-IQGARDVYEYMQGRVPDETKEHLFVLHLNTKNQITKC
RADC_ALKMQ      QIKGVGIAKASQILAAVELGKRISLTSRVNHYRIKSPDDVSNLLMEEMRYLKKEYFNIALLNTKHEVIAI
RADC_PELPB      KVKGIGDAKAMQIVAIFELNKRLHYSRNLN-KKIQAARDVFEYMAGRVPDETKEHLFVLHLNTKNQIIKT
RADC_FLAJ1      KFKGIGEAKAVSIVAALELGRRQRAEDILKLKKITSSKDAFTIMQPIIGELPHEEFWVLFLNNSNKVISK
RADC_CLOTE      NINGVGEAKASQILALLELTKRFRSFKSGENYNITNPKDAAYLVMEEMRWLKQEYLKVILLNTKNYVIKV
RADC_LISMH      LVNGIGVAKASKIMAAIELGKRISIVTEQEEVVVRCPEDAVKLVMPELAFLFQEHFHCLFLNTKNQVIYR
RADC_CLOPS      ELKGVKEAKATQILAMCELYKRFKVSELTQIK-ISKPSDVAKLVLDELRMLRQEVLILINLDTKNKVISK
RADC_CLOAB      KVKGIGNAKAVQILALGELFKRFKAYKSFESVKITSPKEAANLVMEQLRSFNKEHLYVIMLNTKNIVIKI
RADC_LISMO      LVNGIGIAKASKIMAAIELGRRISIVTEQEEVVVRCPEDAVKLVMPELAFLFQEHFHCLFLNTKNQVIYR
RADC_LISMF      LVNGIGIAKASKIMAAIELGRRIGIVTEQEEVVVRCPEDAVKLVMPELAFLFQEHFHCLFLNTKNQVIYR
RADC_LISMC      LVNGIGIAKASKIMAAIELGRRIGIVTEQEEVVVRCPEDAVKLVMPELAFLFQEHFHCLFLNTKNQVIYR
RADC_CLOPE      EVKGVKEAKATQILAMCELYKRFKVSELTQVK-ISKPSDVAKLVLDELRMLRQEVLILINLDTKNKVISK
RADC_CLOP1      EVKGVKEAKATQILAMCELYKRFKVSELAQVK-ISKPSDVAKLVLDELRMLRQEVLILINLDTKNKVISK
RADC_SALAR      GINGIGLAKFAQLKGIAELARRYYSVRMNEEDALLSPEMTLEFLQSQLTGEEREIFLVIFLDAQHRVLQH
RADC_ENT38      YVEGIGLAKYAQLKGIAELARRYHSVRVLGDNPLLSPEMTKDFLQSQLSDAEREVFMVIFLDNQHRVVKH
RADC_ACTPJ      RMKGLGQTQFIQLQASKEMTKRYLAQQMQVRENINEPYLAVMCFQAELESEEREVFMVMFLDNQNRLIKK
RADC_ACTP7      RMKGLGQTQFIQLQASKEMTKRYLAQQMQVRENINEPYLAVMCFQAELESEEREVFMVMFLDNQNRLIKK
RADC_ACTP2      RMKGLGQTQFIQLQASKEMTKRYLAQQMQVRENINEPYLAVMCFQAELESEEREVFMVMFLDNQNRLIKK
RADC_LISIN      LVNGIGIAKASKIMAAVELGKRISLVTEQKEIVIRCPEDAVKLVMPELAFLFQEHFHCIFLNTKNQVIYR
RADC_FINM2      KIKGIGMAKATSILAGIEIGRRLSLRKAMDSFSLNDPDSVAEIFCNEIGSCDVENFYALLLDTKNRIISK
RADC_CLOBA      SIKGIKEGKASQILALAELFRRFRTFKSADRDKIMSPNDIAMLINGEMSLLKQEILKVIFLNTKNIVIGT
RADC_SYNWW      AEKGIGMAKAVSIKAAIEMGRRVVGN--IQLRRIIKSPEDVQEAVRELAMEEREHFRVLYLDRKGGLITM
RADC_SALTY      GVNGIGLAKFAQLKGIAELARRYYSVRMNEESALLSPEMTREFLQSQLTGEEREIFLVIFLDAQHRVLQH
RADC_SALTI      GVNGIGLAKFAQLKGIAELARRYYSVRMNEESALLSPEMTREFLQSQLTGEEREIFLVIFLDAQHRVLQH
RADC_SALSV      GVNGIGLAKFAQLKGIAELARRYYSVRMNEESALLSPEMTREFLQSQLTGEEREIFLVIFLDAQHRVLQH
RADC_SALPK      GVNGIGLAKFAQLKGIAELARRYYSVRMNEESALLSPEMTREFLQSQLTGEEREIFLVIFLDVQHRVLQH
RADC_SALPC      GVNGIGLAKFAQLKGIAELARRYYSVRMNEESALLSPEMTREFLQSQLTGEEREIFLVIFLDAQHRVLQH
RADC_SALPA      GVNGIGLAKFAQLKGIAELARRYYSVRMNEESALLSPEMTREFLQSQLTGEEREIFLVIFLDVQHRVLQH
RADC_SALHS      GVNGIGLAKFAQLKGIAELARRYYSVRMNEESALLSPEMTREFLQSQLTGEEREIFLVIFLDAQHRVLQH
RADC_SALG2      GVNGIGLAKFAQLKGIAELARRYYSVRMNEESALLSPEMTREFLQSQLTGEEREIFLVIFLDAQHRVLQH
RADC_SALEP      GVNGIGLAKFAQLKGIAELARRYYSVRMNEESALLSPEMTREFLQSQLTGEEREIFLVIFLDAQHRVLQH
RADC_SALDC      GVNGIGLAKFAQLKGIAELARRYYSVRMNEESALLSPEMTREFLQSQLTGEEREIFLVIFLDAQHRVLQH
RADC_SALCH      GVNGIGLAKFAQLKGIAELARRYYSVRMNEESALLSPEMTREFLQSQLTGEEREIFLVIFLDAQHRVLQH
RADC_SALA4      GVNGIGLAKFAQLKGIAELARRYYSVRMNEESALLSPEMTREFLQSQLTGEEREIFLVIFLDAQHRVLQH
RADC_COPPD      QIKGMGKAKAAQVKAALEIGKRFLQNETVEEARITTPEDAARYFSSMLMNEGKEHFWILLLDRKNRPIKH
RADC_ECOHS      GVHGIGVAKFAQLKGIAELARRYYNVRMREKSPLLSPEMTREFLQSQLTGEEREIFMVIFLDSQHRVITH
RADC_SHIFL      GVHGIGVAKFAQLKGIAELARRYYNVRMREESPLLSPEMTREFLQSQLTGEEREIFMVIFLDSQHRVITH
RADC_SHIF8      GVHGIGVAKFAQLKGIAELARRYYNVRMREESPLLSPEMTREFLQSQLTGEEREIFMVIFLDSQHRVITH
RADC_SHIDS      GVHGIGVAKFAQLKGIAELARRYYNVRMREESPLLSPEMTREFLQSQLTGEEREIFMVIFLDSQHRVITH
RADC_SHIBS      GVHGIGVAKFAQLKGIAELARRYYNVRMREESPLLSPEMTREFLQSQLTGEEREIFMVIFLDSQHRVITH
RADC_SALNS      GVNGIGLAKFAQLKGIAELARRYYSVRMNEESALLSPEMTREFLQSQLTCEEREIFLVIFLDAQHRVLQH
RADC_ESCF3      GVHGIGVAKFAQLKGIAELARRYYNVRMREESPLLSPEMTREFLQSQLTGEEREIFMVIFLDSQHRVITH
RADC_ECOUT      GVHGIGVAKFAQLKGIAELARRYYNVRMREESPLLSPEMTREFLQSQLTGEEREIFMVIFLDSQHRVITH
RADC_ECOSM      GVHGIGVAKFAQLKGIAELARRYYNVRMREESPLLSPEMTREFLQSQLTGEEREIFMVIFLDSQHRVITH
RADC_ECOLU      GVHGIGVAKFAQLKGIAELARRYYNVRMREESPLLSPEMTREFLQSQLTGEEREIFMVIFLDSQHRVITH
RADC_ECOLI      GVHGIGVAKFAQLKGIAELARRYYNVRMREESPLLSPEMTREFLQSQLTGEEREIFMVIFLDSQHRVITH
RADC_ECOL6      GVHGIGVAKFAQLKGIAELARRYYNVRMREESPLLSPEMTREFLQSQLTGEEREIFMVIFLDSQHRVITH
RADC_ECOL5      GVHGIGVAKFAQLKGIAELARRYYNVRMREESPLLSPEMTREFLQSQLTGEEREIFMVIFLDSQHRVITH
RADC_ECOK1      GVHGIGVAKFAQLKGIAELARRYYNVRMREESPLLSPEMTREFLQSQLTGEEREIFMVIFLDSQHRVITH
RADC_ECODH      GVHGIGVAKFAQLKGIAELARRYYNVRMREESPLLSPEMTREFLQSQLTGEEREIFMVIFLDSQHRVITH
RADC_ECOBW      GVHGIGVAKFAQLKGIAELARRYYNVRMREESPLLSPEMTREFLQSQLTGEEREIFMVIFLDSQHRVITH
RADC_ECO8A      GVHGIGVAKFAQLKGIAELARRYYNVRMREESPLLSPEMTREFLQSQLTGEEREIFMVIFLDSQHRVITH
RADC_ECO81      GVHGIGVAKFAQLKGIAELARRYYNVRMREESPLLSPEMTREFLQSQLTGEEREIFMVIFLDSQHRVITH
RADC_ECO7I      GVHGIGVAKFAQLKGIAELARRYYNVRMREESPLLSPEMTREFLQSQLTGEEREIFMVIFLDSQHRVITH
RADC_ECO5E      GVHGIGVAKFAQLKGIAELARRYYNVRMREESPLLSPEMTREFLQSQLTGEEREIFMVIFLDSQHRVITH
RADC_ECO57      GVHGIGVAKFAQLKGIAELARRYYNVRMREESPLLSPEMTREFLQSQLTGEEREIFMVIFLDSQHRVITH
RADC_ECO55      GVHGIGVAKFAQLKGIAELARRYYNVRMREESPLLSPEMTREFLQSQLTGEEREIFMVIFLDSQHRVITH
RADC_ECO45      GVHGIGVAKFAQLKGIAELARRYYNVRMREESPLLSPEMTREFLQSQLTGEEREIFMVIFLDSQHRVITH
RADC_ECO27      GVHGIGVAKFAQLKGIAELARRYYNVRMREESPLLSPEMTREFLQSQLTGEEREIFMVIFLDSQHRVITH
RADC_ECO24      GVHGIGVAKFAQLKGIAELARRYYNVRMREESPLLSPEMTREFLQSQLTGEEREIFMVIFLDSQHRVITH
RADC_CLOBB      SIKGIKEGKASQILALAELFKRFRTFKSADRDKIMSPNDLAMLINGEMSLLKQEILKVIFLNTKNIVIGT
RADC_SYNP2      SIPGVGLAKAAQILAGIELGKRIFQAKPSEKIIVDSPEAAAIALSNDLMWQDQERFAVLCLDVKNTLIAT
RADC_HAEIE      SVKGLGITQFIQLQAITEMTKRYLKQEMLSTPIINDPETVKLFLLTELQHEEREVFMVLFLDNQHRLIKK
RADC_ALKOO      QVKGVGLAKASQIIAAVELGKRISLTTKVNNYKIKGPDDVSNLLMEEMRYLNKEIFNILLLTTKHDIIAI
RADC_KLEP3      AVDGLGLAKYAQLKGIAELARRYFSSQLVEEAALVSPSTTREFLQSQLTEEEREIFMVIFLDNQNRVLKH
RADC_CLONN      TLXXXXXXXXXXXXXXXELAKRFKAYKSGDVYIIKSPGDVAGLVMEEMKYFKEEHLRVIMLNTKNIVISC
RADC_STAS1      KIKGVGLYKALTLKAAFELGERMHSGSVDDKIQINNPKDAADFMMGKMEHLTQEKFIALFLNSKNIIIKQ
RADC_NITEC      KLPGMGPAKFAQLQAVMEMARRALAEELKSGDIMDSPQSVRSYLRLSLGGKPHEVFVGIFLDARHRTIMI
RADC_HAEI8      SVKGLGITQFIQLQAITEMTKRYLKQEMLSTPIINDLETVKLFLLTELQHEEREVFMVLFLDNQHRLIKK
RADC_CHLSY      RLHGMGVSKAASVKAALEIGRRLARSAIEERFPIRSPADVATLLLVEMSHLDQEHLRTILLDTKNRVQQI
RADC_CHLAA      RLHGMGVSKAASVKAALEIGRRLARSAIEERFPIRSPADVATLLLVEMSHLDQEHLRTILLDTKNRVQQI
RADC_HAES2      QMKGLGITQFVQLQACTEMTKRYLLQELQFAQEFTSPDTVRMYLQTELENKDREIFMVLFLDNQHRLIKK
RADC_HAES1      QMKGLGITQFVQLQACTEMTKRYLLQELQFAQEFTSPDTVRMYLQTELENKDREIFMVLFLDNQHRLIKK
RADC_SHIB3      GVHGIGVAKFAQLKGIAELARRYYNVRMREESPLLSPEMTREFLQSQLTGEEREIFMVIFLDSQHRVITH
RADC_NITEU      ELPGMGPAKFAQLQAVMEMAKRALAEELKNGDIMDSPQSVRNYLCLSLKGKPYEVFVGIFLDARHRTIVT
RADC_ACTSZ      QFKGIGITQYIQLQACTEMTKRYLAEELTFAHEFTNPLTVRLYLQTELEHYEREVFSVLFLDNQHRLIKK
RADC_PASMU      QLKGLGITQFIQLQACTEMSKRYLQEELKLTQAFKNSENVRFYLQATLENKEREIFQVLFLDNQHRLIKQ
RADC_METBU      KIRGIGPAKASQIAALFELARKLEIFTDDPKRKIRSANDVYSLLYPRHRELKKEHLTALYLDTKNNIIKE
RADC_KLEP7      AVDGLGLAKYAQLKGIAELARRYFSSQLVEEAALVTPSMTREFLQSQLTEEEREIFMVIFLDNQNRVLKH
RADC_PORGI      SFRGMGPAKAVTVMAAMELSRRIPSQEMPRRESITDSRMAYRTISPFLTDLPQEEMWVLLLNQSGKIISM
RADC_MICAN      AIHGIGPAKATTILAAIELGKRAFQRRPTEKMVIDSPDTAAAILGHELMYQSQERFAVILLDVKNQLIAL
RADC_STACT      KVKGIGLNKAIILKAAFELGERMYIPDLDTKVKITSPQDAADYFLSRMMHLTHEQFEVLFLNSKNVVIRH
RADC_HAEDU      QIKGLGQTQFIQLQASKEMTKRYLAQQMQMCETINTPHLAIMYFQTELEFEEREVFMVLFLDNQNRLIKK
RADC_CLOB8      SIKGIKQGKASQILALAELFKRFRTLKAINNDIKITSPKLASLLMGEMNELNQEVLKVVLLNTKNIVVGI
RADC_ENTS8      DIGGVGMAKYAQLKAIGELARRYYRSRPCEETALLSPTITRDFLESQLAEQEREVFLVIFLDSQNRIIRQ
RADC_HAEIN      SVKGLGITQFIQLQAITEMTKRYLKQDMLSTPIINDPETVKLFLLTELQHEEREVFMVLFLDNQHRLIKK
RADC_ACIBT      QFNGIGATKYSQLLAVKELGRRYLDYHFSQTESLHSSHLVLDYLRYELKGEKQEVFAVLCLDAELRKLHF
RADC_ACIB5      QFNGIGATKYSQLLAVKELGRRYLDYHFSQTESLHSSHLVLDYLRYELKGEKQEVFAVLCLDAELRKLHF
RADC_ACIB3      QFNGIGATKYSQLLAVKELGRRYLDYHFSQTESLHSSHLVLDYLRYELKGEKQEVFAVLCLDAELRKLHF
RADC_STAAW      KVKGIGLQKAITLKAAFELGERMGRRAENNRIKITQPSDVADYMIPTMKDLTQEHFVILLLNSKNVVIKE
RADC_STAAS      KVKGIGLQKAITLKAAFELGERMGRRAENNRIKITQPSDVADYMIPTMKDLTQEHFVILLLNSKNVVIKE
RADC_STAAE      KVKGIGLQKAITLKAAFELGERMGRRAENNRIKITQPSDVADYMIPTMKDLTQEHFVILLLNSKNVVIKE
RADC_STAAC      KVKGIGLQKAITLKAAFELGERMGRRAENNRIKITQPSDVADYMIPTMKDLTQEHFVILLLNSKNVVIKE
RADC_STAA8      KVKGIGLQKAITLKAAFELGERMGRRAENNRIKITQPSDVADYMIPTMKDLTQEHFVILLLNSKNVVIKE
RADC_STAA3      KVKGIGLQKAITLKAAFELGERMGRRAENNRIKITQPSDVADYMIPTMKDLTQEHFVILLLNSKNVVIKE
