[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for spne4:ACF55668.1

[Show Plain Result]


## Summary of Sequence Search
    1::362
    5::340     8e-89  52%  370 aa  GLDA_BACST RecName: Full=Glycerol dehydrogenase;       
    3::358     1e-83  45%  367 aa  GLDA_ECOLI RecName: Full=Glycerol dehydrogenase;       
    3::358     1e-83  45%  367 aa  GLDA_ECOL6 RecName: Full=Glycerol dehydrogenase;       
    2::356     6e-81  43%  365 aa  GLDA_CITFR RecName: Full=Glycerol dehydrogenase;       
    8::356     3e-76  48%  364 aa  GLDA_THEMA RecName: Full=Glycerol dehydrogenase;       
    3::356     9e-72  42%  365 aa  GLDA_PSEPU RecName: Full=Glycerol dehydrogenase;       
   64::420     1e-69  40%  450 aa  GLD1_SCHPO RecName: Full=Glycerol dehydrogenase;       
   25::364     9e-40  29%  385 aa  Y1167_SYNY3 RecName: Full=Uncharacterized oxidoreductase slr1167;  
   66::360     2e-31  33%  362 aa  YBDH_ECOLI RecName: Full=Uncharacterized oxidoreductase ybdH;      
   97::328     1e-15  28%  359 aa  G1PDH_METHJ RecName: Full=Glycerol-1-phosphate dehydrogenase
   43::342     1e-15  28%  359 aa  G1PDH_METB6 RecName: Full=Glycerol-1-phosphate dehydrogenase
   72::301     2e-15  27%  342 aa  G1PDH_PYRAE RecName: Full=Glycerol-1-phosphate dehydrogenase
   54::315     3e-15  29%  357 aa  G1PDH_METBU RecName: Full=Glycerol-1-phosphate dehydrogenase
    5::308     4e-15  28%  350 aa  G1PDH_THESM RecName: Full=Glycerol-1-phosphate dehydrogenase
   74::313     6e-15  27%  354 aa  G1PDH_NITMS RecName: Full=Glycerol-1-phosphate dehydrogenase
   68::297     8e-15  23%  338 aa  G1PDH_PYRCJ RecName: Full=Glycerol-1-phosphate dehydrogenase
   76::301     8e-15  26%  342 aa  G1PDH_PYRAR RecName: Full=Glycerol-1-phosphate dehydrogenase
   71::301     1e-14  29%  342 aa  G1PDH_PYRIL RecName: Full=Glycerol-1-phosphate dehydrogenase
   12::329     3e-14  23%  351 aa  G1PDH_SULAC RecName: Full=Glycerol-1-phosphate dehydrogenase
   36::314     3e-14  27%  356 aa  G1PDH_METAC RecName: Full=Glycerol-1-phosphate dehydrogenase
   11::312     5e-14  26%  352 aa  G1PDH_HALMA RecName: Full=Glycerol-1-phosphate dehydrogenase
   11::312     6e-14  26%  352 aa  G1PDH_NATPD RecName: Full=Glycerol-1-phosphate dehydrogenase
   87::306     8e-14  29%  348 aa  G1PDH_METST RecName: Full=Glycerol-1-phosphate dehydrogenase
   23::346     1e-13  26%  359 aa  G1PDH_METPE RecName: Full=Glycerol-1-phosphate dehydrogenase
   36::314     2e-13  27%  356 aa  G1PDH_METMA RecName: Full=Glycerol-1-phosphate dehydrogenase
   16::314     2e-13  28%  356 aa  G1PDH_METBF RecName: Full=Glycerol-1-phosphate dehydrogenase
   70::180     9e-13  37%  351 aa  G1PDH_METS5 RecName: Full=Glycerol-1-phosphate dehydrogenase
   50::330     1e-12  24%  352 aa  G1PDH_IGNH4 RecName: Full=Glycerol-1-phosphate dehydrogenase
    1::304     2e-12  24%  346 aa  G1PDH_PYRFU RecName: Full=Glycerol-1-phosphate dehydrogenase
   58::296     2e-12  26%  335 aa  G1PDH_METJA RecName: Full=Glycerol-1-phosphate dehydrogenase
   71::301     4e-12  26%  342 aa  G1PDH_THENV RecName: Full=Glycerol-1-phosphate dehydrogenase
   44::318     5e-12  26%  354 aa  G1PDH_CENSY RecName: Full=Glycerol-1-phosphate dehydrogenase
   15::181     6e-12  28%  354 aa  G1PDH_METTP RecName: Full=Glycerol-1-phosphate dehydrogenase
    1::304     1e-11  24%  346 aa  G1PDH_PYRHO RecName: Full=Glycerol-1-phosphate dehydrogenase
   39::300     2e-11  29%  350 aa  G1PDH_PICTO RecName: Full=Glycerol-1-phosphate dehydrogenase
   63::311     2e-11  27%  352 aa  G1PDH_CALMQ RecName: Full=Glycerol-1-phosphate dehydrogenase
   23::340     5e-11  25%  360 aa  G1PDH_METLZ RecName: Full=Glycerol-1-phosphate dehydrogenase
   71::187     5e-11  35%  352 aa  G1PDH_HALSA RecName: Full=Glycerol-1-phosphate dehydrogenase
   71::187     5e-11  35%  352 aa  G1PDH_HALS3 RecName: Full=Glycerol-1-phosphate dehydrogenase
   49::310     9e-11  27%  355 aa  G1PDH_STAMF RecName: Full=Glycerol-1-phosphate dehydrogenase
   11::309     3e-10  23%  351 aa  G1PDH_PYRKO RecName: Full=Glycerol-1-phosphate dehydrogenase
