[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for spne4:ACF55636.1

[Show Plain Result]


## Summary of Sequence Search
    1::232
   40::238     3e-08  24%  241 aa  LIAF_BACSU RecName: Full=Protein liaF;
    1::232

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxYYTGKEGNNLLLVAATILFFFIVMLNPF
LIAF_BACSU      ------------------------------------------YFLKKYSRDWLGSVMYIFAAFLFLKNLF


                         .         .         *         .         .         .         .:140
query           VILAIFVAVIYSLFLLYPMMNQEKEQTNLVFXXXXXXXXXXNRWFGNLHHFSSYQTCQFDDINLFRFMGK
LIAF_BACSU      SITFNLFGYAFAAFLIYPIFEPNEKQVNLNKKEHHEPPKDVKHFIGELQMMK--QPFDLNDLNVSGFIGD


                         +         .         .         .         .         *         .:210
query           DTIHLERVILTNHDNVIILRKMVGTTKIIVPVDVEVSLSVNCLYGDLTFFNQPKRALRNEHYHQETKDYL
LIAF_BACSU      IKIDLSKAMIPEGESTIVISGVIGNVDIYVPSDLEVAVSSAVFIGDINLIGSKKSGLSTKVYAAST-DFS


                         .         .         .         +         .         .         .:280
query           KSNKSVKIFLTTMIGDVEVxxx
LIAF_BACSU      EXXXXXXXXXXLFIGDVDV---