RADC_VIBF1      SHKGLGTAKFAQLQAVVEMTER-YLFEKIEKEDALTSPEHTKRLTRMLRDRHREAFYVLFLDNQHRVLKG
RADC_GEOSL      AVKGMGTAKATSIKAALEMASRINSERLMICERFTSPEQVYNHYHYAFRDRRKEYFMALLLDGKNRIMRE
RADC_SHEHH      RLDGIGPVKFAQMQAAVELGTRISQ-ENLQRGKILSDPDLTRDLMRQLSDRAYEVFAILLLDSQHRVIQF
RADC_DESAP      AVKGVGPAKSAEVRAAFELGRRAACRPGEWQPTVRTPEEAAGLVMEEMRYFDREHFWALVLNTKNRVLAV
RADC_CITK8      G-TGIGIAKYAQLKGIAELARRYYKARMMKENALLSPEMTREFLQSQLTGEEREIFLVIFLDARHRVIKH
RADC_CHLCH      QIKGIGESKAMQIVAIFELNRRLH-YSRNQLRKIMAAGDVFEYMSGRIPDESKEHLFVLHLNTKNQVIKN
RADC_TOLAT      QAHGLGPAKYVQLQAVLEMSNRYLSECLQRGDSLTSPQLVRRYLQAQLRDRPREVFAMLLLDNQHRVLRF
RADC_STAAB      QVKGIGLQKAITLKAAFELGERMGRRAENNRIKITQPSDVADYMIPTMKDLTQEHFVILLLNSKNVVIKE
RADC_SHEPW      RLDGIGPVKFAQLQAAVEIGKRISK-ENLKRGKILSDPDLTRDLMRQLGDRAYEVFAILLLDSQHRVIQF
RADC_SHEPA      RLDGIGPVKFAQMQAAVELGARISQ-ENLKRGKILSDPDLTRDLMRQLSDRAYEVFAILLLDSQHRVIQF
RADC_VIBFM      SHKGLGAAKFAQLQAVVEMTER-YLFEKIEKEDALTSPEHTKRLTRMLRDRHREAFYVLFLDNQHRVLKG
RADC_PSEA6      LAKGLGEAKFVQLQASIELSQRFFA-EQLQRETVFNSAQQTKHLIAQLRDEPNEVFGMLLLDSQHQLIKF
RADC_JANMA      QLNGLGPAKYAQLQAVXXXXXXXXXXXXQIGISLNSPQAVKKYLQLLLGGKPYEAFAVLFLDVKNRLIAC
RADC_HERAR      KINGLGPAKYAQLQAVLELARRSLCEELQAGVALNSPQAVKQYLQLLLSGRAYESFVILFLDVKNRLIVC
RADC_ALISL      SHKGLGTAKFAQLQAVVEMTER-YLFEKIEKEDALTSPEHTKRLTRILRDRHREAFYVLFLDNQHRVLKG
RADC_METFK      QVHGMGLSKFVQLQAIFEMSRRALLEQMQGRDVLTSPQAVRQYLSLRIGALPREVFIGIFLDAQHRVLAV
RADC_VIBVY      RHKGLGQAKYVQLQAVLEMTQR-YLAETLQRGDALTSPQHTKLLSSMLRDRHREAFYVLFLDNQNRVIKD
RADC_VIBVU      RHKGLGQAKYVQLQAVLEMTQR-YLAETLQRGDALTSPQHTKLLSSMLRDRHREAFYVLFLDNQNRVIKD
RADC_PHOLL      SHKGMGLAKYAQLQAIAELAKRFFSSQFMH-EDIMSSPSVTQELQNLLSGRDREIFVVLFLNNQNRVICH
RADC_CHLPB      ETDGIGPAKAMQIQAVFELQKRLHFSRNTN-KKVRSARDVFDYMYGRVPDESKEHLFVLHLNTKNQIISH
RADC_ACIAD      HFHGIGTTKYAHLMAVKELGRRYLNHYFHQDALNLNSSRLVDYLRYELLGEKQEVFAVLCLDSELRKLNF
RADC_CHLPD      EIKGIGQAKAMQIIAVFELNKRIHYSRNLQRK-VLSARDVFEYMAGRVPDITKEHLFVLHLNTKNQIIRN
RADC_BURXL      DLRGIGPAKKTQLLAIMEMARR-SLVDKMRMRSLINSPEAVENLRLRIGGRPQEIFVSLFLDARHRLIRC
RADC_SYNY3      AFPGIGPAKATTILAAVELGKRVFQSRPLEKMVVDSPEAAAIALSQDLMWQTQEHFAIVMLDVKNRLLAT
RADC_PARUW      EVQGIGFAKAIQLKAALNLGFRATRQQIKSRYLIEHSSHAYQLVKDELENENREIFMAIFQDTKGYLITY
RADC_CHLAD      RRTGIGASKAATIKAALEIGRRLARSSVEERYPIRSPGDVAALLMVEMSHLDQEHLRTVLLDTKHRVQQI
RADC_RALSO      AIHGMGPAKYAQLHALLEVARRALKEEIAYGQTLESPQSVKDFLRLTLGHRPQEVFACLFLDVRHRLIAW
RADC_SHELP      DIQGIGPVKYAQLQAAIELSKRI-AQENLQRGKILSDPDLTRDLMRQLADRAYEVFAILLLDSQHRVIQF
RADC_SACD2      QAQGLGNAKFSQLQAVLEMSRR-HLAAALEQKTSLTSTTAVKQVSAQLRHRQSEVFALILLNTQNQLIKF
RADC_CYAA5      SIDGIGPAKATTIIAAVELGKRTFQVRPLERVTIDSPEAAVAALSHDLMWERREHFAAVFLDSKYRLLGT
RADC_VIBCM      RHKGLGEAKFVQLQAVLEMTQRYLAETLKRGDALTSPQQTKLYLSSVLRDRQREAFYILFLDNQHRVIRD
RADC_VIBCH      RHKGLGEAKFVQLQAVLEMTQRYLAETLKRGDALTSPQQTKLYLSSVLRDRQREAFYILFLDNQHRVIRD
RADC_VIBC3      RHKGLGEAKFVQLQAVLEMTQRYLAETLKRGDALTSPQQTKLYLSSVLRDRQREAFYILFLDNQHRVIRD
RADC_RALPJ      SINGMGPAKYAQLHALLEVARRALKEDFTQGQTFESAQSVKDFLRLTLGHRPHEVFACFFLDVRHRLIAW
RADC_PHOPR      LHKGLGPAKYAQLQAIIEMSQR-HLEETLKEGDVLTSQHTRHYLSQLLRDRQREVFYVLFLDNQHRVIAG
RADC_CELJU      RGRGLGMVKYVQLQAVLEMARR-HIHADMKVGDLLSSPHLVRDLRAQLRHHAREVFAVLFLDNQNRLIAY
RADC_SHEFN      KLAGVGPVKYAQLQAAVEISKRI-AHENLQRGQILTNPDLTRDLMRQLADRSYEVFALLLLDTQHRVIQF
RADC_RALEJ      GIRGMGEAKYTQLQAVPELARRMLA-ESLELPSGLDSPAAVRSLRLTLAPLAQEVFVCLFLDTRNRMIAS
RADC_PSEA7      GHLGLGVAKYAQLQAVLEMGRR-HLAERLRRDSVLESQAVRDYLKARLRHEQHEVFACLFLDTRHRVLAF
RADC_MARAV      QVKGLGTAKYAQVQAAMEMARRVMDEPLRQGDPLRSPADTRRFLTSRLGTYPHEVFAGLFLDNRHRVIQY
RADC_DESRM      QIKGVGPVKAVQVKAALELGRRLAAMPAETRVIIRCPEDVCGLVMEDLRDLDREHFLALLLNTKNQVLAR
RADC_YERE8      AQKGIGVSKYSQIQAIAELAGRCFSSHLMQ-ESVLQNPEITQKLQNILSHREREIFLVMFLDNQHRVIRH
RADC_CYAP7      NIPGIGPAKATTILAAIELGKRAFQLRPMEKVEINDPVSAVAALSHDLMWQNQERFAIVLLNVKNQIIGT
RADC_COXBN      GLRGLGKAVYCKLKAAAELQRR-YLRQSLERKGQLGTQDAQQLLYAQLRHHESEVFACLFLDNRHRIIQF
RADC_COXB1      GLRGLGKAVYCKLKAAAELQRR-YLRQSLERKGQLGTQDAQQLLYAQLRHHESEVFACLFLDNRHRIIQF
RADC_PSEAE      GHLGLGVAKYAQLQAVLEMGRR-HLAERLRRDSILESQAVRDYLKARLRHEQHEVFACLFLDTRHRVLSF
RADC_PSEAB      GHLGLGVAKYAQLQAVLEMGRR-HLAERLRRDSILESQAVRDYLKARLRHEQHEVFACLFLDTRHRVLAF
RADC_PSEA8      GHLGLGVAKYAQLQAVLEMGRR-HLAERLRRDSILESQAVRDYLKARLRHEQHEVFACLFLDTRHRVLAF
RADC_NEIMB      AYKGMGTASFTQFAVVREIGRRILAEELQESIVLSDPDTVADYLRFHLGQEKVEVSVALLLNRQNQLIAV
RADC_NEIMF      AYKGMGTASFTQFAVVREIGRRILAEELQESIVLSDPDTVADYLRFHLGQEKVEVSVALLLNRQNQLIAV
RADC_DELAS      AIKGLGPSKCAQLLAVLELARRAMAEQLRERPALASPEAVARYLQLHLAARQHEVFAVLFLDGQHRLIAL
RADC_BURPP      GLRGIGPAKKAQLLAIMEMARR-SLVDKLRSRSLLNSPEAVENLRLRIGGRPLEVFVSLFLDARHRLIHC
RADC_AERHH      AAHGLGPAKYAQLQAVLEMGKR-HLAEQLQRGDPLTSPQLTRDLQAQLRDRPREVFALLLLDNQHRVIQF
RADC_NEIMA      AYKGMGTASFTQFAVVREIGRRILAEELQESIVLSDPDTVADYLRFHLGQEKVEVSVALLLNRQNQLIAV
RADC_NEIM0      AYKGMGTASFTQFAVVREIGRRILAEELQESIVLSDPDTVADYLRFHLGQEKVEVSVALLLNRQNQLIAV
RADC_THEEB      AIPGVGPAKATTILAAVELGKRVFQSRPGEQTIIDSPXXXXXXXXXXXMWQATERFAVLLLDVRHRLLGS
RADC_TERTT      QGLGLGEAKYVQLQAVLEMSKR-HLGETLQRQTFANSQSVKDFLNSQLRHRRSEVFAALFLDSQHRLLSF
RADC_PECCP      TAKGVGISKYTQIKAIAELSRRLFFSRLAKEDAMLNPQATGQYLQLLLSRREREVFLVLFLDNQHHVIRH
RADC_METBF      KVHGVGKAKAAQIAAVFELARRLETFVEEPKRKVCSPKDVYTLMYPKMREQKKEKFITLCLDTKNQILKE
RADC_GEOLS      QIKGLGLAKAASIKAAFTLGKRFQARRLETLERFTSPAQVFDFFHHELRDNRKELFLTLLLDGKNRITRK
RADC_CLOD6      NIDGIGLSKSTQIKAALELGSRVASFKPIKYK-IMNPWDIQRYYMDSLRYLKKEVFKAVLLNTKNEIISD
RADC_CLOBH      KIKGIGVTKAVQILALSELSKRFKTYKSGNEYKISTPLDVSNLVMEDMKYLKQEKLKILILNTKNIVTYI
RADC_CLOB6      KIKGIGVTKAVQILALSELSKRFKTYKSGNEYKISTPLDVSNLVMEDMKYLKQEKLKILILNTKNIVTYI
RADC_CLOB1      KIKGIGVTKAVQILALSELSKRFKTYKSGNEYKISTPLDVSNLVMEDMKYLKQEKLKILILNTKNIVTYI
RADC_YERPY      AHKGIGASKYSQIQAIGELACRCFSSHLMRESVLLNPGITQKFLQNILSHREREIFLVVFLDNQHRVIRH
RADC_YERPS      AHKGIGASKYSQIQAIGELACRCFSSHLMRESVLLNPGITQKFLQNILSHREREIFLVVFLDNQHRVIRH
RADC_YERPP      AHKGIGASKYSQIQAIGELACRCFSSHLMRESVLLNPGITQKFLQNILSHREREIFLVVFLDNQHRVIRH
RADC_YERPN      AHKGIGASKYSQIQAIGELACRCFSSHLMRESVLLNPGITQKFLQNILSHREREIFLVVFLDNQHRVIRH
RADC_YERPG      AHKGIGASKYSQIQAIGELACRCFSSHLMRESVLLNPGITQKFLQNILSHREREIFLVVFLDNQHRVIRH
RADC_YERPE      AHKGIGASKYSQIQAIGELACRCFSSHLMRESVLLNPGITQKFLQNILSHREREIFLVVFLDNQHRVIRH
RADC_YERPB      AHKGIGASKYSQIQAIGELACRCFSSHLMRESVLLNPGITQKFLQNILSHREREIFLVVFLDNQHRVIRH
RADC_YERPA      AHKGIGASKYSQIQAIGELACRCFSSHLMRESVLLNPGITQKFLQNILSHREREIFLVVFLDNQHRVIRH
RADC_YERP3      AHKGIGASKYSQIQAIGELACRCFSSHLMRESVLLNPGITQKFLQNILSHREREIFLVVFLDNQHRVIRH
RADC_SHEAM      RLQGLGPVKYAQLQASAELARRL-AGESLQRGAVLTSPDLTRDLRFQLADRAYEVFAVLLLDSQHRVIQF
RADC_CLOBL      KIKGIGVTKAVQILALSELSKRFKTYKSGNEYKINTPLDVSNLVMEDMKYLKQEKLKILILNTKNIVKYI
RADC_CLOBK      KIKGIGVTKAVQILALSELSKRFKTYKSGNEYKINTPLDVSNLVMEDMKYLKQEKLKILILNTKNIVTYI
RADC_CLOBJ      KIKGIGVTKAVQILALSELSKRFKTYKSGNEYKINTPLDVSNLVMEDMKYLKQEKLKILILNTKNIVTYI
RADC_RHOFD      RIKGLGPAKRAELVAVLELSRRALAQQLKERTIFATPDAVKHYLQLHLAAKPHEVFAVLFLDVQNRLLAL
RADC_THICR      EAKGLGQAKYVQLKAVLEMSRRHFESGLKKGEALTQPEKVARLLQHHIGHQSREIFGLVLLDQQNQFIQF
RADC_AZOVD      RRLGLGPAKFAQLQAVLEMSRR-HLAERLRRDPALESQAVRDYLKARLRHEPHEVFGCLFLDAKHRVLAF
RADC_PSEU5      AHLGLGPAKFAQLQAVLEMGRR-HLAERLRRDSALESQAVRDYLKARLRHEPHELFGCLFLDAKHRVLAF
RADC_LISW6      LVNGIGVAKASKIMAAIELGRRISIVTNQEEIVIRCPDDAVKLVMPELAFLFQEHFHCIFLNTKNQVIYR
RADC_CLOBM      KIKGIGVTKAVQILALSELSKRFKTYKSGNEYKISTPLDVSNLVMEDMKYLKQEKLKILILNTKNIVTYI
RADC_PSEHT      AQKGLGTAKYVQLQAVLELSQR-YMQERCQRDAIFNSNAVYDYLTLQMRGLQQEVFMVLYLDSQNRLIKD
RADC_AZOSB      AIPGMGLAKYAQLQAVMELARRALSETLCARDLFDSPEAVRDWLRLRLGHLPHETFCVLLLDARNTLIDA
RADC_THETN      NIRXXXXXXXXXXXXXXXXXRRLMLSTQGENFSVTSPEDVINLLMEEMRYLSKEHFKVVMLNVKNKIIAI
RADC_SHEWM      RLSGMGPVKFAQLRAAVELSSRV-SAQNLKRGKILSDPDLTRDLMRQLRDRAYEVFAILLLDSQHRVIQF
RADC_AQUAE      XXRGLGLVKALQVKALVELSKRFKGGKS--RISIRNPQEAFEFLKDKF-DERRESLIALYLDLSNRLLDW
RADC_PSEMY      QHLGLGPAKYAQLQAVLEMARR-HLAERLRRDSALESQAVRDYLKAQLRHEPHEVFGCLFLDAKHRVLAF
RADC_ERWCT      NARGVGISKYTQIKAIAELSRRLFFSRLAKEDAMLNPEATGQYLQLLLSRREREVFLVLFLDNQHHVIRH
RADC_CYAP4      AIPGIGPAKATTILAAIELGKRVFQSKPTEQTIINDPAVAAAALGSELFWQAQEKFAVLLLDVRHRLIGT
RADC_PSEPK      GELGLGPVRYSQLQALLEIGRR-HLATSIERESAMDSPAAVRRLKAMLRHEASEVFGCLFLDTKHRPLAF
RADC_PSEFS      QQLGLGPAKFAQLQAVLEMAKR-HMAERLRHDSVLESPKAVRDLKAMLRHEPHEIFGCLFLDSRHRVLGF
RADC_BORPE      VVPGLGTAKACVLAAVLELARRTLEEDLVRQDALANPDLVRRYCQAALGHRKVEHCIALYLDARLKLIIC