   71::306     3e-10  29%  341 aa  G1PDH_META3 RecName: Full=Glycerol-1-phosphate dehydrogenase
    9::326     6e-10  26%  348 aa  G1PDH_METS3 RecName: Full=Glycerol-1-phosphate dehydrogenase
   43::340     6e-10  29%  360 aa  G1PDH_METMJ RecName: Full=Glycerol-1-phosphate dehydrogenase
   28::291     6e-09  25%  352 aa  G1PDH_THEAC RecName: Full=Glycerol-1-phosphate dehydrogenase
   66::304     2e-08  24%  346 aa  G1PDH_PYRAB RecName: Full=Glycerol-1-phosphate dehydrogenase
   87::302     3e-08  35%  345 aa  G1PDH_UNCMA RecName: Full=Glycerol-1-phosphate dehydrogenase
   39::311     3e-08  24%  352 aa  G1PDH_THEVO RecName: Full=Glycerol-1-phosphate dehydrogenase
   47::221     4e-08  29%  394 aa  G1PDH_BACA2 RecName: Full=Glycerol-1-phosphate dehydrogenase
   40::299     4e-08  26%  355 aa  AROB_LACSS RecName: Full=3-dehydroquinate synthase;       
   48::188     5e-08  26%  394 aa  G1PDH_BACSK RecName: Full=Glycerol-1-phosphate dehydrogenase
   88::226     7e-08  29%  395 aa  EUTG_ECOLI RecName: Full=Ethanolamine utilization protein eutG;    
   53::324     2e-07  22%  399 aa  G1PDH_BACHD RecName: Full=Glycerol-1-phosphate dehydrogenase
   11::309     3e-07  24%  348 aa  G1PDH_HALWD RecName: Full=Glycerol-1-phosphate dehydrogenase
   17::268     3e-07  24%  314 aa  G1PDH_KORCO RecName: Full=Glycerol-1-phosphate dehydrogenase
   98::344     3e-07  32%  377 aa  AROB_AGRRK RecName: Full=3-dehydroquinate synthase;       
   87::180     4e-07  31%  351 aa  G1PDH_SULIL RecName: Full=Glycerol-1-phosphate dehydrogenase
   33::147     6e-07  29%  334 aa  G1PDH_METM5 RecName: Full=Glycerol-1-phosphate dehydrogenase
   49::252     6e-07  32%  422 aa  ADH4_SCHPO RecName: Full=Alcohol dehydrogenase 4;       
  101::344     8e-07  31%  376 aa  AROB_RHIL3 RecName: Full=3-dehydroquinate synthase;       
   75::177     1e-06  34%  350 aa  G1PDH_HALLT RecName: Full=Glycerol-1-phosphate dehydrogenase
   40::343     1e-06  25%  356 aa  AROB_THETN RecName: Full=3-dehydroquinate synthase;       
   49::319     1e-06  28%  381 aa  AROB_RHOPA RecName: Full=3-dehydroquinate synthase;       
  101::344     1e-06  30%  376 aa  AROB_RHILW RecName: Full=3-dehydroquinate synthase;       
   86::332     1e-06  28%  364 aa  AROB_DECAR RecName: Full=3-dehydroquinate synthase;       
   31::333     1e-06  27%  367 aa  AROB_CYAP7 RecName: Full=3-dehydroquinate synthase;       
   87::180     1e-06  30%  351 aa  G1PDH_SULIY RecName: Full=Glycerol-1-phosphate dehydrogenase
   87::180     1e-06  30%  351 aa  G1PDH_SULIN RecName: Full=Glycerol-1-phosphate dehydrogenase
   87::180     1e-06  30%  351 aa  G1PDH_SULIM RecName: Full=Glycerol-1-phosphate dehydrogenase
   87::180     1e-06  30%  351 aa  G1PDH_SULIK RecName: Full=Glycerol-1-phosphate dehydrogenase
   87::180     1e-06  30%  351 aa  G1PDH_SULIA RecName: Full=Glycerol-1-phosphate dehydrogenase
   43::281     1e-06  33%  360 aa  AROB_AZOSE RecName: Full=3-dehydroquinate synthase;       
   49::319     2e-06  28%  381 aa  AROB_RHOPT RecName: Full=3-dehydroquinate synthase;       
   59::357     3e-06  31%  367 aa  AROB_PSEU2 RecName: Full=3-dehydroquinate synthase;       
   59::357     3e-06  30%  367 aa  AROB_PSE14 RecName: Full=3-dehydroquinate synthase;       
   59::357     4e-06  30%  367 aa  AROB_PSESM RecName: Full=3-dehydroquinate synthase;       
   38::303     4e-06  29%  356 aa  AROB_LACLM RecName: Full=3-dehydroquinate synthase;       
   16::247     5e-06  29%  402 aa  GBSB_BACSU RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
    6::253     5e-06  29%  383 aa  ADH2_ECOLI RecName: Full=Probable alcohol dehydrogenase;       
   70::170     6e-06  30%  350 aa  G1PDH_SULTO RecName: Full=Glycerol-1-phosphate dehydrogenase
   20::318     6e-06  26%  366 aa  AROB_MICAN RecName: Full=3-dehydroquinate synthase;       
   49::345     6e-06  28%  388 aa  ADH1_CLOSA RecName: Full=NADPH-dependent butanol dehydrogenase;    
  100::173     1e-05  41%  347 aa  G1PDH_METTH RecName: Full=Glycerol-1-phosphate dehydrogenase
  101::344     1e-05  31%  376 aa  AROB_RHIE6 RecName: Full=3-dehydroquinate synthase;       