RADC_SHESH      RMPGMGPVKFAQLQAAAELSKRISQ-QNLKRGKILSDPDLTRDLMRQLADRAYEVFAILLLDSQHRVIQF
RADC_PSEP1      GELGLGPVRYSQLQALLEIGRR-HLATSIERESAMDSPAAVRRLKAMLRHEASEVFGCLFLDTKHRPLAF
RADC_PELCD      AIKGIGPAKAAELQAVFELARRFGRNPLRPGDRYTSPQAVFAHFHERLRDHKRERFIALLLDSKNRLLRE
RADC_PSYCK      ACHGIGPAKYAQILASLEMGRRYLDSQLKTGQGLGRSQMVKDYISTQLRGEPREVFAVLCLDNALNLINF
RADC_PSE14      SQLGLGPAKFAQLQAVMEMARR-HMAESLRRDSALENPTQVRNLKAQLRHEQHEVFACLFLDNKHRVMTF
RADC_TRIEI      QIHGIGTAKATTILAAIELGKRVFQSRPPELAVVESPQAAADALSQDLMWQTQEKFAVLLLDVKNRLLGT
RADC_SHEDO      QIPGVGPVKYAQLQAAAEISKRISR-ENLQRGQILTNPDLTRDLMRQLADRSYEVFALLLLDSQHRVIQF
RADC_AERS4      HAHGLGPAKYAQLQAVLEMGKR-HLAEQLQRGDALTSPQLTRDYLQA---QLREVFALLLLDNQHRVIQF
RADC_PSEE4      GELGLGPVRYSQLQALLEIGRR-NLAMSIERESVMDNPLAVRRLKAMLRHEASEVFGCLFLDTKHRPLAF
RADC_MOOTA      QQKGIXXXXXXXXXXXXXXXXXXXXF-TLSRTVIRNPRDVAGLLLDEMRYLDRENFRTVSLNTKNQVLGI
RADC_METAC      QVHGVGKAKAAQIAAVFELARRLETFVEEPKRKICSPKDVYALMYPRMREQKKEKFITLYLDTKNQILKE
RADC_PSYWF      ACHGIGTAKYAQLLASLEMGKRYLNSELKSGNSLNRSQVVKDYITTQIRRESKEVFAVLCLDNGLNLLDY
RADC_PSEPW      GELGLGPVRYGQLQALLEIGRR-NLATSIERDCALESPSAVRRLKAMLRHEPSEVFGCLFLDSKHRPLAF
RADC_PSYIN      EKKGLGQAKYVQLQAVLEMSSRYLQEPLSKGNALTSAAQTKAFLIAKMHNLPYEVFAAILLDTQHRIIRF
RADC_PSEU2      SQLGLGPAKFAQLQAVMEMARR-HMAESLRRESALENTQVRSYLKALLRHEPHEVFGCLFLDNKHRVMTF
RADC_PSYA2      ACHGIGPAKYAQILASLEIGRRYLDSQLKTGQGLGRSQMVKDYISTHLRGEPREVFAVLCLDNALNLINF
RADC_PELLD      KTPGIGQAKAMQIVAIFEXXXXXXXXXXXXXX-VQGAKDVFEYMSGRIPDETQEHLFVLHLNTKNQVTKC
RADC_PSESM      AQLGLGPAKFAQLQAVMEMARR-HMAESLRRDSALENPAQVRNLKAQLRHEPHEVFACLFLDNKHRVMTF
RADC_MARMS      QGLGLGDAKYTQLQAVLEMSKR-HLQEQLMRETVFASAEHVRTLSSQLRHSPREVFAVLFLDTQHRLIRY
RADC_ACIF5      VHKGLGDAKYALLQAVLEMGRRHLAEEWQRGDGLDSPLRVRQYLSATLRDRCREVFAVIFLDNRHRVLRF
RADC_ACIF2      VHKGLGDAKYALLQAVLEMGRRHLAEEWQRGDGLDSPLRVRQYLSATLRDRCREVFAVIFLDNRHRVLRF
RADC_PSEPF      KQLGLGPAKFAQLQAAQEMSKRHLAERSRQKTALENPQVVRDYLKVMLRHEPHEVFGCLFLDSKHQVLTF
RADC_DESHY      RYRGMGTXXXXXXXXXXXXGRRSVSSDPLVRPVINSPQDIAHLVMEEMRYLDREHFRVVSLSTKNHXXXX
RADC_DESHD      RYRGMGTXXXXXXXXXXXXGRRSVSSDPLVRPVINSPQDIAHLVMEEMRYLDREHFRVVSLSTKNHXXXX
RADC_GEOUR      RXXXXXXXXXXXXXXXXXXXNRYGARRFESLERFTSPSQVXXXXXXXXRDHRKEYFLTLLLDGKNRILKR
RADC_NITMU      QVPGMGPAKFAQLQAVXXXXXXXXXXXXKSSDAMDSPGPVRAFLRLSLEGKEHEVFVSIFLDARNRVIAT
RADC_AZOSE      AIPGMGLAKYAQLQAVMELARRALAEQMNDADVFESPLAVRNWLRLRIGSLPHEVFHVLLLDARNRLIEA
RADC_RALEH      SVRGMGETKYAQLQAIPXXXXXXXXXXXXXPTGFDGPAAVRNYLRLTLAPLPHEVFLCLFLDPRNRMVAS
RADC_NEIG2      AYKGMGTASFTQFAVVXXXXXXXXXXXXXXXXXXSDPDTVADYLRFHLGQEKVEVSVALLLNRQNQLIAV
RADC_NEIG1      AYKGMGTASFTQFAVVXXXXXXXXXXXXXXXXXXSDPDTVADYLRFHLGQEKVEVSVALLLNRQNQLIAV
RADC_CARHZ      SFKGIGQXXXXXXXXXXXXXXXXXXXTGENKLNFLNPDDVYNYLRYKIGHKKQEQVVVLYLNTKNQLCGE
RADC_ALTMD      KVTGIGPCKYAQFQAGFEIFKR-NLEIKLQREDVFNNVDDTKRLQAKLRDCQREKFALLMLDSQHQLIAF
RADC_VIBSL      AHKGMGQAKYVQLQAVLEMTQR-YLAETLSRGDALTSPSHTKYLSSILRDRQREAFYILFLDNQNRVIKD
RADC_DECAR      SVSGIGMAKAAQLKASFELTRRALSQEMATRDSFTSPGKVRDWLRLKLASRGHEVFMALWLDAQNQLLKA
RADC_BURCH      AHPGIGPARSARLVAVTEIARRMLVEKAEERMQIDSPGAVEDCLRLKIGTRQYEVFIAVYLDARNRLIDM
RADC_BURCC      AHPGIGPARSARLVAVTEIARRMLVEKAEERMQIDSPGAVEDCLRLKIGTRQYEVFIAVYLDARNRLIDM
RADC_BURCA      AHPGIGPARSARLVAVTEIARRMLVEKAEERMQIDSPGAVEDCLRLKIGTRQYEVFIAVYLDARNRLIDM
RADC_BURVG      THPGIGDARAAVLIAVTEITRRALVEKARRRMPIDSPGAVEDYLRLRIGMRPYEVFVTLYLDARHGLIEV
RADC_VIBPA      QHKGLGQAKYVQLQAVLEMTQR-YLAETLKRGDALTSPEQTKYLSSILRDRQREAFYILFLDNQHRVIKD
RADC_VARPS      VIKGMGGAKRAELIAVLELARRAMAERLKERTVFDSPGTVKQYLQLHIGSRPYEVFAVLFLDAQHRLIVL
RADC_HAHCH      QIPGLGEAKFTQLQAATELAKRYLQEKMQRSHNLTSPELTREYLSAHLRHYPYEVFAALFLDNQHRVIAY
RADC_FUSNN      TIDGLGKNSITFLKLLGELPSIIYKDELIDKETLKISNKLLKYLRNKIGYEEIEKFYVIYLSSSNEVIEF
RADC_NOSP7      LISGVGPAKATSILAAIELGKRAFQSRPNDGTLIDSPLAAAATLSQDLMWQTQERFAVVLLDVKNRLLGT
RADC_PSEF5      RQLGLGPAKYALLQAVLEMARR-HLAEKLHRQSALENPLVVRDLKSMLRHEPHEVFGCLFLDTRHRVLTF
RADC_ANAVT      QIPGIGPAKATSILAAVELGKRTFQFRPLDKTPIDSPVAAVAALSQDLMWQNQERFAVLLLDVKNRLLGT
RADC_VIBHB      QHKGLGQAKYVQLQAVLEMTQR-YLAETLKRGDALTSPEQTKYLSSILRDRQREAFYILFLDNQHRVIKD
RADC_ANASP      QIPGIGPAKATSILAAVELGKRTFQFRPLDKTPIDSPVAAVAALSQDLMWQNQERFAVLLLDVKNRLLGT
RADC_XANCP      RLPGLGPASACKLSAALELANRHLLSDLERGEALSDPSSVGRYFSQRLRARNYEVFAALFLDSRHRAIAF
RADC_XANC8      RLPGLGPASACKLSAALELANRHLLSDLERGEALSDPSSVGRYFSQRLRARNYEVFAALFLDSRHRAIAF
RADC_IDILO      ACNGIGPARVNQLRVVLELSRRYLKWQLERSDGFTEPTMVKDYLTSQLRHQGREVFAILLLDSQHRLLRY
RADC_SILPO      EVKGVGEAVITDLKILEASAHRMARARVMQRQVISSWDALLDYCHTTMAHRETEQFRVFYLDRKNVLIAD
RADC_SERP5      SHKGLGNSSYSQLQAISELAFRFFSSHLAQENAMLNPRMTQHYLQSLLVHHEREVFLVLFLDNQHRVIRH
RADC_NITOC      HAPGLGIAKYTQLQACLEMGRR-HLEDTLKRGDVLTDQTTQRYLVARLRAYPFEVFSCLFLDNRHRVLAF
RADC_XANC5      RLPGLGPASACKLAAAMELAQR-HLMSALERGEALSDPSVGRYFSQRLRARAYEVFAALFLDNRHRAIAF
RADC_BURS3      AHPGIGPARSARLVAVTEIARRMLKEKAHEKQPIDSPGAVEDYLRLKIGARPYEVFAAVYLDARHRLIDM
RADC_ALHEH      DHLGLGPAKFTQLQAVLEMARR-HLHAGLEREALTSPEQVARYLTARLRHQSREIFACLFLDNRHRVVRY
RADC_THISH      SARGLGSAKYAQLQAVLEMGRR-HLSESLARGDALTSPDDTRRLAARLRDYPFEVFACLFLDNRHRVIAF
RADC_PELPD      XXXXXXXXXXXXXXXXFTLASRFQGRRLENLDRFTSPRQVFDYFHYELRDCRREYFLVLLLDGKNRIIRR
RADC_XANAC      RLPGLGPASACKFAAAMELAQR-HLMSALERGEALSDPSVGRYFSQRLRARAYEVFAVLFLDNRHRAIAF
RADC_LARHH      SSPGLGPAKACXXXXXXXXXXXXXXXKLPVADALTSPQAVHDYLRLAYGMRVQEVVXXXXXXXXXXXXXV
RADC_SYMTH      -VKGLGPAKVCTILAGLHLGLRASA-APLRRVDLCNPRAVFEFLAPRMAHLSIEQFHVILLNAKNQVIDV
RADC_ACAM1      TIQGIGPAKATTILAAIELGKRICQARPPELTVIDDPXXXXXXXXGELMWQSQERFAVLLLDVKHRLLGT
RADC_RHIME      EVKGVGESVALDLKLVATASHRMLRSELRNKQVLSSWSAVIDYCHAAMAHETKEQFRILFLDKRNTLIAD
RADC_ALCBS      HLPGMG-VXXXXXXXXXXXXXXXXXXEPLERGLPLDNDKAGQLLTAQLRGLPFEVFACLFLDNKHRLIAF
RADC_RHOCA      EVTGVGEAVVQELKIVEAAAQRLARSRVLQRPVLSSWQALLDYCHTAMAHRPTEQFRVLFLDRKNLLIAD
RADC_SHEB9      RLPGVGPVK-YXXXXXXXXXXXXXXXXNLQRGQVLTNPDLTRDLMRQLADRSYEVFAVLLLDSQHRVIQF
RADC_SHEB5      RLPGVGPVK-YXXXXXXXXXXXXXXXXNLQRGQVLTNPDLTRDLMRQLADRSYEVFAVLLLDSQHRVIQF
RADC_SHEB2      RLPGVGPVK-YXXXXXXXXXXXXXXXXNLQRGQVLTNPDLTRDLMRQLADRSYEVFAVLLLDSQHRVIQF
RADC_METHJ      TLNGIGPTKAAVLMACFELANRYGTPAEKERIRITEPDHILKISETDLSGKSQEHFLVTTLNGASEVICT
RADC_SHEB8      RLPGVGPVK-YXXXXXXXXXXXXXXXXNLQRGQVLTNPDLTRDLMRQLADRSYEVFAVLLLDSQHRVIQF
RADC_PSEPG      REPGIGMVKYAQLQALLEIGRRYLDENIKRAAALDGPAAVRRYLKAMLRHEVSEVFGCLFLDSKHRPLAF
RADC_BORPA      VVPGLGTAKACVLAAVLELARRTLEEDLVRQDALANPDLVRRYCQAALGHRKVEHCIALYLDARLKLIIC
RADC_BORBR      VVPGLGTAKACVLAAVLELARRTLEEDLVRQDALANPDLVRRYCQAALGHRKVEHCIALYLDARLKLIIC
RADC_XYLFT      RLPGLGLARACKLTAALELSTRHLAAALQRGASIHDPISAGRYFAQRLRANPNEVFAVLFLDNRHRAISF
RADC_SHESW      RLPGVGPVK-YXXXXXXXXXXXXXXXXNLQRGQVLTNPDLTRDLMRQLTDRSYEVFAILLLDSQHRVIQF
RADC_SHEPC      RLPGVGPVK-YXXXXXXXXXXXXXXXXNLQRGQVLTNPDLTRDLMRQLTDRSYEVFAILLLDSQHRVIQF
RADC_XYLFA      RLPGLGLARACKLTAALELSTRHLAAALQRGASIHDPISAGRYFAQRLRANPNEVFAVLFLDNRHRAISF
RADC_PARDP      EVSGLGPAVLQELKIVEAAAQRLARSRVMHRPVLTSWDALLDYCHTAMAHGEIEQFRVLYLDRKNVLIAD
RADC_SHESR      RLPGVGPVK-YXXXXXXXXXXXXXXXXNLQRGQVLTNPDLTRDLMRQLADRSYEVFAILLLDSQHRVIQF
RADC_SHESA      RLPGVGPVK-YXXXXXXXXXXXXXXXXNLQRGQVLTNPDLTRDLMRQLADRSYEVFAILLLDSQHRVIQF
RADC_SHEON      RLPGVGPVK-YXXXXXXXXXXXXXXXXNLQRGQVLTNPDLTRDLMRQLADRSYEVFAILLLDSQHRVIQF
RADC_SHESM      RLPGVGPVK-YXXXXXXXXXXXXXXXXNLQRGQVLTNPDLTRDLMRQLADRSYEVFAILLLDSQHRVIQF
RADC_RHILW      EVKGVGEAVALDLKLISTVAHRTLKSELRSKQVLSSWSSVIQYCHAAMAHETREQFRILFLDKRNVLIAD
RADC_RHIE6      EVKGVGENVALDLKLISTVAHRTLKSEIRSKQVLSSWSSVIQYCHAAMAHETREQFRILFLDKRNVLIAD
RADC_DIAST      RIKGLGPAKRAELMAVLELARRAMAQQLREREVFDSPQAVQHYLQLHLAGRTHEVFAVLFLDSGNRLIAM
RADC_STRM5      RLPGLGPARSCTLAAGLELAHRYLAAELEHGEAVGNNPAVGRYLQHRLRGQAREIFMALFLDNRHRLIAC
RADC_BORA1      TEPGLGVAKACSLLVAPELSRRSIEETLLGRQAMKHPEEVRRYCLTALAHQPVEHCIAXXXXXXXXXXAC
RADC_STRMK      RLPGLGPARSCTLAAGLELAHRYLAAELEHGEAVGNNPAVGRYLQHRLRGQAREVFMALFLDNRHRLIAC
RADC_RHIL3      EVKGVGEAVALDLKLISTVAHRTLKSELRTKQVLSSWSSVIQYCHAAMAHETREQFRILFLDKRNVLIAD
RADC_METMA      QVNXXXXXXXXXXXXVFELARRLETFVEEPKRKISSPKDVYTLMYPKMREQKKEKFITLYLDTKNQILKE
RADC_RHOP2      EVSGLGEAAITEIKLVAAAAARVTKGQVKSRTVLSSWSAVIDYCRTTMAFADREQFRILFLDKRNQLIAD
RADC_RHIEC      EVKGVGENVALDLKLIATVAHRTLKSEIRSKQVLSSWSSVIQYCHAAMAHETREQFRILFLDKRNVLIAD
RADC_CUPTR      XVRGMGAAKFAQVQAIXXXXXXXXXXXXXXXXGFDSPDSVRSYLRLTLAPLQHEVFMCLFLDPGNRMVAS
RADC_SINMW      EVKGVKESVALDLKLVATASHRMLKSELRNKQVLSSWSAVIDYCHAAMAHETKEQFRILFLDKRNTLIAD
RADC_RHISN      EVKGVGEAVALDLKLIATAAQRTLKSELRNKQVLSSWSAVIDYCHAAMAHETKEQFRILFLDKRNALIAD