   98::320     1e-05  31%  377 aa  AROB_AGRT5 RecName: Full=3-dehydroquinate synthase;       
   33::275     2e-05  27%  361 aa  AROB_SYNY3 RecName: Full=3-dehydroquinate synthase;       
   51::196     2e-05  27%  404 aa  G1PDH_GEOTN RecName: Full=Glycerol-1-phosphate dehydrogenase
   58::228     2e-05  29%  387 aa  DHAT_KLEPN RecName: Full=1,3-propanediol dehydrogenase;       
   69::147     4e-05  29%  334 aa  G1PDH_METM7 RecName: Full=Glycerol-1-phosphate dehydrogenase
  256::321     5e-05  35%  357 aa  AROB_STRP8 RecName: Full=3-dehydroquinate synthase;       
   89::357     5e-05  28%  365 aa  AROB_PSEPW RecName: Full=3-dehydroquinate synthase;       
   13::177     5e-05  33%  355 aa  AROB_DICT6 RecName: Full=3-dehydroquinate synthase;       
   86::185     7e-05  32%  347 aa  G1PDH_THEPD RecName: Full=Glycerol-1-phosphate dehydrogenase
   67::197     7e-05  33%  404 aa  G1PDH_BACST RecName: Full=Glycerol-1-phosphate dehydrogenase
   97::303     7e-05  29%  361 aa  AROB_TERTT RecName: Full=3-dehydroquinate synthase;       
   34::357     7e-05  27%  366 aa  AROB_PSEFS RecName: Full=3-dehydroquinate synthase;       
   69::105     9e-05  38%  381 aa  MEDH_BACMT RecName: Full=NAD-dependent methanol dehydrogenase;     
  256::321     1e-04  34%  357 aa  AROB_STRPZ RecName: Full=3-dehydroquinate synthase;       
  256::321     1e-04  34%  357 aa  AROB_STRPM RecName: Full=3-dehydroquinate synthase;       
  256::321     1e-04  34%  357 aa  AROB_STRPG RecName: Full=3-dehydroquinate synthase;       
  256::321     1e-04  34%  357 aa  AROB_STRP3 RecName: Full=3-dehydroquinate synthase;       
  256::321     1e-04  34%  357 aa  AROB_STRP1 RecName: Full=3-dehydroquinate synthase;       
   18::299     2e-04  24%  368 aa  DOIS_BACCI RecName: Full=2-deoxy-scyllo-inosose synthase;       
   67::224     2e-04  32%  359 aa  AROB_THIDA RecName: Full=3-dehydroquinate synthase;       
   32::357     3e-04  23%  401 aa  G1PDH_BACLD RecName: Full=Glycerol-1-phosphate dehydrogenase
  113::272     3e-04  28%  365 aa  AROB_CHLCH RecName: Full=3-dehydroquinate synthase;       
   34::227     4e-04  30%  394 aa  G1PDH_BACSU RecName: Full=Glycerol-1-phosphate dehydrogenase
  256::321     4e-04  32%  357 aa  AROB_STRP6 RecName: Full=3-dehydroquinate synthase;       
   25::233     4e-04  27%  369 aa  AROB_PSYCK RecName: Full=3-dehydroquinate synthase;       
   82::225     4e-04  26%  368 aa  AROB_PELUB RecName: Full=3-dehydroquinate synthase;       
  104::191     4e-04  32%  373 aa  AROB_HYPNA RecName: Full=3-dehydroquinate synthase;       
   96::222     4e-04  29%  360 aa  AROB_AERHH RecName: Full=3-dehydroquinate synthase;       
  127::273     6e-04  26%  396 aa  PGK_STAAW RecName: Full=Phosphoglycerate kinase;       
  127::273     6e-04  26%  396 aa  PGK_STAAU RecName: Full=Phosphoglycerate kinase;       
  127::273     6e-04  26%  396 aa  PGK_STAAT RecName: Full=Phosphoglycerate kinase;       
  127::273     6e-04  26%  396 aa  PGK_STAAS RecName: Full=Phosphoglycerate kinase;       
  127::273     6e-04  26%  396 aa  PGK_STAAR RecName: Full=Phosphoglycerate kinase;       
  127::273     6e-04  26%  396 aa  PGK_STAAN RecName: Full=Phosphoglycerate kinase;       
  127::273     6e-04  26%  396 aa  PGK_STAAM RecName: Full=Phosphoglycerate kinase;       
  127::273     6e-04  26%  396 aa  PGK_STAAE RecName: Full=Phosphoglycerate kinase;       
  127::273     6e-04  26%  396 aa  PGK_STAAC RecName: Full=Phosphoglycerate kinase;       
  127::273     6e-04  26%  396 aa  PGK_STAAB RecName: Full=Phosphoglycerate kinase;       
  127::273     6e-04  26%  396 aa  PGK_STAA9 RecName: Full=Phosphoglycerate kinase;       
  127::273     6e-04  26%  396 aa  PGK_STAA8 RecName: Full=Phosphoglycerate kinase;       
  127::273     6e-04  26%  396 aa  PGK_STAA3 RecName: Full=Phosphoglycerate kinase;       
  127::273     6e-04  26%  396 aa  PGK_STAA2 RecName: Full=Phosphoglycerate kinase;       
  127::273     6e-04  26%  396 aa  PGK_STAA1 RecName: Full=Phosphoglycerate kinase;       
   88::226     6e-04  27%  395 aa  EUTG_SALTY RecName: Full=Ethanolamine utilization protein eutG;    