RADC_ACIAC      RIKGLGPAKRTSLVAVLELARRMLAQTLPKRDLFHSPRAVRDYLQLHLGGKPHEVFSVLFLDSQNGLIAM
RADC_LEGPH      SIHGLGEVRYAQLQAAKEICHRIHLQKEIRLSNTQQTYAFLKK---RLRDYKNETFAALFLDNQHRIIAY
RADC_LEGPC      SIHGLGEVRYAQLQAAKEICHRSDFIDLQKEIQLSNTQQTYAFLKKRLRDYKNETFAALFLDSQHRIIAY
RADC_LEGPA      SIHGLGEVRYAQLQAAKEICHRSDFIDLQKEIRLSNTQQTYAFLKKRLRDYKNETFAALFLDNQHRIIAY
RADC_LEGPL      SIHGLGEVRYAQLQAAKEICHRSDFIDLQKEIRLSNTQQTYAFLKKRLRDYKNETFAALFLDNQHRIIAY
RADC_THIDA      RAPGVGEAKYALLQAVMEMARRTLAEDMQAGDALSSPAAVRDYLRLILRDKEYEVFCCVFLNAQNRVIAV
RADC_RUBXD      QVKGIGEXXXXXXXXXXXXXXXXXXXXNPGRPVISSPADVDGLLRGRIANLDREHFVVVLLNTKNEVIEA
RADC_OCHA4      EVPGAGPTVAHELKLVEAVAKRSARSTVMEREVLGSWNKVIEYCTAAMAYETREQFRILFLDKKNKLIAD
RADC_CHRVO      XXXXXGEAKYAQLMACTELARRALSEQMRLGDALSSPQQVRDYLRLSIGRREVETFVVIFLSAQNRLIEV
RADC_BURTA      GLRGIGPARTAIXXXXXXXXXXXXXXXXXXXXXVDSPGAVDDYLRLLIGTRPREVFVCLFLDARHRLVQT
RADC_XANOM      RLPGLGPASACKXXXXXXXXXXXXMSALERGEALSDPPSVGRYFSQRLRARAYEVFAVLFLDNRHRAIAF
RADC_XANOR      RLPGLGPASACKXXXXXXXXXXXXMSALERGEALSDPPSVGRYFSQRLRARAYEVFAVLFLDNRHRAIAF
RADC_XANOP      RLPGLGPASACKXXXXXXXXXXXXMSALERGEALSDPPSVGRYFSQRLRARAYEVFAVLFLDNRHRAIAF
RADC_CHRSD      AEHGLGEAKYVQLQASLELSRR-HLGSLLERGAALTSPTLVRRLTSQLRHLPHEAFAALFLDTQHRVIRF
RADC_SALRD      RTRGVGPXXXXXXXXXXXXGRRVEQRQQDERMQVTCPADVADVYGPLLRDLDKEVFKVVHLNTANVIIGD
RADC_BURP6      GLRGIGPARTAIXXXXXXXXXXXXXXXXXXXXXVDSPGAVDDYLRLLIGTRPREVFVCLFLDARHRLVQT
RADC_BURP1      GLRGIGPARTAIXXXXXXXXXXXXXXXXXXXXXVDSPGAVDDYLRLLIGTRPREVFVCLFLDARHRLVQT
RADC_BURP0      GLRGIGPARTAIXXXXXXXXXXXXXXXXXXXXXVDSPGAVDDYLRLLIGTRPREVFVCLFLDARHRLVQT
RADC_BURMS      GLRGIGPARTAIXXXXXXXXXXXXXXXXXXXXXVDSPGAVDDYLRLLIGTRPREVFVCLFLDARHRLVQT
RADC_BURMA      GLRGIGPARTAIXXXXXXXXXXXXXXXXXXXXXVDSPGAVDDYLRLLIGTRPREVFVCLFLDARHRLVQT
RADC_BURM9      GLRGIGPARTAIXXXXXXXXXXXXXXXXXXXXXVDSPGAVDDYLRLLIGTRPREVFVCLFLDARHRLVQT
RADC_BURM7      GLRGIGPARTAIXXXXXXXXXXXXXXXXXXXXXVDSPGAVDDYLRLLIGTRPREVFVCLFLDARHRLVQT
RADC_BURA4      THPGIGTARSAVLIAVTEIARRALVEKARERLQIDSPGAVEDYLRLRIGTRPHEVFVTLYLDARHGLIDV
RADC_HALHL      ARPGLGDAKYAQMQAALEIARR-HLGEQLQRGPTLSSPAQTRTLAALLRDHPSEVFGGLFLDNRHRVIGF
RADC_BURCM      THPGIGTARSAVLIAVTEIVRRALVEKARERLQIDSPGAVEDYLRLRIGTRPHEVFVTLYLDARHGLIDV
RADC_AGRT5      EVKGVGEAVALDLKLVASVSQRMLKSEIRNKQVLGSWSSVIDYCHAAMAHETREQFRILFLDKRNVLIAD
RADC_BRUSU      EIPGAGPTVALELKLVEAIAKRSARSTVMEREVLGSWDKVINYCTAAMAFETREQFRILFLDKKNKLIAD
RADC_BRUME      EIPGAGPTVALELKLVEAIAKRSARSTVMEREVLGSWDKVINYCTAAMAFETREQFRILFLDKKNKLIAD
RADC_BRUMB      EIPGAGPTVALELKLVEAIAKRSARSTVMEREVLGSWDKVINYCTAAMAFETREQFRILFLDKKNKLIAD
RADC_BRUC2      EIPGAGPTVALELKLVEAIAKRSARSTVMEREVLGSWDKVINYCTAAMAFETREQFRILFLDKKNKLIAD
RADC_BRUAB      EIPGAGPTVALELKLVEAIAKRSARSTVMEREVLGSWDKVINYCTAAMAFETREQFRILFLDKKNKLIAD
RADC_BRUA2      EIPGAGPTVALELKLVEAIAKRSARSTVMEREVLGSWDKVINYCTAAMAFETREQFRILFLDKKNKLIAD
RADC_BRUA1      EIPGAGPTVALELKLVEAIAKRSARSTVMEREVLGSWDKVINYCTAAMAFETREQFRILFLDKKNKLIAD
RADC_POLNA      SIKGLGPAKRAEIXXXXXXXXXXXXXXXXXXXXFTTPQAVRDYLQLQLGSRPHEIFAVLFLDSQHRLIAL
RADC_ROSCS      QRRGMGEAKTAQLKAALEIGRRLLLASGEERFQIRSPTDAAQLMQIEMSHLDQEQLRAICLDTKNRVQKI
RADC_VEREI      RIKGLGPAKXXXXXXXXXXXXXXXXXXXXECAVFDTPDAVKHYLQLQLAAKGHEVFAVLFLDNQNRLLAM
RADC_LEPCP      TVKGLGPAKRSELQAVLELARRAIVSQLAQRPVFDSPQAVRDYLRLQLGRLDHEVFAVLFLDAQHRLIAY
RADC_ROSS1      QRRGMGEAKTAQLKAALEIGRRLLLAGGDERFLIRSPTDAAQLMQIEMSHLDQEQLRAICLDTKNRVQKI
RADC_ACISJ      RIKGLGPAKXXXXXXXXXXXXXXXXXXXXXXXVFDSPQAVQHYLQLHLAGRTHEVFAVLFLDSGNRLIAM
RADC_POLSJ      SIKGLGPXXXXXXXXXXXXXXXXXXXXXXXXXXFSTPQAVRDYLQLQLGGRPHEIFAVLFLDSQHRLIAL
RADC_METPP      SVKGLGPAKRAELAAVLEIARRSLASRLAQTPVFDSPQAVKDYLQLQLASKPHEVFAVLFLDTQHRLLAF
YFJY_ECOLI      -----------------------------------STQAARDWLKLKMAGLEREEFMMLYLNQQNQLIAH
RADC_BORPD      SLPXXXXXXXXXXXXXXXXXXXXXXXXXMRQQAMSEPGSVKRYFKTALANCAVEHCLALYLDSQLNLITS
Y1786_VIBCH     ------------------LSQRAYEHRVLEEETFARTENTTEYLRCKLAGYEHEIFAVLFLDNQHRLIEF
YKFG_ECOLI      -----------------------------------STHAVREWLRLHMAALEREEFRVLYLDNQNQLIAH
Y510_VIBCH      ----------------------------------------------KLGSYEREVFALLLLDNQNRLIEF
YEES_ECOLI      ---------------------------------------------------EREEFRVLYLNNQNQLIAG
DNLJ_AQUAE      RLEGIGYKVARSIKEFFNIPQNLEVLKKLEKAGV----NLAKKVKEKVAD--------------------


                         +         .         .         .         .         *         .:210
query           XXXXXGSVTRSIAEPREILHYAIKHMATSLILVHNHPSGAVAPSQNDDHVTKLVKEACELMGIVLLDHLI
RADC_STRZT      XXXXXGSVTRSIAEPREILHYAIKHMATSLILVHNHPSGAVAPSQNDDHVTKLVKEACELMGIVLLDHLI
RADC_STRZP      XXXXXGSVTRSIAEPREILHYAIKHMATSLILVHNHPSGAVAPSQNDDHVTKLVKEACELMGIVLLDHLI
RADC_STRPN      XXXXXGSVTRSIAEPREILHYAIKHMATSLILVHNHPSGAVAPSQNDDHVTKLVKEACELMGIVLLDHLI
RADC_STRPJ      XXXXXGSVTRSIAEPREILHYAIKHMATSLILVHNHPSGAVAPSQNDDHVTKLVKEACELMGIVLLDHLI
RADC_STRPI      XXXXXGSVTRSIAEPREILHYAIKHMATSLILVHNHPSGAVAPSQNDDHVTKLVKEACELMGIVLLDHLI
RADC_STRP7      XXXXXGSVTRSIAEPREILHYAIKHMATSLILVHNHPSGAVAPSQNDDHVTKLVKEACELMGIVLLDHLI
RADC_STRP4      XXXXXGSVTRSIAEPREILHYAIKHMATSLILVHNHPSGAVAPSQNDDHVTKLVKEACELMGIVLLDHLI
RADC_STRR6      XXXXXGSVTRSIAEPREILHYAIKHMATSLVLVHNHPSGAVAPSQNDDHVTKLVKEACELMGIVLLDHLI
RADC_STRP2      XXXXXGSVTRSIAEPREILHYAIKHMATSLVLVHNHPSGAVAPSQNDDHVTKLVKEACELMGIVLLDHLI
RADC_STRZJ      XXXXXGSVTRSIAEPREILHYAIKHMATSLILVHNHPSGAVAPSQNDDHVTKLVKEACELMGIVLLDHLI
RADC_STRGC      XXXXXGSLTRSLAEPREILHYAIKHMATSIILVHNHPSGATRPSRDDDQVTEKIKEACEMMGFVLLDHLI
RADC_STRSV      QTIFMGTVSRSIAEPREILHYALKHLATSIILVHNHPSGSVVPSRNDDEVTQHMKEACEMMGLVLLDHLI
RADC_STRS2      KTIFIGSVNRSIAEPREILHYAVKCMATSIIIVHNHPSGSVQPSRNDLLFTENLKESCEKLGLVLLDHLI
RADC_STRA5      RTIFIGTVRRSVAEPREILHYACKNMATSLIIIHNHPSGSPKPSESDLSFTKKIKRSCDHLGIVCLDHII
RADC_STRA1      RTIFIGTVRRSVAEPREILHYACKNMATSLIIIHNHPSGSPKPSESDLSFTKKIKRSCDHLGIVCLDHII
RADC_STRA3      RTIFIGTVRRSVAEPREILHYACKNMATSLIIIHNHPSGSPNPSESDLSFTKKIKRSCDHLGIVCLDHII
RADC_STRU0      KTIFIGSVRRSIAEPREILHFACRNMATSLIVVHNHPSGLTNPSENDVAFTKKIKRSCDHLGINCLDHII
RADC_STRTD      KTVFIGGVRRSIAEPREILHYACHLMATSLIVVHNHPSGEAYPSRNDIDFTQKIKRSCDDLGICLLDHLI
RADC_STRT2      KTVFIGGVRRSIAEPREILYYACHLMATSLIVVHNHPSGEAYPSRNDIDFTQKIKRSCDDLGICLLDHLI
RADC_STRT1      KTVFIGGVRRSIAEPREILYYACHLMATSLIVVHNHPSGEAYPSRNDIDFTQKIKRSCDDLGICLLDHLI
RADC_STRPZ      KTIFIGTVRRSLAEPREILYYACKNMATSLIVIHNHPSGNIEPSSNDYCFTEKIKRSCEDLGIICLDHII
RADC_STRPM      KTIFIGTVRRSLAEPREILYYACKNMATSLIVIHNHPSGNIEPSSNDYCFTEKIKRSCEDLGIICLDHII
RADC_STRPG      KTIFIGTVRRSLAEPREILYYACKNMATSLIVIHNHPSGNIEPSSNDYCFTEKIKRSCEDLGIICLDHII
RADC_STRPF      KTIFIGTVRRSLAEPREILYYACKNMATSLIVIHNHPSGNIEPSSNDYCFTEKIKRSCEDLGIICLDHII
RADC_STRPD      KTIFIGTVRRSLAEPREILYYACKNMATSLIVIHNHPSGNIEPSSNDYCFTEKIKRSCEDLGIICLDHII
RADC_STRPC      KTIFIGTVRRSLAEPREILYYACKNMATSLIVIHNHPSGNIEPSSNDYCFTEKIKRSCEDLGIICLDHII
RADC_STRPB      KTIFIGTVRRSLAEPREILYYACKNMATSLIVIHNHPSGNIEPSSNDYCFTEKIKRSCEDLGIICLDHII
RADC_STRP8      KTIFIGTVRRSLAEPREILYYACKNMATSLIVIHNHPSGNIEPSSNDYCFTEKIKRSCEDLGIICLDHII
RADC_STRP1      KTIFIGTVRRSLAEPREILYYACKNMATSLIVIHNHPSGNIEPSSNDYCFTEKIKRSCEDLGIICLDHII
RADC_STRP6      KTIFIGTVRRSLAEPREILYYACKNMATSLIVIHNHPSGNIEPSSNDYCFTEKIKRSCEDLGIICLDHII
RADC_STRP3      KTIFIGTVRRSLAEPREILYYACKNMATSLIVIHNHPSGNIEPSSNDYCFTEKIKRSCEDLGIICLDHII
RADC_STRS7      KTIFIGTVRKSIAEPREILYYACKNMATSLIVVHNHPSGLTKPSANDYHFTEKIKRSCDYLGLICLDHII
RADC_STREM      KTIFIGTVRKSIAEPREILYYACKNMATSLIVVHNHPSGLTKPSANDYHFTEKIKRSCDYLGLICLDHII
RADC_STRE4      KTIFIGTVRKSIAEPREILYYACKNMATSLIVVHNHPSGLTKPSANDYHFTEKIKRSCDYLGLICLDHII
RADC_ENTFA      KTIFKGSLNQSIAHPREIFREAVKYSSARILLAHNHPSGNPTPSPQDIQFTKRMEECGEMMGIQLLDHII
RADC_LACLA      KTIFIGAVNQATASPREILYHAIKNLSVGLLVAHNHPSGNLKPSQADKIFTTKIKKSCEDVGINFIDHII
RADC_GEOKA      KTVFIGSLNASIVHPREVFKEAIKRSAASVICVHNHPSGDPTPSREDIDVTKRLAECGRIIGIELLDHLI
RADC_GEOTN      KTVFIGSLNASIVHPREVFKEAIKRSAASVICVHNHPSGDPTPSREDIDVTKRLAECGRIIGIELLDHLI
RADC_LACSS      KQLYLGTLNSSVAHPREVFKWAVQYSAAKFILVHNHPSGQLAPSTQDINFTKRIVNCGQLMGITCLDHLI
RADC_BACSK      KTLFIGSLNASIVHPREVFKEALQSSSASVICLHNHPSGDPSPSPEDISVTKRLRQAGAILGIELLDHII
RADC_BACLD      RTVFIGSLNSSIVHPREVFKEALKRSAASFICVHNHPSGDPAPSREDIEVTQRLHESGQLLGIELLDHII
RADC_BACSU      RTVFIGSLNSSIVHPREVFKEAFKRSAASFICVHNHPSGDPTPSREDIEVTRRLFECGNLIGIELLDHLV
RADC_BACHD      QTVFIGSLNASIVHPREVFKEALRRSAASLICLHNHPSGDPTPSREDIEVTHRLAQVGKLIGIELLDHVI
RADC_BACA2      RTVFIGSLNSSIVHPREVFKEAFKRSAASFICVHNHPSGDPTPSREDIEVTRRLFECGNLIGIELLDHLV