   75::173     6e-04  34%  361 aa  AROB_PROAC RecName: Full=3-dehydroquinate synthase;       
   77::108     8e-04  44%  387 aa  YUGJ_BACSU RecName: Full=Probable NADH-dependent butanol
   11::173     8e-04  21%  353 aa  G1PDH_METKA RecName: Full=Glycerol-1-phosphate dehydrogenase
   96::187     8e-04  32%  370 aa  AROB_RHOOB RecName: Full=3-dehydroquinate synthase;       
   94::228     8e-04  31%  378 aa  AROB_RHILO RecName: Full=3-dehydroquinate synthase;       
   90::183     8e-04  30%  368 aa  AROB_MARMS RecName: Full=3-dehydroquinate synthase;       
   97::183     8e-04  33%  362 aa  AROB_HAEI8 RecName: Full=3-dehydroquinate synthase;       
   18::183     8e-04  24%  362 aa  AROB_ACTSZ RecName: Full=3-dehydroquinate synthase;       
    1::362

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRIFASPSRYIQGENALFENAKSILDLGNYPILLCDQLVYDIVGKRFEDYLHRYGFHIVLALFNGEASDN
GLDA_BACST      -RVFISPAKYVQGKNVITKIANYLEGIGNKTVVIADEIVWKIAGHTIVNELKKGNIAAEEVVFSGEASRN
GLDA_ECOLI      -RIIQSPGKYIQGADVINRLGEYLKPLAERWLVVGDKFVLGFAQSTVEKSFKDAGLVVEIAPFGGECSQN
GLDA_ECOL6      -RIIQSPGKYIQGADVINRLGEYLKPLAERWLVVGDKFVLGFAQSTVEKSFKDAGLVVEIAPFGGECSQN
GLDA_CITFR      LKVIQSPAKYLQGPDASTLFGQYAKNLADSFFVIADDFVMKLAGEKVLNGLHSHDISCHAERFNGECSHI
GLDA_THEMA      ------PGRYVQGAGAINILEEELSRFGERAFVVIDDFVKNVLGENFFSSFTKV--RVNKQIFGGECSDE
GLDA_PSEPU      -RAIQSPGKYVQGADALQRLGDYLKPLADSWLVIADKFVLGFAEDTIRQSLSKAGLAMDIVAFNGECSQG
GLD1_SCHPO      -RIFTSPQKYVQGRHAFTRSYMYVKKWATKSVVLADQNVWNICANKIVDSLSQNGMTVTKLVFGGEASLV
Y1167_SYNY3     --------------SALAKAGEHLQKLGSKGLVVTGSHSAELGEKSLQTLQKNYGLTLPLASYLPDCAES
YBDH_ECOLI      -------------------------------------------------------------LFRGHCSES
G1PDH_METHJ     ----------------------------------------------------------------------
G1PDH_METB6     ------------------------LKLGRSALLISGKNTMDRAGKTVQDVIGKTCDVMVYI------SDE
G1PDH_PYRAE     ----------------------------------------------------------------------
G1PDH_METBU     -----------------------------------------IAGEIVQDSLQDAGQNVELVI-SESASMK
G1PDH_THESM     MHLMELPREVLLGED-LKDKVSQVLKLGENVLILYGPKTKEIAGKDIEKHLKEF-FHVKNLLIK-EASMK
G1PDH_NITMS     ------------------------------------------------------------------SKDN
G1PDH_PYRCJ     ----------------------------------------------------------------------
G1PDH_PYRAR     ----------------------------------------------------------------------
G1PDH_PYRIL     ----------------------------------------------------------------------
G1PDH_SULAC     --------KHIYTGYGILDNFRNYLQTLNLPLVITGPVIHEIFSKRIEEHIKDFKYEVVIV---NKSDLS
G1PDH_METAC     ------------------------LKLKGNALIVTGNTTRDVAGKRVSTLLENAGSSTEMVL-TCRATME
G1PDH_HALMA     ------PRNVVVGHGVLGQTIEAVLHLTGRPLVVSSPTPHDVAGKQVVAQFEDEGYEIVIE----EASFD
G1PDH_NATPD     ------PRSVVVGHGVLDRTAEAVLYLDGRPLIVTSPTPEELAVDRLREQFVSAGFDPAVAVVE-EASFD
G1PDH_METST     ----------------------------------------------------------------------
G1PDH_METPE     ------PRDVVIGHNALFPAVCQDLKIGRSVMLFAGKSTMQVAGNRIEELLAP-SFDISTFLARELTPES
G1PDH_METMA     ------------------------LKLKGNALIVTGSTTQDVAGKRVSRLLEDAG-NSTETVLTCRATME
G1PDH_METBF     ------PRDVLVGHGVLEEIGDVCRDLGN-ALIVTGSTTNNIAGKRVSNLLESAGCSAEMVL-TCKATKE
G1PDH_METS5     -----------------------------------------------------------------DSSID
G1PDH_IGNH4     -------------------------------------------GDELQGLLEKEGFKVDFVTVV-EPSVE
G1PDH_PYRFU     MHIMEFPREVILGKNVISENVAKRLSFSSPVLVVYGPKTKEIAGKDVERVLEEFDVHSVIVK---EATIN
G1PDH_METJA     ----------------------------------------------------------------------
G1PDH_THENV     ----------------------------------------------------------------------
G1PDH_CENSY     --------------------------------LISGRTVQGATGRKIEGSLKRSGIKWSWHM----AGTN
G1PDH_METTP     ------PRRVVAGAGALANIGDVCVDLSGRALVITGPQTRSVAGDNLAASLTDCGFEADVVITR-DPRPA
G1PDH_PYRHO     MHLMEFPREVILGKNLIQENVIKRLKLGSPGLVVYGPITKKIAGSNVEKIVKEE--FEVYSITVKEAHIN
G1PDH_PICTO     -------------------------------LLITGENTYNIAGKKVLSNLNDFDVNVIIA---SRATRD
G1PDH_CALMQ     -------------------------------------------------------------------SDD