RADC_GEOSW      KTIFIGSLNASIVHPREVFKEAIKRSAASIICVHNHPSGDPTPSREDIDVTKRLAECGRIIGIELLDHLI
RADC_BACHK      QTIFIGSLNSSIVHPREVFKEAFRRAAASIICLHNHPSGDPAPSREDIEVTKRLVECGRIIGIEVLDHII
RADC_BACC3      QTIFIGSLNSSIVHPREVFKEAFRRAAASIICLHNHPSGDPAPSREDIEVTKRLVECGRIIGIEVLDHII
RADC_BACAN      QTIFIGSLNSSIVHPREVFKEAFRRAAASIICLHNHPSGDPAPSREDIEVTKRLVECGRIIGIEVLDHII
RADC_BACAC      QTIFIGSLNSSIVHPREVFKEAFRRAAASIICLHNHPSGDPAPSREDIEVTKRLVECGRIIGIEVLDHII
RADC_BACAA      QTIFIGSLNSSIVHPREVFKEAFRRAAASIICLHNHPSGDPAPSREDIEVTKRLVECGRIIGIEVLDHII
RADC_LACLM      KTIFIGAFNHATASPREILYHAVKNLSVGLLVAHNHPSGNLQPSQADKIFTKKIKNACDNIGINFIDHII
RADC_BACCZ      QTIFIGSLNSSIVHPREVFKEAFRRAAASIICLHNHPSGDPAPSREDIEVTKRLVECGRIIGIEVLDHII
RADC_BACCQ      QTIFIGSLNSSIVHPREVFKEAFRRAAASIICLHNHPSGDPAPSREDIEVTKRLVECGRIIGIEVLDHII
RADC_BACC7      QTIFIGSLNSSIVHPREVFKEAFRRAAASIICLHNHPSGDPAPSREDIEVTKRLVECGRIIGIEVLDHII
RADC_BACC1      QTIFIGSLNSSIVHPREVFKEAFRRAAASIICLHNHPSGDPAPSREDIEVTKRLVECGRIIGIEVLDHII
RADC_STAES      AWVYKGTLNSSIIHPREVFNIAIRESSNSIIVVHNHPSGDVTPSKEDITTTYRLKECGDILGINLLDHII
RADC_BACP2      HTVFIGSLNSSIVHPREIFKEAFKRSAASFICVHNHPSGDPTPSREDIEVTQRLFECGKLIGIQLLDHLV
RADC_BACC2      QTIFIGSLNTSIVHPREVFKEAFRRAAASIICLHNHPSGDPTPSREDIEVTKRLVECGQIIGIEVLDHII
RADC_BACC4      QTIFIGSLNTSIVHPREVFKEAFRRAAASIICLHNHPSGDPTPSREDIAVTKRLVECGQIIGIEVLDHII
RADC_THEMA      NTLTVGTSDRSLIHPRDVFRTAIRANASGVIVVHNHPSGDPTPSKEDRLITERLKQAGEILGVSLVDHVI
RADC_THEP1      NTLTVGTSDRSLIHPRDVFRTAIRANASGVIVVHNHPSGDPTPSKEDRLITERLKQAGEILGVSLVDHVI
RADC_CHLP8      ESVTVGTLTSSLIHPREIFKAAIRQSAHSIILVHNHPSGDVQPSNADKQVTSILKKSGDLLQIALLDHVI
RADC_BACWK      QTIFIGSLNTSIVHPREVFKEAFRRAAASIICLHNHPSGDPAPSREDIEVTKRLVECGRIIGIEVLDHII
RADC_STAHJ      ETIYKGTLNSSVIHPREVFKAAIRASSNAIIVLHNHPSGDVTPSKEDIETTIRLKECGELLGIQVLDHII
RADC_CLOK5      KNVFIGTLNSSIVHPREIFFYAIKKNSASIILCHNHPSGDPSPSNEDVNVTFRLKKCGELLGIQLVDHLI
RADC_CLOK1      KNVFIGTLNSSIVHPREIFFYAIKKNSASIILCHNHPSGDPSPSNEDVNVTFRLKKCGELLGIQLVDHLI
RADC_PROA2      EIISVGTLNASLIHPREIFKEAIRESAHAIIVVHNHPSGDVEASNADKQVTAVLKKAGSLLQIELLDHVI
RADC_CHLTE      ETITIGTLTASLIHPREIFKAAIRESAHSIILVHNHPSGDVQPSNADKQVTSILKKAGDLLQIELLDHVI
RADC_PROVI      EEVTIGTLNASLIHPREVFKAAIRESANAIILVHNHPSGDTEPSNADRQVTNLLKQASAVIQIDLLDHVI
RADC_ALKMQ      ENISIGSLNASIVHPREVFVVAIKRSSSAIILVHNHPSGDPSPSGEDIRITKRLVEAGKLLGIEVLDHII
RADC_PELPB      ELVSVGTLNAALIHPREVFKSAIKESSHAIILVHNHPSGDVEPSNADKQVTDLLKQASTVIQIDLLDHII
RADC_FLAJ1      AQLSKGGIAGTIVDVRLVFKLGLENGATGLILCHNHPSGELNPSQADKQITKKIKTAGEILDVKILDHLI
RADC_CLOTE      KDVFIGSLNSSIVHPREIFLEAIKNNSYSIIICHNHPSGDTTPSKEDINVSNRIKECGKLIGIELLDHII
RADC_LISMH      QTIFVGGLNASIVHPREVFRLALRKSAASIMCFHNHPSGDPAPSSEDLLVTKRLAEAGNIVGITLLDHII
RADC_CLOPS      KEIFKGGLNSSLVHPREIFKEAVKDSAASIIICHNHPSGDPTPSRDDINITTRLKECGKMMGIELLDHLI
RADC_CLOAB      SDVSVGSLNSSIVHPREVYVEPILKHAASIILCHNHPSGDPKPSNEDLNITKRLYECSKFIGIELLDHII
RADC_LISMO      QTIFVGGLNASIVHPREVFRLALRKSAASIMCFHNHPSGDPTPSSEDLLVTKRLAEAGNIVGITLLDHII
RADC_LISMF      QTIFVGGLNASIVHPREVFRLALRKSAASIMCFHNHPSGDPTPSSEDLLVTKRLAEAGNIVGITLLDHII
RADC_LISMC      QTIFVGGLNASIVHPREVFRLALRKSAASIMCFHNHPSGDPTPSSEDLLVTKRLAEAGNIVGITLLDHII
RADC_CLOPE      KEIFKGGLNSSLVHPREIFREAVKDSAASIIICHNHPSGDPTPSRDDINITTRLKECGKMMGIELLDHLI
RADC_CLOP1      KEIFKGGLNSSLVHPREIFREAVKDSAASIIICHNHPSGDPTPSRDDINITTRLKECGKMMGIELLDHLI
RADC_SALAR      SRLFSGTLSHVEVHPREIVREAIKLNASAVILAHNHPSGCAEPSKADKHITDRVIKCCQFMDIRVLDHLI
RADC_ENT38      SRMFSGTLRHVEVHPREIVREAIKVNAAAVILAHNHPSGCAEPSKADKDITERIIKCCQFMDIHVLDHFI
RADC_ACTPJ      EKMFYGTINQATVYPREIIKEALKCNAAAIIVAHNHPSGNCTPSESDRALTKKLEMACDLVGIRFVDHIV
RADC_ACTP7      EKMFYGTINQATVYPREIIKEALKCNAAAIIVAHNHPSGNCTPSESDRALTKKLEMACDLVGIRFVDHIV
RADC_ACTP2      EKMFYGTINQATVYPREIIKEALKCNAAAIIVAHNHPSGNCTPSESDRALTKKLEMACDLVGIRFVDHIV
RADC_LISIN      QTIFVGGLNASIVHPREVFRLALRKSSASIMCFHNHPSGDPAPSSEDLLVTKRLAEAGNIVGITLLDHII
RADC_FINM2      ELISKGTINQSIVHPREVFKSAIKKGANSIILVHNHPSGSLIPSNADIEVTKRLDKVGDLVGIQVLDHII
RADC_CLOBA      KDVFKGSLNTSIVHPREIFKEAVNKSSTKIIICHNHPSGDPTPSKEDINITLRIKECGEIMGIQLLDHII
RADC_SYNWW      QDISIGGLHSSIVHPREVFKTAVKKSAASMILVHNHPSGDPTPSQEDIEITRRLIEAGKIMGIEILDHVI
RADC_SALTY      SRLFSGTLNHVEVHPREIVREAIKLNASAVILAHNHPSGCAEPSKADKLITERVIKCCQFMDIRVLDHLI
RADC_SALTI      SRLFSGTLNHVEVHPREIVREAIKLNASAVILAHNHPSGCAEPSKADKLITERVIKCCQFMDIRVLDHLI
RADC_SALSV      SRLFSGTLNHVEVHPREIVREAIKLNASAVILAHNHPSGCAEPSKADKLITERVIKCCQFMDIRVLDHLI
RADC_SALPK      SRLFSGTLNHVEVHPREIVREAIKLNASAVILAHNHPSGCAEPSKADKLITERVIKCCQFMDIRVLDHLI
RADC_SALPC      SRLFSGTLNHVEVHPREIVREAIKLNASAVILAHNHPSGCAEPSKADKLITERVIKCCQFMDIRVLDHLI
RADC_SALPA      SRLFSGTLNHVEVHPREIVREAIKLNASAVILAHNHPSGCAEPSKADKLITERVIKCCQFMDIRVLDHLI
RADC_SALHS      SRLFSGTLNHVEVHPREIVREAIKLNASAVILAHNHPSGCAEPSKADKLITERVIKCCQFMDIRVLDHLI
RADC_SALG2      SRLFSGTLNHVEVHPREIVREAIKLNASAVILAHNHPSGCAEPSKADKLITERVIKCCQFMDIRVLDHLI
RADC_SALEP      SRLFSGTLNHVEVHPREIVREAIKLNASAVILAHNHPSGCAEPSKADKLITERVIKCCQFMDIRVLDHLI
RADC_SALDC      SRLFSGTLNHVEVHPREIVREAIKLNASAVILAHNHPSGCAEPSKADKLITERVIKCCQFMDIRVLDHLI
RADC_SALCH      SRLFSGTLNHVEVHPREIVREAIKLNASAVILAHNHPSGCAEPSKADKLITERVIKCCQFMDIRVLDHLI
RADC_SALA4      SRLFSGTLNHVEVHPREIVREAIKLNASAVILAHNHPSGCAEPSKADKLITERVIKCCQFMDIRVLDHLI
RADC_COPPD      VEISVGSSIQTTVDPKEILKQVSLTSAQALILIHNHPSGDPSPSREDVAVTKQLKQACELVGAQLLDHII
RADC_ECOHS      SRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADKLITERIIKSCQFMDLRVLDHIV
RADC_SHIFL      SRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADKLITERIIKSCQFMDLRVLDHIV
RADC_SHIF8      SRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADKLITERIIKSCQFMDLRVLDHIV
RADC_SHIDS      SRIFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADKLITERIIKSCQFMDLRVLDHIV
RADC_SHIBS      SRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADKLITERIIKSCQFMDLRVLDHIV
RADC_SALNS      SRLFSGTLNHVEVHPREIVREAIKLNASAVILAHNHPSGCAEPSKADKLITERVIKCCQFMDIRVLDHLI
RADC_ESCF3      SRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADKLITERIIKSCQFMDLRVLDHIV
RADC_ECOUT      SRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADKLITERIIKSCQFMDLRVLDHIV
RADC_ECOSM      SRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADKLITERIIKSCQFMDLRVLDHIV
RADC_ECOLU      SRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADKLITERIIKSCQFMDLRVLDHIV
RADC_ECOLI      RRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADKLITERIIKSCQFMDLRVLDHIV
RADC_ECOL6      SRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADKLITERIIKSCQFMDLRVLDHIV
RADC_ECOL5      SRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADKLITERIIKSCQFMDLRVLDHIV
RADC_ECOK1      SRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADKLITERIIKSCQFMDLRVLDHIV
RADC_ECODH      RRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADKLITERIIKSCQFMDLRVLDHIV
RADC_ECOBW      RRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADKLITERIIKSCQFMDLRVLDHIV
RADC_ECO8A      SRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADKLITERIIKSCQFMDLRVLDHIV
RADC_ECO81      SRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADKLITERIIKSCQFMDLRVLDHIV
RADC_ECO7I      SRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADKLITERIIKSCQFMDLRVLDHIV
RADC_ECO5E      SRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADKLITERIIKSCQFMDLRVLDHIV
RADC_ECO57      SRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADKLITERIIKSCQFMDLRVLDHIV
RADC_ECO55      SRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADKLITERIIKSCQFMDLRVLDHIV
RADC_ECO45      SRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADKLITERIIKSCQFMDLRVLDHIV
RADC_ECO27      SRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADKLITERIIKSCQFMDLRVLDHIV
RADC_ECO24      SRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADKLITERIIKSCQFMDLRVLDHIV
RADC_CLOBB      KDVFKGSLNTSIVHPREIFKEAVNKSSAKIIISHNHPSGDPTPSKEDINITLRIKECGEIMGIQLLDHII
RADC_SYNP2      RVVTIGLATETLAHPREIFREVIKHGATRLIIAHNHPSGNVDPSPEDLQLTERLLQSAQILGIPLLDHLI
RADC_HAEIE      ERLFLGTINVSAVYPREIIKEALYCNAAALILAHNHPSGVTEPSYSDQLITKKIQDAAELMEICVLDHLI
RADC_ALKOO      ENISVGSLNASIVHPREVFNRAIKRSSSAIILAHNHPSGDPNPSGEDINITKRLIEAGNIIGISVLDHII
RADC_KLEP3      SRLFSGTLSHVEVHPREIVREAIKVNAAAVILAHNHPSGSPEPSQADRLITERVVKCCRFMEIRVLDHLV
RADC_CLONN      KDVSIGSLNSAIVHPREVFCEALKKNSASIVICHNHPSGDPTPSSEDINVTKRLKQCGIILGINLLDHLI
RADC_STAS1      KTIFMGTLNSAIVHPREIYSEAVKCASNAIIVLHNHPSGDTTPSLEDIKTTDRLRECGDILGIQLLDHVI
RADC_NITEC      EELFRGTLTQASVYPREVVKRALYHNAAAMIFAHNHPSGVAEPSRADEMLTQSLKQALALVDVKVLDHFV