G1PDH_METLZ     ------PRDVIAGHDALLQLPNVITDLGGPLLLLSGKTTLQTVGL---EVLRLLEDRQVTSAVVGEITYE
G1PDH_HALSA     -----------------------------------------------------------------EATFN
G1PDH_HALS3     -----------------------------------------------------------------EATFN
G1PDH_STAMF     ---------------------------------------YNVAGKIVEEAMKNNGY-IVEVWKARDARIE
G1PDH_PYRKO     ------PREVLLGENLTGESVAKRIGLTGKALVIYGPKTKEIAGRDVEDAI-KSAYEVSSLTIRKGATME
G1PDH_META3     ----------------------------------------------------------------------
G1PDH_METS3     ------PREVYIGPDVIYETGEICKDLDNKVLVLTGPNTYDIAAKHAIESLENQDIEVDVKIVEKVSYDS
G1PDH_METMJ     ------------------------LALGDSVLIVSGGQTRDIAGKRVEALLA--GSYDVVTF---AANDG
G1PDH_THEAC     ----------VVGENSRNKNA----------IIVSGDLTYELAGRKVHDLLSTYGYHVFLA---GNANYD
G1PDH_PYRAB     -----------------------------------------------------------------KAHIG
G1PDH_UNCMA     ----------------------------------------------------------------------
G1PDH_THEVO     -------------------------------IIVTGNTTYELAGKKIVEILASSPYEVHLS-FAGEANYE
G1PDH_BACA2     ----------------------------NHPVIVCDRNTYEAAGRLLADELRAGGIKASKVIIPGAAAAD
AROB_LACSS      --------------------------------LVTDTIVGPLYQAQITEQLTQAGFQVTVLTIPAGESAK
G1PDH_BACSK     -------------------------------VLVADSHTYKAAGRDLHDHLCQKGWHLLEPNSNGDIIAD
EUTG_ECOLI      ----------------------------------------------------------------GEPCIT
G1PDH_BACHD     --------------------------------IVADANTYAVAGQLVAQLLKGRGIDVENCILKEQADEH
G1PDH_HALWD     ------PRNVLVGHDVIGDLAAAILYLDGRPLIVTSPTPDQLIGNRV-----RSQFADPQTVSVDHASFD
G1PDH_KORCO     -------------------------------------------------------YRILHVLTTGGLED-
AROB_AGRRK      ----------------------------------------------------------------------
G1PDH_SULIL     ----------------------------------------------------------------------
G1PDH_METM5     -----------------------------------------ITGKNTKKYNKDFDF-----IYYDEIETS
ADH4_SCHPO      ---FYIPSFNLFGKGCLAEAAKQIKMSGFKNTLIVTDPLYDKVKALLEEQ------SITVHLYDGVQPNG
AROB_RHIL3      ----------------------------------------------------------------------
G1PDH_HALLT     ----------------------------------------------------------------------
AROB_THETN      --------------------------------VITDSNVYPLYFEKIEESLRKSGFDVLYEVIPAGETSK
AROB_RHOPA      --------------------------------IVTDRTVAKTWLKRTEEVLDQAGIHASVIVGEGESSKS
AROB_RHILW      ----------------------------------------------------------------------
AROB_DECAR      ---------------------------------------------------------------------N
AROB_CYAP7      ----------------------STLNLGKKVLLVSNPEIYDYYGEIAVNSLKTAGFEVATHLIEGEIYKD
G1PDH_SULIY     ----------------------------------------------------------------------
G1PDH_SULIN     ----------------------------------------------------------------------
G1PDH_SULIM     ----------------------------------------------------------------------
G1PDH_SULIK     ----------------------------------------------------------------------
G1PDH_SULIA     ----------------------------------------------------------------------
AROB_AZOSE      ----------------------------------------DVVGPRLQRALEADGVRVVVTLPDGESHKN
AROB_RHOPT      --------------------------------IVTDRTVAKTWLKRTEEVLDQVGIHASVIVGEGESSKS
AROB_PSEU2      ------------------------------------------------------GYNVLIVLPDGEAFKN
AROB_PSE14      ------------------------------------------------------GYNVLIVLPDGEAFKN
AROB_PSESM      ------------------------------------------------------GYNVLIVLPDGEAFKN
AROB_LACLM      -------------------------------VLISDNHVNGLYGQKVVDQLEKSGFEVETFEFEGEASKN
GBSB_BACSU      ---FEIPTVIKHGIGAIKHTGEEVAALGSKALLVTDPGIYKAVADPVIESLKEAGIEVVL--FNKVEPNP
ADH2_ECOLI      ---FFIPSVNVIGADSLTDAMNMMADYGFTRTLIVTDNMLTKLGMAGDVQKALEERNIFSVIYDGTQPNP
G1PDH_SULTO     ------------------------------------------------------------------ASID
AROB_MICAN      -----------KGSLANLGGEMSQLSLGKKVLLVSNPEIFDYYGQIAVNSLEKAGFAVFTHLIPAGENYK
ADH1_CLOSA      -------------------------------------------------YLKEAGIEV--KLIEGVEPDP
G1PDH_METTH     ----------------------------------------------------------------------