RADC_HAEI8      ERLFLGTINVSAVYPREIIKEALYCNAAALILAHNHPSGITEPSYSDQLITKKIQDAAELMEIRVLDHLI
RADC_CHLSY      TTVYIGSLNSANVRVGEVFKEAVRRNSAAIIVVHNHPSGEPTPSMEDIEITRQLVSAGRLLDIEVVDHLI
RADC_CHLAA      TTVYIGSLNSANVRVGEVFKEAVRRNSAAIIVVHNHPSGEPTPSMEDIEITRQLVSAGRLLDIEVVDHLI
RADC_HAES2      EEMFLGTINQANVYPREIIKTALFCNAAALILAHNHPSGVSTPSMADRKMTENIKQLSELMEIRVLDHFI
RADC_HAES1      EEMFLGTINQANVYPREIIKTALFCNAAALILAHNHPSGVSTPSMADRKMTENIKQLSELMEIRVLDHFI
RADC_SHIB3      SRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADKLITERIIKSCQFMDLRVLDHIV
RADC_NITEU      EELFNGTLTQASVYPREVVKRALYHNAAAMIFAHNHPSGIAEPSTADEILTQSLKQALALVDVKVLDHFV
RADC_ACTSZ      EDMFRGTINAASVYPREIIKTALYCNAAALILAHNHPSGSAEPSASDKQMTKRIQAAAELMEIRVLDHFV
RADC_PASMU      EEMFLGTINCTTIHPREIIKSALFCNAAALILAHNHPSGNPEPSASDKMVTTKIQAAAELVEIRILDHFV
RADC_METBU      EVISIGSLNANIVHPREVFKSALMESSASVILTHNHPSGDPAPSREDIAVTEKLVEGGKILGISVLDHVI
RADC_KLEP7      SRLFSGTLSHVEVHPREIVREAIKVNAAAVILAHNHPSGSPEPSQADRLITERVIKCCRFMEIRVLDHLV
RADC_PORGI      ENLSRGGVSETSADVRLIMHKAVSHLASAIILAHNHPSGTVRPSEQDIQLTQRVQKAATLLGFRLNDHLI
RADC_MICAN      KVITIGTATETLVHPREIFREVVKQSATKLIIAHNHPTGSLVPSQDDILLTEQLLQGATYLAIPLLDHLI
RADC_STACT      EVIFVGTLNSSIVHPREVFKAAIKWSSNAIIVVHNHPSGDVTPSKEDILTTKRLQECGRVLGIELLDHII
RADC_HAEDU      EKMFYGTINQATVHPREIIKEALKCNAAAIIVAHNHPSGNCTASQADRQLTQKIKAACHLVEVRFVDHII
RADC_CLOB8      KDVFKGSLNTSVVHPREIFKQAISKNSASIIICHNHPSGDPTPSREDINITLRIKECGNIIGIQLVDHII
RADC_ENTS8      NTLFTGTLSHVEVHPREIVREAVRLNAAGIILAHNHPSGRAEPSRADKMVTERIVKSCQLVDIRVLDHLV
RADC_HAEIN      ERLFLGTIYVSAVYPREIIKEALYCNAAALILAHNHPSGITEPSYSDQLITKKIQDAAELMEIRVLDHLI
RADC_ACIBT      KKLFFGSVQHCAVSVNQTLRYALQQHACQLVIAHNHPFGSPQPSPEDIKLTQQLEQACQLVEIRLLDHFI
RADC_ACIB5      KKLFFGSVQHCAVSVNQTLRYALQQHACQLVIAHNHPFGSPQPSPEDIKLTQQLEQACQLVEIRLLDHFI
RADC_ACIB3      KKLFFGSVQHCAVSVNQTLRYALQQHACQLVIAHNHPFGSPQPSPEDIKLTQQLEQACQLVEIRLLDHFI
RADC_STAAW      TCVFKGTLNSSIVHPREIFSIAVRENANAIIAVHNHPSGDVTPSQEDIITTMRLKE--------------
RADC_STAAS      TCVFKGTLNSSIVHPREIFSIAVRENANAIIAVHNHPSGDVTPSQEDIITTMRLKE--------------
RADC_STAAE      TCVFKGTLNSSIVHPREIFSIAVRENANAIIAVHNHPSGDVTPSQEDIITTMRLKE--------------
RADC_STAAC      TCVFKGTLNSSIVHPREIFSIAVRENANAIIAVHNHPSGDVTPSQEDIITTMRLKE--------------
RADC_STAA8      TCVFKGTLNSSIVHPREIFSIAVRENANAIIAVHNHPSGDVTPSQEDIITTMRLKE--------------
RADC_STAA3      TCVFKGTLNSSIVHPREIFSIAVRENANAIIAVHNHPSGDVTPSQEDIITTMRLKE--------------
RADC_VIBF1      EILFEGTIDVAAVYPREVVKRSIDYNAAAIILAHNHPSGVAEPSQADRRITKRISDAVELVDIRVLDHFV
RADC_GEOSL      IQVSEGSLNQSIVHPREVFNPAVRESAAAVILVHNHPTGDPAPSREDLEITRRLREAGDIMGIRVLDHII
RADC_SHEHH      VELFRGTINSASVYPREVVSLVLEKKAAAVIVCHNHPSGIAEPSTADRRITERLKQALQTIDVSLLDHMV
RADC_DESAP      EKVSVGTLNSSSVHPRELFKNAIRRSAAALILVHNHPSGDPAPSPQDIELTQRLFEAGEIVGIKVLDHII
RADC_CITK8      SRLFSGTLNHVEVHPREIIREAIKLNASAVILAHNHPSGCAEPSKADKLITERVVKCCQFMDIRVLDHLV
RADC_CHLCH      ELISIGTLNTAVIHPREIFKSAIRESAHSIIVVHNHPSGDVNPSNADKKITNELKQAGAFMQIEMLDHVI
RADC_TOLAT      CELFFGTIDAASVYPREIVQTVLKHNAAAVILCHNHPSGVAEPSHADRHITERICDALRLIDVRVLDHFV
RADC_STAAB      SCVFKGTLNSSIVHPREIFSIAVRENANAIIAVHNHPSGDVTPSQEDIITTMRLKES-------------
RADC_SHEPW      VELFRGTINSASVYPRDVVGLVLEKKAAAVIVCHNHPSGIAEPSTADRRITERLKQALQTIDVSLLDHMV
RADC_SHEPA      VELFRGTINSASVYPREVVSLVLEKKAAAVIVCHNHPSGIAEPSTADRRITERLKQALQTIDVSLLDHMV
RADC_VIBFM      EILFEGTIDAAAVYPREVVKRSIDYNAAAIILAHNHPSGVAEPSQADRRITKRISDAVELVDIRVLDHFV
RADC_PSEA6      RKMFFGTIDSASVYPRVLVKQALEDNAAAVILTHNHPSGVAEPSQADEHITARIISAMSLLDIKVLDHLV
RADC_JANMA      EELFRGTLTHTSVYPREIVKEALTHNAASVILAHNHPSGSSEPSAADHSLTQALKQALALIDVRVLDHFV
RADC_HERAR      DEMFRGTLTHTSVYPREIVKAALGHNAASVILAHNHPSGTPEPSAADQTLTQALKQALMLIDVRVLDHFV
RADC_ALISL      EVLFEGTIDAAAVYPREVVKRSIDYNAAAIILAHNHPSGVAEPSQADRRITKRISDAVELVDIRVLDHFV
RADC_METFK      EELFSGTLTQTSVYPREVVKCALRHNAAAMIFAHNHPSGVPEPSQADRALTEALKAALNLIDIRVLDHFV
RADC_VIBVY      EVMFEGTIDAASVYPREVVKRALHYNAAALILAHNHPSGVAEPSQADRRITRRLSDALGLVDIRVLDHFV
RADC_VIBVU      EVMFEGTIDAASVYPREVVKRALHYNAAALILAHNHPSGVAEPSQADRRITRRLSDALGLVDIRVLDHFV
RADC_PHOLL      EEMFKGTINKVEVHPREIVRSAIKVNASSVILAHNHPSGHAEPSLADKIVTDKVIDACNLVGVKVLDHLV
RADC_CHLPB      HLISVGTLNASLIHPREIYKSAIRESSHAIILVHNHPSGDVEPSNADKQVTSILEHAGSILQINLLDHII
RADC_ACIAD      KKLFYGSLNACNISINHTLRYALQQHACHIVIAHNHPFGKAEPSAADLDLTHQLYQACQLVEIKLLDHFI
RADC_CHLPD      EQVTVGTLNASLAHPREVFKSAIRESAHAIILVHNHPSGDVEPSNADRQVTEILRQAGSFLQIDLLDHVI
RADC_BURXL      EESAQGTLTRMAVYPREIVRRALSLNAASLIVAHNHPSGAVQPSASDCRLTHTLRDALTLIDVQLVDHLV
RADC_SYNY3      KVITIGTATETLIHPREIFREVIKQGATRLIVAHNHPSGGLEPSPEDIRLTEFLLQGAQYLQIPVLDHLI
RADC_PARUW      EVISIGSLSQTLVHPREVFYSAIRHKAASLIVVHNHPSGDPMPSNQDLKLTQILLEGSRLLGIPLRDHLI
RADC_CHLAD      NTVYIGSLNSATIRIGEVFKEAVRRNSAAIIVVHNHPSGEATPSPEDIQVTRQLVAAGRLLDIEVLDHLI
RADC_RALSO      EELFQGTLTEARVYPREIAKRALHHNASALILSHNHPTGHVEPSESDLVLTRELCRALALLDVRVLDHMI
RADC_SHELP      VELFRGTIDSASVYPREVVSLVLEKKAAAVIVCHNHPSGGAEPSHADRRITERLKYALATIDVSLLDHMV
RADC_SACD2      VELFNGTIDSASVYPREVVKTALSHNAAAVILAHNHPSGIAEPSEPDKAITKRLQQALQLVDIRTLDHLV
RADC_CYAA5      KVITIGTATETLVDPAEIFRETLKQGANALIVAHNHPSGNVEPSQQDLDLTEQLLKGMQLIRIPLIDHLI
RADC_VIBCM      EILFEGTIDAASVYPREVVKRALHHNAAAVILAHNHPSGVAEPSQADRRITDRLRDALGLVEIRVLDHFV
RADC_VIBCH      EILFEGTIDAASVYPREVVKRALHHNAAAVILAHNHPSGVAEPSQADRRITDRLRDALGLVEIRVLDHFV
RADC_VIBC3      EILFEGTIDAASVYPREVVKRALHHNAAAVILAHNHPSGVAEPSQADRRITDRLRDALGLVEIRVLDHFV
RADC_RALPJ      EELFRGTLTEARVYPREIAKRALHHNAAAVILAHNHPTGNTEPSESDVILTRELCRALAMLDVIVLDHMI
RADC_PHOPR      EVLFEGTINSAAVYPREIVKRSLEFNAVALILAHNHPSGVAEPSQSDLRITRTISDALALVDIRVLDHFI
RADC_CELJU      EELFQGTIDGANVYPREVVKQALAHNAAAVIFAHNHPSGLAEPSQADIRITRRLQEALGLVDIRVLDHLV
RADC_SHEFN      VELFRGTIDSASVYPREVVSLVLEKKAAAVIVCHNHPSGIAEPSQADRRITERIKNALATIDVSLLDHMV
RADC_RALEJ      EELFRGTLNQTAVYPREVARRALAHNAASVIVAHNHPSGCCTPSQSDLQMTRMLARALDLIDVRLLDHFV
RADC_PSEA7      EVLFQGSIDGASVYPRQVVKRALAHNAAALILTHNHPSGDARPSLADRQLTARLKEALALIDVRVLDHFI
RADC_MARAV      RELFRGTIDGAAVYPREVVRQALEDNAAAVIFAHNHPSGVAEPSQADISLTRRLKEALGLVDIRVLDHMV
RADC_DESRM      ETISIGTLNSSVVHPRELFKVAIRRSAASMILVHNHPSGDPTPSREDIVLTKRLIEAGE-----------
RADC_YERE8      EEMFTGTISSVEIHPREIVREALKVNAAALILAHNHPSGKAEPSQADRLMTTQVIKACSLLDIRVLDHLV
RADC_CYAP7      KLISIGTATETLVHPREIFREVLKQGATKLIIGHNHPSGNVAPSQEDIDLTEQLLKAATFLNFPLLDHLI
RADC_COXBN      EKLFYGSINQASVHPREIIKRALYHNSAALIVAHNHPSGVPDPSQADRAATTHLKEALALIDVRLLDHII
RADC_COXB1      EKLFYGSINQASVHPREIIKRALYHNSAALIVAHNHPSGVPDPSQADRAATTHLKEALALIDVRLLDHII
RADC_PSEAE      EVLFQGSIDGASVYPRQVVKRTLAHNAAALILTHNHPSGDARPSLADRQLTARLKEALALIDVRVLDHFI
RADC_PSEAB      EVLFQGSIDGASVYPRQVVKRTLAHNAAALILTHNHPSGDARPSLADRQLTARLKEALALIDVRVLDHFI
RADC_PSEA8      EVLFQGSIDGASVYPRQVVKRTLAHNAAALILTHNHPSGDARPSLADRQLTARLKEALALIDVRVLDHFI
RADC_NEIMB      RELSRGTVAENTIYIREIVKLALDEYADSLIIAHNHPGGSPEPSQEDIMFTRRLAQAMSLVDVSLLDHFI
RADC_NEIMF      RELSRGTVAENTIYIREIVKLALDEYADSLIIAHNHPGGSPEPSQEDIMFTRRLAQAMSLVDVSLLDHFI
RADC_DELAS      EEMFRGTLTRTSVYPREVVLRALHHHAGAVILAHNHPSGQVQASAADKAVTQNLQAALRLVDIQVLDHVI
RADC_BURPP      EESAQGTLTRMAVYPREIVRRALSLNAASLIVAHNHPSGAVQPSASDCRLTHTLRDALTLIDVQLVDHLV
RADC_AERHH      VELFYGTLDSASVWPREIVQIALKHNAAAVILAHNHPSGVAEPSRADRQITDRITAALALIDIRVLDHLV
RADC_NEIMA      RELSRGTVAENTIYIREIVKLALDEYADSLIIAHNHPGGSPEPSQEDIMFTRRLAQAMSLVDVSLLDHFI
RADC_NEIM0      RELSRGTVAENTIYIREIVKLALDEYADSLIIAHNHPGGSPEPSQEDIMFTRRLAQAMSLVDVSLLDHFI
RADC_THEEB      HVITVGTATETLAHPREIFREAVRRNASRLIIAHNHPSGNLSPSQADLDLTKQILQAGQLMEIPVLDHLI
RADC_TERTT      DILFNGTIDGAAVYPREVVKKCLAHNAAAVIFAHNHPSGVAEPSEADRQITDRLCRALQLLDIRTLDHIV
RADC_PECCP      QEMFVGTINSVEVHPREIVREXXXXXXXXXXXXHNHPSGKAEPSQADRAITEQIVKACLLMEIRVLDHLV
RADC_METBF      EVVSIGSLNASIVHPREVFKSALMESSASVIMIHNHPSGDPSPSREDIMVTEKMVEGGKLLGIDVLDHII
RADC_GEOLS      VQVSEGSLNQSIVHPREVFAPAVRESAAAVIFIHNHPSGDPAPSREDHEITRRLNEAGEILGIKVLDHII
RADC_CLOD6      VDVSIGTLSSSLVHPREVFKEAIRRSASKIIVMHNHPSGSVEPSREDKNITSRLIKCXXXXXXXXXXXXX
RADC_CLOBH      RDVFIGTLNSSIVHPREIFCEAIKKNGASIIICHNHPSGDPTPSKEDINITLRLKECGKXXXXXXXXXXX
RADC_CLOB6      RDVFIGTLNSSIVHPREIFCEAIKKNGASIIICHNHPSGDPTPSKEDINITLRLKECGKXXXXXXXXXXX
RADC_CLOB1      RDVFIGTLNSSIVHPREIFCEAIKKNGASIIICHNHPSGDPTPSKEDINITLRLKECGKXXXXXXXXXXX
RADC_YERPY      EEMFTGTISSVEVHPREIVREALKVNAAALILAHNHPSGKAEPSQADRLITTQVIKACSLLDIRVLDHLV
RADC_YERPS      EEMFTGTISSVEVHPREIVREALKVNAAALILAHNHPSGKAEPSQADRLITTQVIKACSLLDIRVLDHLV
RADC_YERPP      EEMFTGTISSVEVHPREIVREALKVNAAALILAHNHPSGKAEPSQADRLITTQVIKACSLLDIRVLDHLV