AROB_RHIE6      ----------------------------------------------------------------------
AROB_AGRT5      ----------------------------------------------------------------------
AROB_SYNY3      ------------------------LGLGKKIMVVSNPEIYDYYGEVVIQALQRAGYEVFQHLIPGEASIN
G1PDH_GEOTN     -------------------------------VVVADNRTFTAAGRSLCDKLKNESVLYTVCLIQSDENED
DHAT_KLEPN      -------------------------------------------------YLREAGIEV--AIFDGNPKDT
G1PDH_METM7     ----------------------------------------------------------------------
AROB_STRP8      ----------------------------------------------------------------------
AROB_PSEPW      ----------------------------------------------------------------------
AROB_DICT6      -----------------------------YPIYIG----YDILKKFLKNYRDNYSFSFIITLYDGEKSKS
G1PDH_THEPD     ----------------------------------------------------------------------
G1PDH_BACST     ---------------------------------LCDQL---------ENGSIRYTVCLVQPDENGDVIAD
AROB_TERTT      ----------------------------------------------------------------------
AROB_PSEFS      ---------------------------GRQVAIISNETVAPLYLERLNRSLAAYSV-ISVILPDGEAHKN
MEDH_BACMT      -----------------------------------------------------------------DPADT
AROB_STRPZ      ----------------------------------------------------------------------
AROB_STRPM      ----------------------------------------------------------------------
AROB_STRPG      ----------------------------------------------------------------------
AROB_STRP3      ----------------------------------------------------------------------
AROB_STRP1      ----------------------------------------------------------------------
DOIS_BACCI      ------------GEHVL-ESVESYIPRDEFDIMISDSGVPDSIVHYAAEYFGKLAPVHILRFQGGETVTN
AROB_THIDA      -----------------------------------------------------------VVLPDGEAYKN
G1PDH_BACLD     ------------GDNAVEQELPAFVKSASYKAVIYDETTGRLAGKRIASLLEETAETVPVLLEANEAGDD
AROB_CHLCH      ----------------------------------------------------------------------
G1PDH_BACSU     --------------------ADSLLDYNQHIVLVCDANTHRIAGIDLENRLNQEGFQACLIIPENEAGDD
AROB_STRP6      ----------------------------------------------------------------------
AROB_PSYCK      -------------ENAIAENSSMASQVAPYVLIVTNETVAPLYLKALQEELEAQFTVQVCVLPDGEQYKN
AROB_PELUB      -------------------------------------------------------------------SVN
AROB_HYPNA      ----------------------------------------------------------------------
AROB_AERHH      ----------------------------------------------------------------------
PGK_STAAW       ------------------KESKNDPELGKYWASLGDVFVNDAFGTAHREHASNVGISTHLETAAGFLMDK
PGK_STAAU       ------------------KESKNDPELGKYWASLGDVFVNDAFGTAHREHASNVGISTHLETAAGFLMDK
PGK_STAAT       ------------------KESKNDPELGKYWASLGDVFVNDAFGTAHREHASNVGISTHLETAAGFLMDK
PGK_STAAS       ------------------KESKNDPELGKYWASLGDVFVNDAFGTAHREHASNVGISTHLETAAGFLMDK
PGK_STAAR       ------------------KESKNDPELGKYWASLGDVFVNDAFGTAHREHASNVGISTHLETAAGFLMDK
PGK_STAAN       ------------------KESKNDPELGKYWASLGDVFVNDAFGTAHREHASNVGISTHLETAAGFLMDK
PGK_STAAM       ------------------KESKNDPELGKYWASLGDVFVNDAFGTAHREHASNVGISTHLETAAGFLMDK
PGK_STAAE       ------------------KESKNDPELGKYWASLGDVFVNDAFGTAHREHASNVGISTHLETAAGFLMDK
PGK_STAAC       ------------------KESKNDPELGKYWASLGDVFVNDAFGTAHREHASNVGISTHLETAAGFLMDK
PGK_STAAB       ------------------KESKNDPELGKYWASLGDVFVNDAFGTAHREHASNVGISTHLETAAGFLMDK
PGK_STAA9       ------------------KESKNDPELGKYWASLGDVFVNDAFGTAHREHASNVGISTHLETAAGFLMDK
PGK_STAA8       ------------------KESKNDPELGKYWASLGDVFVNDAFGTAHREHASNVGISTHLETAAGFLMDK
PGK_STAA3       ------------------KESKNDPELGKYWASLGDVFVNDAFGTAHREHASNVGISTHLETAAGFLMDK
PGK_STAA2       ------------------KESKNDPELGKYWASLGDVFVNDAFGTAHREHASNVGISTHLETAAGFLMDK
PGK_STAA1       ------------------KESKNDPELGKYWASLGDVFVNDAFGTAHREHASNVGISTHLETAAGFLMDK
EUTG_SALTY      ----------------------------------------------------------------GEPCIT
AROB_PROAC      ----------------------------------------------------------------------
YUGJ_BACSU      ----------------------------------------------------------------------
G1PDH_METKA     ------PREVVVGSNVLPEVPKLLRSVGGVVAVFSGRTTMKIAGNEVADHLEEAGYQTSPVIVKGSTGD-
AROB_RHOOB      ----------------------------------------------------------------------
AROB_RHILO      ----------------------------------------------------------------------
AROB_MARMS      ----------------------------------------------------------------------
AROB_HAEI8      ----------------------------------------------------------------------
AROB_ACTSZ      ------------GEGLLTDSSVYPLKSGDKVMIVTNETIAPLYLETVTDTLNQIGCHVLLKDGEKYKTLG


                         .         .         *         .         .         .         .:140
query           EINRVVALAEKENCDSIIGLGGGKTIDSAKAIADLIEKPVIIAPTIASTDAPVSALSVIYTDEGAFDHYL
GLDA_BACST      EVERIANIARKAEXXXXXXXXXXKTLDTAKAVADELDAYIVIVXXXXXXXXXXXXLSVIYSDDGVFESYR
GLDA_ECOLI      EIDRLRGIAETAQCGAILGIGGGKTLDTAKALAHFMGVPVAIAPTIASTDAPCSALSVIYTDEGEFDRYL
GLDA_ECOL6      EIDRLRGIAETAQCGAILGIGGGKTLDTAKALAHFMGVPVAIAPTIASTDAPCSALSVIYTDEGEFDRYL
GLDA_CITFR      EINRLIAILKQHXXXXXXXXXXXKTLDTAKAIGYYQKLPVVVIPTIASTDAPTSALSVIYTEAGEFEEYL
GLDA_THEMA      EIERLSGLVEEET-DVVVGIGGGKTLDTAKAVAYKLKKPVVIVPTIASTDAPCSALSVIYTPNGEFKRYL
GLDA_PSEPU      EVDRLCQLATQNGRSAIVGIGGGKTLDTAKAVAFFQKVPVAVAPTIASTDAPCSALSVLYTDEGEFDRYL
GLD1_SCHPO      ELDKLRKQCP-DDTQVIIGVGGGKTMDSAKYIAHSMNLPSIICPXXXXXXXXXXXXXVIYTPDGQFQKYS
Y1167_SYNY3     SLEQLRRRVHQEQPDFILGIGGGKALDTAKLLAHQTQLAIATVPTSAATCAGWTALANVYSETGAFRYDV
YBDH_ECOLI      DVQQLAAESGDDR-SVVIGVGGGALLDTAKALARRLGLPFVAVPTIAATCAAWTPLSVWYNDAGQALHYE
G1PDH_METHJ     ------------SADFLIGVGGGRVIDCAKIVSYKQGKPFISVPTAASHDGIISGRATLPTETGSVS---
G1PDH_METB6     ISPAVIKDAEKKDVDFVIGVGGGRVIDTAKIVSYNLDRQFVSVPTAASHDGIASARASVPTGEG---NVS
G1PDH_PYRAE     ----------KSSYDLVIGVGGGRPIDMAKVYSCVHKKPLVVIPTAASHDG-IASPYVSYTLSQKLQTYG
G1PDH_METBU     EVERIRKHAIESGTKYFLGVGSGKTIDVAKLAATDLEVPFISVPTAASHDGIVSSRASIKDGKTTTS---
G1PDH_THESM     NVQKALEIIRNENIDWLLGVGGGSIIDVAKLASFKADVPFISFPTTASHDGIASANASI-RDLGA--KTS
G1PDH_NITMS     QINRIEKEVKKDRSDMIAGIGGGRSVDTAKLISFNLDIPFVSVPTAASHDGVSSPFVSVKSDK----PHS
G1PDH_PYRCJ     ---------EKPGFDLVIGIGGGRPLDMAKVYSYIHKKPFVAIPTSASHDG-IASPYVSFSLTQRFSKYG
G1PDH_PYRAR     --------------DLVLGVGGGRPIDVAKVYSYLHRAPLIVIPTSASHDGIASPYVSYALSQKMASHGK
G1PDH_PYRIL     ---------EKSGFDLVLGVGGGRPIDMAKVYSYVHKKPLVIVPTSASHDG-IASPYVSYTLAQKMIKYG
G1PDH_SULAC     EAEKVEDIARQKGIKTILGVGGGTVIDIAKFTAYKIDREFISIPTSPSHDGITSPFAAI---KGLGKPIS
G1PDH_METAC     EVDKIMQKASETGATFLLGIGSGRSIDLAKLASTRLEIPFISVPTAASHDGIASSRASI-IDNG--KNAS
G1PDH_HALMA     AVQQVIDHASDIDAGFLLGVGGGKAIDITKMAADDLGLGFVSVPTAASHDGIVSGRGSV--PEGDTRHSV
G1PDH_NATPD     AVERVIETAERETAGFLVGFGGGKPIDIAKMAADERNCGFISVPTAASHDGIVSGRGSV--PEGDTRHSV
G1PDH_METST     ---------------AILGVGGGKVIDVAKMASTINHIPLISVPTTAAHDGMASPRASIKNDKGTVS---
G1PDH_METPE     -----MKEGEEAACDLIIGVGGGRVIDTAKIVSFNLDLPFISVPTAASHDGIASGRASLQTSEGSAS---
G1PDH_METMA     EVDKLMEKALNTEATFLLGVGSGRSIDLAKLASTRLEIPFISVPTAASHDGIASSASVIDNGKNA----S
G1PDH_METBF     EVEKVMEKALEVETNFLIGVGSGRSIDLAKLASTRLELPFISVPTAASHDGIASSRASI-VDNGRSTS--
G1PDH_METS5     EVNRVEEKAKQLNPKFVLGIGGGKTIDVAKYVAYKLNVNFISIPTAPSHDGITSPFASI---KGLGKPVS
G1PDH_IGNH4     EANKVLEGLNGEP-NVVVGFGGGKAIDVAKYVAMKLGRDVVSVPTATSHDGIASPFSSL---KGLKGPTS
G1PDH_PYRFU     EVEKVEGIIRDNKVKWAIAVGGGTIIDVTKLASYRAGIPFVSFPTTASHDGIASANASI---KGLGTKTS
G1PDH_METJA     --NLEIELKKYTAYDCVIGIGGGRSIDTGKYLAYKLGIPFISVPTTASNDGIASPIVSIRQPS-------
G1PDH_THENV     ---------EKSGFDLIIGVGGGRPLDMAKVYSYVHKRPLIVVPTSASHDG-IASPYISYILAEKVKRYG
G1PDH_CENSY     DPESIASVQEAVRSDEAVGIGGGRAVDTAKMAAFKLGIPFVSVPTAASHDGIASPFVSIKGDK----PHS
G1PDH_METTP     EVDRVKSFALDYKADFLIGAGGGRSIDIAKLAAYHLDIPYLSVPTAASHDGIASAMASLNMDG---ETKS
G1PDH_PYRHO     EVERVISKIRDKGIKWAIAVGGGSIIDVTKLASFKMGIPFISFPTTASHDGIASANASI---KGLNVKTS
G1PDH_PICTO     SIKSIEESLKNRRSGIVLGVGGGSKIDIAKKIAYDLGIPFISVPTTPSHDGIASPRASIYDGKSVYSE--
G1PDH_CALMQ     EIELVKGMSAFSDVDFIAGVGGGRVIDVSKVIAYKLNKHLISIPTVASHDGIASPISFLMQDDLNKLGVG
G1PDH_METLZ     EIARVEDLAQNXXXXXXXXXXXXXXXDTAKVVSYNLDIQFISVPTAASHDGIASSRASIMTADG----NV
G1PDH_HALSA     SVERVLGEAEAVDPGYLVGVGGGKAIDIAKLASDHLNVGFVSVPTAASHDGIVSGRGSV--PEGDTRHSV
G1PDH_HALS3     SVERVLGEAEAVDPGYLVGVGGGKAIDIAKLASDHLNVGFVSVPTAASHDGIVSGRGSV--PEGDTRHSV