RADC_YERPN      EEMFTGTISSVEVHPREIVREALKVNAAALILAHNHPSGKAEPSQADRLITTQVIKACSLLDIRVLDHLV
RADC_YERPG      EEMFTGTISSVEVHPREIVREALKVNAAALILAHNHPSGKAEPSQADRLITTQVIKACSLLDIRVLDHLV
RADC_YERPE      EEMFTGTISSVEVHPREIVREALKVNAAALILAHNHPSGKAEPSQADRLITTQVIKACSLLDIRVLDHLV
RADC_YERPB      EEMFTGTISSVEVHPREIVREALKVNAAALILAHNHPSGKAEPSQADRLITTQVIKACSLLDIRVLDHLV
RADC_YERPA      EEMFTGTISSVEVHPREIVREALKVNAAALILAHNHPSGKAEPSQADRLITTQVIKACSLLDIRVLDHLV
RADC_YERP3      EEMFTGTISSVEVHPREIVREALKVNAAALILAHNHPSGKAEPSQADRLITTQVIKACSLLDIRVLDHLV
RADC_SHEAM      VELFRGTIDAASVYPRELVSLVLEKRAAAVIVCHNHPSGVAEPSQADRRITERLKNALATIDVSLLDHMV
RADC_CLOBL      RDVFIGTLNSSIVHPREIFCEAIKKNGASIIICHNHPSGDPTPSKEDINITLRLKECGKXXXXXXXXXXX
RADC_CLOBK      RDVFIGTLNSSIVHPREIFCEAIKKNGASIIICHNHPSGDPTPSKEDINITLRLKECGKXXXXXXXXXXX
RADC_CLOBJ      RDVFIGTLNSSIVHPREIFCEAIKKNGASIIICHNHPSGDPTPSKEDINITLRLKECGKXXXXXXXXXXX
RADC_RHOFD      EELFRGTLTQTSVYPREVVLRALHHQASSVVLAHNHPSGTVQPSRADEMLTQTLKTTLALIDVRVLDHVI
RADC_THICR      VPLFTGTINQATVHIREVLKTVLDHHAAAVILAHNHPSGDPTPSQSDRDLTHQIQQGLQLIETRCLDHII
RADC_AZOVD      EVLFQGTVDGASVYPRQVLKRALAHNAAALILTHNHPSGIAEPSQADFSLTRRLKEALALVDVRVLDHFI
RADC_PSEU5      EVLFHGTIDGASVYPRQVVKRALAQNAAAVILTHNHPSGVAEPSQADRQLTQRLKDALALIDVRVLDHFI
RADC_LISW6      QTIFVGGLNASIVHPREVFRLALRKSSAAIMCFHNHPSGDPTPSSEDLLVTKRLVEAGNXXXXXXXXXXX
RADC_CLOBM      RDVFIGTLNSSIVHPREIFCEAIKKNGASIIICHNHPSGDPTPSKEDINITLRLKKCGKXXXXXXXXXXX
RADC_PSEHT      EILFYGTINSASVYPREXXXXXXXXXXXXXIFAHNHPSGIAEPSQADKLITNKLQQALQLVDINVLDHII
RADC_AZOSB      VDLFRGTLTQTSVYPREVVKLALDRNAAAVIFAHNHPSGAAEPSSADEQLTRHLKDALALVDIRVLDHFV
RADC_THETN      ETISIGSLNTSIVHPREVFKAAIERSASSIILVHNHPSGDPTPSREDVEVTKRLVEAGNILGIKVLDHVI
RADC_SHEWM      VELFRGTIDSASVYPRDVVSLVLEKKAAAVIVCHNHPSGVAEPSHADRRITERLKCALSTIDVSLLDHMV
RADC_AQUAE      EVVAIGNVNTVFSKPKDILFKAVKLSANGIIIAHNHPQGEPSPSNEDLNFTERLKKACELLGFELLDHLI
RADC_PSEMY      EVLFRGSIDSASVYPRQVVKRALANNAAAVILTHNHPSGVCEPSQADRVLTQRLKDALALVEVRVLDHFI
RADC_ERWCT      QEMFVGTINSVEVHPREIVREXXXXXXXXXXXXHNHPSGKAEPSQADRAITEQIVKACLLLEIRVLDHLV
RADC_CYAP4      QVITIGTATETIAHPRDIFREVIRQGATRVIVAHNHPSGNVEPSPEDLALTQQLLSGAKFLDIPLLDHLI
RADC_PSEPK      EILFRGTIDRASVYPREVVRRALVHNAAALILCHNHPSGISEPSQDDVHLTLSLKRGLALIDVRVLDHII
RADC_PSEFS      EALSQGTIDAAMVYPRQVVKRALAYNAAALILCHNHPSGSLEPSAADRKLTKLLQKALEVVDVRVLDHII
RADC_BORPE      AEVARGTLTQAQIYPREIVREALRHHAAALILTHNHPGGTXXXXXXXXXMTRQIRQALALIDVRLIDHVI
RADC_SHESH      VELFRGTIDSASVYPRDVVCLVLEKKAAAVIVCHNHPSGVAEPSLADRRITERLKFALETIDVSLLDHMV
RADC_PSEP1      EILFRGTIDRASVYPREVVRRALVHNAAALILCHNHPSGISEPSQDDVHLTLSLKRGLALIDVRVLDHII
RADC_PELCD      VGISEGSLTASIVHPRDVFAPVVRESAAAVLFVHNHPSGDPSPSREDLDITQRLREVGELMGVRVLDHII
RADC_PSYCK      EILFTGGISSCSVCIKHVLRHALSHAASQLIIAHNHPHTDAKPSTADNLLTYELKKACDLIDLSLIDHVI
RADC_PSE14      EILFRGTINASYVHPRQVVKRAMAHNAASLILCHNHPSGITTPSRSDIDLTKRLKEA-------------
RADC_TRIEI      QVITIGTATETLAHPREIFGEVIRQGASRVIISHNHPSGNVEPSPEDINLTKQLLAGAQXXXXXXXXXXX
RADC_SHEDO      VELFRGTIDSASVYPREVVSLVLEKRAAAVIICHNHPSGIAEPSQADRRITERLKNALATIDVSLLDHMV
RADC_AERS4      VELFYGTLDSASVWPREIVQIALKHNAAAVILAHNHPSGVAEPSRADRQITDRILAALALIDIRVLDHLV
RADC_PSEE4      EILFRGTIDRASIYPREVVRRALLHNAAALILCHNHPSGNCEPSQDDVHLTLMLKRSLALIDVRVVDHVI
RADC_MOOTA      DNVSVGSLNSSLAHPREVFKDPIRRSAAAIILAHNHPSGDPTPSQEDIMVTRRLVEAGHILGIEVLDHLI
RADC_METAC      EVVSIGSLNASIVHPREVFKSALLESSASVIMVHNHPSGDPSPSREDIMVTEKLVE--------------
RADC_PSYWF      KVLFVGGLSSCSVCVKQVLRHALEQGASQIIIAHNHPNQDATPSAADIHLTQTLKLACEAIDLRLTDHII
RADC_PSEPW      EILFRGTIDRASIYPREVVRRSLMHNAAALILCHNHPSGNSEPSQDDVHMTLALKRGLALIDVRVLDHII
RADC_PSYIN      HEFFFGSIDCATVHPRIIAQKVLSENAAAIILVHNHPSGDPSASEADKMITQKIVSALQLIDVRVLDHLV
RADC_PSEU2      EILFRGTINASYVHPRQVVKRAMAHNAASLILCHNHPSGITTPSRSDIDLTKRLKEA-------------
RADC_PSYA2      EILFTGGISSCSVCIKHVLRHALSHATSQLIIAHNHPHTDATPSTADNLLTYELKKACDLIDLSLIDHVI
RADC_PELLD      VRVTVGTLNASLIHPREVFKSAIRESAHAIILVHNHPSGDTEPSNADRQVTTLLKQASAVIQIDLLDHVI
RADC_PSESM      EILFRGTINASYVHPRQVVKRALAHNAASLILCHNHPSGITTPSRSDIDLTKRLKEA-------------
RADC_MARMS      QELFMGTIDAAAVYPREVVKAALQYNAAAVILAHNHPSGIAEPSQADISITDKIKRA-------------
RADC_ACIF5      EEMFLGTIDGATVHIREVLKRALELNAAALIVAHNHPSGVAEPSAADLSLTRRLDQAMQLLDLRLLDHFI
RADC_ACIF2      EEMFLGTIDGATVHIREVLKRALELNAAALIVAHNHPSGVAEPSAADLSLTRRLDQAMQLLDLRLLDHFI
RADC_PSEPF      EALFRGSIDNTAVHPREVVKRSLANNAAAVILCHNHPSGNSDPSQADRLLTKRLQKALELIDVRVLDHFI
RADC_DESHY      XXXXXXXXXXXXXHPRECFKEAIRRNSNAIILLHNHPSGDPTPSSEDIDVTRRLSDGGQILGIEVLDHVI
RADC_DESHD      XXXXXXXXXXXXXHPRECFKEAIRRNSNAIILLHNHPSGDPTPSSEDIDVTRRLSDGGQILGIEVLDHVI
RADC_GEOUR      VQISEGSLNQSIVHPREVFNQAVRESAAAIILVHNHPTGDPTPSREDIDITRRLREAGDLLGIKVLDHII
RADC_NITMU      EELFQGTLTQTSVYPREVVKRALHHNAAAVIFAHNHPSGAAEPSHADAVLTQSLKQALLLVDVRVLDHFI
RADC_AZOSE      VELFRGTLTQTSVYPREXXXXXXXXXXXXXXXXHNHPSGAAEPSPADELLTRSLKQALELVDIRVLDHFI
RADC_RALEH      EEMFRGTLTRTAVYPREVARQALVHNAAGIIVAHNHPRGTTAPSQSDIRLTHELARTLDLIDVRLLDHFI
RADC_NEIG2      RELSRGTVAENTIYIREIVKLALDEYADSLIIAHNHPGGSPEPSQEDIMFTRRLAQAMSLVDVSLLDHFI
RADC_NEIG1      RELSRGTVAENTIYIREIVKLALDEYADSLIIAHNHPGGSPEPSQEDIMFTRRLAQAMSLVDVSLLDHFI
RADC_CARHZ      NIVAIGGVNHAGVSPGDIFREAVKIGAYAVIIAHNHPSGDPTPSKEDIDFTGRVKKASEILGIKLLDHII
RADC_ALTMD      RTMFNGTINSAAVYPRELIKQVMIDNAAAIILVHNHPSGVAEPSHADIRLTTEIKSAMASIDVPVLDHFV
RADC_VIBSL      EVMFEGTIDAASVYPREVVKRXXXXXXXXXXXXXXXPSGVAEPSQADRRITRRLTDALALVDIRILDHFV
RADC_DECAR      EELFTGTLTQTSVYPREXXXXXXXXXXXXXXXXXXXPSGIAEPSRADEMLTRSLKEALAMVDVKVLDHFI
RADC_BURCH      EEIARGSLTRMAVYPREIVRRAMKHNAAALIVAHNHPSGAVQPSAEDRRLTRVLKDA-------------
RADC_BURCC      EEIARGSLTRMAVYPREIVRRAMKHNAAALIVAHNHPSGAVQPSAEDRRLTRVLKDA-------------
RADC_BURCA      EEIARGSLTRMAVYPREIVRRAMKHNAAALIVAHNHPSGAVQPSAEDRRLTRVLKDA-------------
RADC_BURVG      EESARGSLTRMAVYPREIVRRALMLNAASLIIAHNHPSGAVQPSAEDRRLTRVLHEALALVDAKLLDHVV
RADC_VIBPA      EILFEGTLDAASVYPREVVKRXXXXXXXXXXXXXXXPSGVAEPSQADRRITRRLIDALALVDIRILDHFV
RADC_VARPS      EELFRGTLTQTSVYPREVVTRALHHQAAAVVLSHNHPSGSIEPSRADESLTQTLRAALSLIDVRVLDHVI
RADC_HAHCH      EELFRGTIDSASVHPREVVRRVLKXXXXXXXXXXXXPSGVAEPSLSDKEITETLRKALRLVDVRVLDHMI
RADC_FUSNN      EENSVGTLDRSSVYPREIYKKVINLNAKSIILAHNHPSDNITPSKSDIELTNEIAKGLKNFGALLIEHII
RADC_NOSP7      QVITIGTATETLASPRDIFREVIRQGATRAIVAHNHPSGNLEPSQEDIELTRQLLAGAQLLGIPVLDHLI
RADC_PSEF5      EVLFQGSIDSTTVYPRQVIKRALAHNAAAVILCHNHPSGICEPSPADRVVTRRLQEALELIDVRVLDHFI
RADC_ANAVT      QVITIGTATETLASPREIFREIIRQGATRTIVAHNHPSGNVEPSPEDIELTRQLLAGAQXXXXXXXXXXX
RADC_VIBHB      EILFEGTLDAASVYPREVVKRXXXXXXXXXXXXXXXPSGVAEPSQADRRITRRLIDALGLVDIRILDHFV
RADC_ANASP      QVITIGTATETLASPREIFREIIRQGATRTIVAHNHPSGNVEPSPEDIELTRQLLAGAQXXXXXXXXXXX
RADC_XANCP      EELFTGTIDAAEIHPREVVRRALLHNAAAVVVGHNHPSGNPEPSEADRAVTQRLLQALGLVDIRLLDHFV
RADC_XANC8      EELFTGTIDAAEIHPREVVRRALLHNAAAVVVGHNHPSGNPEPSEADRAVTQRLLQALGLVDIRLLDHFV
RADC_IDILO      EELFQGTINAAPVYPREVIKLVMQYNAAAVILAHNHPSGVAEPSQADQRVTERVKKALTLIDVALLDHFV
RADC_SILPO      EEQARGTVDHVPVYPREVAKRALELNASALILVHNHPSGDPTPSQSDIDMTARIRSACEALGLTLHDHLI
RADC_SERP5      QEMFAGTISSVVVYPREIVREXXXXXXXXXXXXXXXPSGKAEPSHADRLITEQVVNACLLLEIRVLDHLV
RADC_NITOC      EELFRGTIDGASVHPREVLKRXXXXXXXXXXXXXXXPSGVAEPSRADECITQRLKEALALVDIRVLDHII
RADC_XANC5      EELFTGTIDGADIHPREVVRRALLHNAAAVIVGHNHPSGNPEPSEADRAVTKRLLDSLELVDIRLLDHFV
RADC_BURS3      EEITRGSLTRMAVYPREIVRRAMVHNAAALIVAHNHPSGAVQPSAEDRRLT-------------------
RADC_ALHEH      EELFQGTIDAASVYPREVVQRXXXXXXXXXXXXXXXPSGVAEPSVADQALTRRLQEALGLVDIRVLDHFV
RADC_THISH      EELFRGTIDGASVHPREVVRRXXXXXXXXXXXXXXXPSGVAEPSRSDEAITRRLRDALALVDIRVLDHVV
RADC_PELPD      VQVSEGSLNQSIVHPREVFCQAVKESAAAVILVHNHPTGDPTPSQEDIAITRRLKEAGEIMGIRVLDHII
RADC_XANAC      EELFTGTIDGADIHPREVVRRALLHNAAAVIVGHNHPSGNPEPSEADRAVTKRLLDSLELVDIRLLDHFV
RADC_LARHH      EEVAHGTLTESRVYPREVVKAALRQHAVAVILAHNHPSGDSGPSLADRELTEALGRALALVDVRLLDHLV
RADC_SYMTH      ECVSEGTLTASLVHPREVFKTAIRRSAHAVILAHNHPSGDPTPSREDREITRRLVQAGRVIGIEVLDHLV
RADC_ACAM1      QVVSIGTATETLAHPRDIFREIIRKGATRAIVAHNHPSGQTDPSPEDLELTQQLLSGAQIXXXXXXXXXX
RADC_RHIME      EVQQQGTIDHTPVYPREVVKRALELSATALILVHNHPSGDPTPSRADIDMTKLIAEAAKPLGIALHDHVI
RADC_ALCBS      EKLFQGTIDAAAVYPREVVRRAMEHNAAAVILAHNHPSGVAEPSQSDHAITRRLVEALGLVEVRVLDHLV
RADC_RHOCA      EEQARGTVDHVPVYPREVVKRALELDASALILVHNHPSGDPTPSQADIAMTDQIRHAAEALGLVLHDHLV
RADC_SHEB9      VELFRGTIDSASVYPREVVSLVLEKKAAAVIVCHNHPSGIAEPSQADRRITERLKNALATIDVSLLDHMV
RADC_SHEB5      VELFRGTIDSASVYPREVVSLVLEKKAAAVIVCHNHPSGIAEPSQADRRITERLKNALATIDVSLLDHMV
RADC_SHEB2      VELFRGTIDSASVYPREVVSLVLEKKAAAVIVCHNHPSGIAEPSQADRRITERLKNALATIDVSLLDHMV
RADC_METHJ      RTITMGLLNHSLVHPREVFXXXXXXXXXXXXXXHNHPSGNPEPSSEDITVTRQLSEAGKILGISLLDHLI
RADC_SHEB8      VELFRGTIDSASVYPREVVSLVLEKKAAAVIVCHNHPSGNAEPSQADRRITERLKNALATIDVSLLDHMV
RADC_PSEPG      EILFRGTIDRASVYPREVVRRALLHNAAALILCHNHPSGSSEPSQDDVHLTLSLKRGLALIDVRVLDHII
RADC_BORPA      AEVARGTLTQAQIYPREIVREXXXXXXXXXXXXXNHPGGTXXXXXXXXXMTRQIRQALALVDVRLIDHVI
RADC_BORBR      AEVARGTLTQAQIYPREIVREXXXXXXXXXXXXXNHPGGTXXXXXXXXXMTRQIRQALALIDVRLIDHVI
RADC_XYLFT      EELFHGTINGAEVHPREVVRRALTLNAAAVIVGHNHPSGNREPSPADQMITQRLKNALDLIDVRLVDHFV
RADC_SHESW      VELFRGTIDSASVYPREVVSLVLEKKAAAVIVCHNHPSGIAEPSQADRRITERLKNALATIDVSLLDHMV
RADC_SHEPC      VELFRGTIDSASVYPREVVSLVLEKKAAAVIVCHNHPSGIAEPSQADRRITERLKNALATIDVSLLDHMV
RADC_XYLFA      EELFHGTINGAEVHPREVVRRALTLNAAAVIVGHNHPSGNREPSPADRMITQRLKNALDLIDVRLVDHFV
RADC_PARDP      EEQARGTVDHVPVYPREIMRRALELSASALILVHNHPSGDPTPSQADIGMTNRIVAAAEVMGIAVHDHLI
RADC_SHESR      VELFRGTIDSASVYPREVVSLVLEKKAAAVIVCHNHPSGIAEPSQADRRITERLKNALATIDVSLLDHMV
RADC_SHESA      VELFRGTIDSASVYPREVVSLVLEKKAAAVIVCHNHPSGIAEPSQADRRITERLKNALATIDVSLLDHMV
RADC_SHEON      VELFRGTIDSASVYPREVVSLVLEKKAAAVIVCHNHPSGIAEPSQADRRITERLKNALATIDVSLLDHMV
RADC_SHESM      VELFRGTIDSASVYPREVVSLVLEKKAAAVIVCHNHPSGIAEPSQADRRITERLKNALATIDVSLLDHMV
RADC_RHILW      EVQGRGTVDHTPVYPREVVKRALELSATAMILVHNHPSGDPTPSRADIDMTKVIIEAAKALDITVHDHVI
RADC_RHIE6      EVQGRGTVDHTPVYPREVVKRALELSATAIILVHNHPSGDPTPSRADIDMTKVIIEAAKALDITVHDHII
RADC_DIAST      EELFRGTLTQTSVYPREXXXXXXXXXXXXXXXXXNHPSGSVQPSRADEXXXXXXXXXXXXVDVRVLDHVI
RADC_STRM5      EELFHGTINAAPVYPREVVRRALLHNAAAVILSHNHPSGDPEPSSADTRITDELQQALAMVDVRLLDHFV
RADC_BORA1      GELERGTLGRASVFPREVVREALRLHAGAIILAHNHPSGNPQPSAADCAFTQQLSQALALVDIRLVDHII
RADC_STRMK      EELFHGTINAAPVYPREVVRRALLHNAAAVILSHNHPSGDPEPSSADTRITDELQQALAMVDVRLLDHFV
RADC_RHIL3      EVQGRGTVDHTPVYPREVVKRALELSATAMVLVHNHPSGDPTPSRADIDMTKVIIDAAKALDITVHDHII
RADC_METMA      EVVSIGSLNASIVHPREVFKSALMESSASVIMVHNHPSGDPSPSREDIMVTEKLVE--------------
RADC_RHOP2      ELQQVGTVDHTPVYPREIVKRALELSATAVIMVHNHPSGDPTPSQADIQMTKTIVAIAEPLGVAVHDHII
RADC_RHIEC      EVQGRGTVDHTPVYPREVVKRALELSATAIILVHNHPSGDPTPSRADIDMTKVIIEAAKALDITVHDHII
RADC_CUPTR      EELFRGTLTRTSVYPREVARQALAHNAAGIIVAHNHPRGTTAPSQSDIHLTRELARTLDLIDVRLLDHFI
RADC_SINMW      EVQQQGTIDHTPVYPREVVKRALELSATALILVHNHPSGDPTPSCADIEMTKLIAEAAKPLGIALHDHVI
RADC_RHISN      EVQQQGTIDHTPVYPREVVKRALELSATALILAHNHPSGDPTPSRADIEMTKLIAEAAKPLGITVHDHVI
RADC_ACIAC      EEMFRGTLSQASVYPREXXXXXXXXXXXXXXXXXNHPSGQVQPSRADETLTRSLTDALRLVDVRVLDHII
RADC_LEGPH      EELFSGTINTATVYPRPIVERVXXXXXXXXXXXHNHPSGLSDASQQDLAITERIXXXXXXXXXXXXXHIV
RADC_LEGPC      EELFSGTINTATVYPRPIVERVXXXXXXXXXXXHNHPSGLSDASQQDFAITERIXXXXXXXXXXXXXHIV
RADC_LEGPA      EELFSGTINTATVYPRPIVERVXXXXXXXXXXXHNHPSGLSDASQQDLAITERIXXXXXXXXXXXXXHIV
RADC_LEGPL      EELFSGTINTATVYPRPIVERVXXXXXXXXXXXHNHPSGLSDASQQDLAITERIXXXXXXXXXXXXXHIV
RADC_THIDA      EELFRGTLTQTSVYPREIVKRXXXXXXXXXXXXXXXPSGVNEPSQADRSLTRRLAEALALVDIRVLDHFI
RADC_RUBXD      PTISVGTLSSSLVHPREVFKPAIRASAASVVLAHNHPSGRVEPSREDREVTGRVAEAGGIIGIEVLDHVI
RADC_OCHA4      EVQQTGTVDHTPVYPREVVKRALELSATAIILVHNHPSGDPTPSRADIDMTKQLVNAAKALNITVHDHVI
RADC_CHRVO      EEVFKGTLTETRVYPREVXXXXXXXXXXXXXXXXXXPSGVSEPSSADRVLTDTLKRALELVDIRLLDHFV
RADC_BURTA      EETAHGSLTRMAVYPREXXXXXXXXXXXXXXXXXXXPSGAVRPSAADRHLTRVLRDALALVDVQLIDHFV
RADC_XANOM      EELFTGTIDGADIHPREVVRRALLHNAAAVIVGHNHPSGNPEPSEADRAVTKRLLDSLELVDIRLLDHFV
RADC_XANOR      EELFTGTIDGADIHPREVVRRALLHNAAAVIVGHNHPSGNPEPSKADRAVTKRLLDSLELVDIRLLDHFV
RADC_XANOP      EELFTGTIDGADIHPREVVRRALLHNAAAVIVGHNHPSGNPEPSKADRAVTKRLLDSLELVDIRLLDHFV
RADC_CHRSD      ETLSKGTLDSASVYPREVSRRALALNAGALIFAHNHPSGVAEPSDADRRITQRLSDALGLFDIRVLDHFV
RADC_SALRD      YTXXXXXXXXXXXXPRGVFEQAILDDAAAVICLHNHPSGNPEPSREDIRITRQLAEAGGTMGIPVHDHLI
RADC_BURP6      EETAHGSLTRMAVYPREXXXXXXXXXXXXXXXXXXXPSGAVRPSAADRRLTRVLRDALALVDIKLIDHFV
RADC_BURP1      EETAHGSLTRMAVYPREXXXXXXXXXXXXXXXXXXXPSGAVRPSAADRRLTRVLRDALALVDIKLIDHFV
RADC_BURP0      EETAHGSLTRMAVYPREXXXXXXXXXXXXXXXXXXXPSGAVRPSAADRRLTRVLRDALALVDIKLIDHFV
RADC_BURMS      EETAHGSLTRMAVYPREXXXXXXXXXXXXXXXXXXXPSGAVRPSAADRRLTRVLRDALALVDIKLIDHFV
RADC_BURMA      EETAHGSLTRMAVYPREXXXXXXXXXXXXXXXXXXXPSGAVRPSAADRRLTRVLRDALALVDIKLIDHFV
RADC_BURM9      EETAHGSLTRMAVYPREXXXXXXXXXXXXXXXXXXXPSGAVRPSAADRRLTRVLRDALALVDIKLIDHFV
RADC_BURM7      EETAHGSLTRMAVYPREXXXXXXXXXXXXXXXXXXXPSGAVRPSAADRRLTRVLRDALALVDIKLIDHFV
RADC_BURA4      EESARGSLTRMAVYPREXXXXXXXXXXXXXXXXXXXPSGAVQPSAEDRRLTRVLHEALALIDAKLLDHVV
RADC_HALHL      EELFRGTINGASVYPREXXXXXXXXXXXXXXXXXXXPSGITEPSAADEALTHRLREALGLVDVRLLDHFV
RADC_BURCM      EESARGSLTRMAVYPREXXXXXXXXXXXXXXXXXXXPSGAVQPSAEDRRLTRVLHEALALIDAKLLDHVV
RADC_AGRT5      EVQGQGTVDHTPVYPREIVRRALELSSTALILIHNHPSGDPTPSRADIEMTKTIIDTAKPLGITVHDHII
RADC_BRUSU      EVQQTGTVDHTPVYPREVVKRALELSATAIILVHNHPSGDPTPSRADIDMTKQLVNAAKALNITVHDHVI
RADC_BRUME      EVQQTGTVDHTPVYPREVVKRALELSATAIILVHNHPSGDPTPSRADIDMTKQLVNAAKALNITVHDHVI
RADC_BRUMB      EVQQTGTVDHTPVYPREVVKRALELSATAIILVHNHPSGDPTPSRADIDMTKQLVNAAKALNITVHDHVI
RADC_BRUC2      EVQQTGTVDHTPVYPREVVKRALELSATAIILVHNHPSGDPTPSRADIDMTKQLVNAAKALNITVHDHVI
RADC_BRUAB      EVQQTGTVDHTPVYPREVVKRALELSATAIILVHNHPSGDPTPSRADIDMTKQLVNAAKALNITVHDHVI
RADC_BRUA2      EVQQTGTVDHTPVYPREVVKRALELSATAIILVHNHPSGDPTPSRADIDMTKQLVNAAKALNITVHDHVI
RADC_BRUA1      EVQQTGTVDHTPVYPREVVKRALELSATAIILVHNHPSGDPTPSRADIDMTKQLVNAAKALNITVHDHVI
RADC_POLNA      EELFRGTLTQTSVYPREVVIRXXXXXXXXXXXXHNHPSGAAQPSRADEMLTQTLKTALALVDVRVLDHFV
RADC_ROSCS      QTVYVGSLNASMVRIGEVFKEAIRLNSASIIVVHNHPSGDPTPSPEDIVVTRQMIEAGRXXXXXXXXXXX
RADC_VEREI      EELFRGTLTQTSVYPREXXXXXXXXXXXXXXXXXNHPSGSVQPSRADEALTQTLKSTLALVDVRVLDHVI
RADC_LEPCP      EPLFRGTLTQTSVYPREVLKRXXXXXXXXXXXXHNHPSGVAEPSRADEFLTQSLKTALALIDVRVLDHFV
RADC_ROSS1      QTVYIGSLHTSMVRIGEIFKEPIRLNSASIIVVHNHPSGDPTPSPEDVVVTRQIIEA-------------
RADC_ACISJ      EELFRGTLTQTSVYPREXXXXXXXXXXXXXXXXXNHPSGSVQPSRADEXXXXXXXXXXXXVDVRVLDHVI
RADC_POLSJ      EELFRGTLTQTSVYPREXXXXXXXXXXXXXXXXHNHPSGAATPSRADEALTQTLKSALALVDVRVLDHFV
RADC_METPP      EELFRGTLNQASVYPREVVKRXXXXXXXXXXXXHNHPSGVAEPSRADEXXXXXXXXXXXXVDVRVLDHFV
YFJY_ECOLI      ETLFAGSISSTEVHPREVVKRALYFNAAAVILAHNHPSGDTTPSQADKTITQRLVQALQLVDIRVPDHLI
RADC_BORPD      GELARGTLARASVYPREVVREXXXXXXXXXXXXXNHPSGSAQPSQADRDFTRHMQQALALVEIRLLDHLI
Y1786_VIBCH     KELFRGTVDAASVYPREVLKEALNVNAAAVIFAHNHPSGDPEPSQADRRITQRLKDALSLVDIRVLDHVV
YKFG_ECOLI      ETLFTGTINRTEVHPREVVKRALHFNAAAVILAHNHPSGETTPSQADKTLTXXXXXXXXXXDIRVPDHLI
Y510_VIBCH      KELFQGTVDAASVYPREVVKAVLEVNAAAVIFAHNHPSGDSTPSQADRRITERLKDTLALVDVRVLDHIV
YEES_ECOLI      ETLFTGTINRTEVHPREVIKRXXXXXXXXXXXXXXHPSGEVTPSKADRLITERLVQALGLVDIRVPDHLI
DNLJ_AQUAE      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           VSHSNYFSYREKTDLI
RADC_STRZT      VSHSNYFSYREKTDLI
RADC_STRZP      VSHSNYFSYREKTDLI
RADC_STRPN      VSHSNYFSYREKTDLI
RADC_STRPJ      VSHSNYFSYREKTDLI
RADC_STRPI      VSHSNYFSYREKTDLI
RADC_STRP7      VSHSNYFSYREKTDLI
RADC_STRP4      VSHSNYFSYREKTDLI
RADC_STRR6      VSHSNYFSYREKTDLI
RADC_STRP2      VSHSNYFSYREKTDLI
RADC_STRZJ      VSHSNYFSYREKTDLI
RADC_STRGC      VGGDSYYSYREETDLI
RADC_STRSV      VSKSNYYSYREETDMI
RADC_STRS2      VGNKDYYSFREESDVI
RADC_STRA5      VGKNKYYSFREEADIL
RADC_STRA1      VGKNKYYSFREEADIL
RADC_STRA3      VGKNKYYSFREEADIL
RADC_STRU0      VGKKQYYSFREKSDI-
RADC_STRTD      VGKSTYYSFREERE--
RADC_STRT2      VGKSTYYSFREERE--
RADC_STRT1      VGKSTYYSFREERE--
RADC_STRPZ      VSYKDYYSFREKSTL-
RADC_STRPM      VSYKDYYSFREKSTL-
RADC_STRPG      VSYKDYYSFREKSTL-
RADC_STRPF      VSYKDYYSFREKSTL-
RADC_STRPD      VSYKDYYSFREKSTL-
RADC_STRPC      VSYKDYYSFREKSTL-
RADC_STRPB      VSYKDYYSFREKSTL-
RADC_STRP8      VSYKDYYSFREKSTL-
RADC_STRP1      VSYKDYYSFREKSTL-
RADC_STRP6      VSYKDYYSFREKSTL-
RADC_STRP3      VSYKDYYSFREKSTL-
RADC_STRS7      VSKHGYYSFREKSDL-
RADC_STREM      VSKHGYYSFREKSDL-
RADC_STRE4      VSKYDYYSFREKSDL-
RADC_ENTFA      LGDSGYISLREE----
RADC_LACLA      VGAGNYFSFREE----
RADC_GEOKA      IGDQKFISLKEK----
RADC_GEOTN      IGDQKFISLKEK----
RADC_LACSS      IGSSQYLSLREEGYLV
RADC_BACSK      VGDGCFISLKER----
RADC_BACLD      IGDQKFVSLKEK----
RADC_BACSU      IGDKKFVSLKEK----
RADC_BACHD      IGDRTFVSLKEKGHL-
RADC_BACA2      IGDKKFVSLKEK----
RADC_GEOSW      IGDQKFVSLKEK----
RADC_BACHK      IGDHKFVSLKEK----
RADC_BACC3      IGDHKFVSLKEK----
RADC_BACAN      IGDHKFVSLKEK----
RADC_BACAC      IGDHKFVSLKEK----
RADC_BACAA      I