G1PDH_STAMF     TANQIVEETKKHGIKIFLGVGGGKSIDLAKYAAYKNNGYMISVPTAASHDGIASPFASL---KGXXXXXX
G1PDH_PYRKO     EVERTIEKIKDEGIGWVIAVGGGSIIDVAKLSSFKTGVPFISFPTTASHDGIASANASI-KDLGS--KTS
G1PDH_META3     ------------NFDCIIGVGGGKAIDVGKYIAYKYNKQFISIPTTASND---GIASPIISQQGK----S
G1PDH_METS3     EVSEMITSGT-----NVLGVGGGKVIDVAKLASYDKNVFFVSMPTTASHDGIVSPLASIKTSTSAKAHA-
G1PDH_METMJ     NPFETIRKAEEXXXXXXXXXXXXXXIDTAKIASYNTDRHFISVPTAASHDGIASSRASVPTADG---NVS
G1PDH_THEAC     TLERIEYESLDIQXXXXXXXXXXXKIDLAKKLAFDRKLPFVSVPTIASPRASLRRNGISYSEEGAM----
G1PDH_PYRAB     EVEKVEAKIRDYNIKWAIAVGGGSIIDVTKLASYRSGIPFISFPTTASHDGIASANASI---RGIEAKTS
G1PDH_UNCMA     ------------------GVGGGKSIDIAKIASTRLNMYYLSIPTAASHDGIASSRASIRHDG---ETVS
G1PDH_THEVO     NLKKIEEETNDVNAXXXXXXXXXTKIDLAKKLAYDKNLPFISIPTIASPRASLRRNGISYSEEGAM----
G1PDH_BACA2     ERTLVYTLINAEETDVIIAAGAGTIHDITRFAAYQRGLPFISFPTAPSVDGFTSAGAPLILNG---IKTT
AROB_LACSS      SLEQAMSLYEANRSDGLIALGGGVVGDLTGFVASTYMRPFIQIPTLAQVDSSVGGKTAVDLPAGKNLVGT
G1PDH_BACSK     EVSLIVMLKVEQSTKLLVAVGAGTIHDIVRFVSGKTNKPFVSIPTAPSVDG-FTSLGAPIVVQGSKKTYQ
EUTG_ECOLI      DVCAAVAQLRESGCDGVIAFGGGSVLDAAKAVTLLVTNPLIAIPTTAGTGSETTNVTVIIDAVSGRKQVL
G1PDH_BACHD     GLGQLVIGAAKET-DVFLAVGAGTIHDLTRIASYKFGKPFIAIPTAPSVDGFTSMGAPVIRDGVKIT---
G1PDH_HALWD     AVEAVIDTAKATDAGYLIGLGGGKPIDTAKMASDRLGCGFVSVPTAASHDGIVSGRSSI--PEGDTRH-S
G1PDH_KORCO     -LMDAIKTARKSEVDLLIGVGGGKPLDITKILAAELGVRYVVVPTSASHDG-IASPSVSFTLSREIEERV
AROB_AGRRK      -----VLTARIERNDAVIALGGGVIGDLSGFAAGIVRRGVVQVPTLSQVDSSVGGKTGINTHHGKNLVGV
G1PDH_SULIL     ------------NPNILLGIGGGKVIDVTKYAAFRNNLEFVSIPTSPSHDGITSPFASI---KGLQKPVS
G1PDH_METM5     DLENIKNYAN--DYDSIMGIGGGRPIDIGKLIAHKSKKPFLSVPTTASNDGIASPIVSLTQPS-------
ADH4_SCHPO      NVNQGLEIVKKENCDSMVSIGGGSAHDCAKGIALLAQLPLIAINTTAGTASEMTRFAII-TEETRHIKMA
AROB_RHIL3      --------ARVERNDYVIALGGGVIGDLSGFAAGIVRRGVVQVPTLSQVDSSVGGKTGINSRHGKNLIGV
G1PDH_HALLT     ---KLTETAEAVDPGYLIALGGGKPIDIAKMAADHLGVGFVSVPTVASHDGIVSGRSSI--PEGDTRH-S
AROB_THETN      TMEMAQRLLEVARDSSIIALGGGVVGDIAGFVADFIQIPTTL---LAQVDSSVGGKVAVNLKKGKNIVGA
AROB_RHOPA      QVCEALIAAKIERNDLVIALGGGVIGDLAGFSASLLRRGVVQVPTLAQVDSSVGGKTGINSPQGKNLIGT
AROB_RHILW      --------ARVERNDCVIALGGGVIGDLSGFAAGIVRRGVVQVPTLAQVDSSVGGKTGINSRHGKNLIGV
AROB_DECAR      LIFDALLAARCERNTTLIALGGGVIGDMGGFAAACYQRPFIQVPTLSQVDSSVGGKTAINHPMGKNMVGA
AROB_CYAP7      SITQIYDTAVEERSSTMIALGGGVVGDMTGFAAATWLRGIVQVPTLAMIDAAIGGKTGVNHPKGKNLIGA
G1PDH_SULIY     ------------NPNILLGIGGGKVIDVTKYAAFRNNLEFVSIPTSPSHDGITSPFASI---KGLQKPVS
G1PDH_SULIN     ------------NPNILLGIGGGKVIDVTKYAAFRNNLEFVSIPTSPSHDGITSPFASI---KGLQKPVS
G1PDH_SULIM     ------------NPNILLGIGGGKVIDVTKYAAFRNNLEFVSIPTSPSHDGITSPFASI---KGLQKPVS
G1PDH_SULIK     ------------NPNILLGIGGGKVIDVTKYAAFRNNLEFVSIPTSPSHDGITSPFASI---KGLQKPVS
G1PDH_SULIA     ------------NPNILLGIGGGKVIDVTKYAAFRNNLEFVSIPTSPSHDGITSPFASI---KGLQKPVS
AROB_AZOSE      TLNLVFDMLLATRCETLIALGGGVVGDMAGFAAATYQRPFIQVPTLSQVDSSVGGKTAINHPLGKNMIGA
AROB_RHOPT      QVCEALIAAKIERNDLVIALGGGVIGDLAGFSASLLRRGVVQVPTLAQVDSSVGGKTGINSPQGKNLIGT
AROB_PSEU2      TIFDGLLTARHDRRTTVIALGGGVIGDMAGFAAACYQRGVIQIPTLSQVDSSVGGKTGINHPLGKNMVGA
AROB_PSE14      TIFDGLLTARHDRRTTVIALGGGVIGDMAGFAAACYQRGVIQIPTLSQVDSSVGGKTGINHPLGKNMVGA
AROB_PSESM      TIFDGLLTARHDRRTTVIALGGGVIGDMAGFAAACYQRGVIQIPTLSQVDSSVGGKTGINHPLGKNMVGA
AROB_LACLM      LLTAEKACAELTRSDGIIALGGGVTGDLAGFVASTYMRGILQIPTSLTAQVDSSIGGKTGINSKMAKNMI
GBSB_BACSU      PVNEGSELYKKENCNGLVAVGGGSSMDTAKAIGSVLDPPLTTIPTTAGTGSEVTQWAVITDEEREFK---
ADH2_ECOLI      TTENVAALLKENNCDSVISLGGGSPHDCAKGIALVAQLPMIAINTTAGTASEMTRFCII-TDEARHIKMA
G1PDH_SULTO     EVNKVEEMAKGSRXXXXXXXXXXXXXDVAKYVAYRIGKEFVSLPTAPSHDGITSPFASI---KGLGKPTS
AROB_MICAN      TLDAIAALAHRERSSTMVALGGGVIGDMTGFAAATWLRGVVQVPTLAMVDASIGGKTGVNHPQGKNLIGA
ADH1_CLOSA      SVETVFKGAEQFEPDWIIAMGGGSPIDAAKAMWIFYEHPFLAIPSTSGTATEVTAFSVITDYKTEIKYPL
G1PDH_METTH     ----------------------------AKMSATLEGLHFISVPTAASHDGIASPRASIRNGEGTAS---
AROB_RHIE6      ------ARVERNGC--VIALGGGVIGDLSGFAAGIVRRGVVQVPTLAQVDSSVGGKTGINSRHGKNLIGV
AROB_AGRT5      -----VLSARVERNDAVIALGGGVIGDLAGFAAGIVRRGVVQIPTLSQVDSSVGGKTGINTRHGKNLVGV
AROB_SYNY3      ELYDVAFQANLERNSTLLSLGGGVIGDMTGAATWLRGINFVQVPTLAMVDASIGGKTGVNHPQGKNLIGA
G1PDH_GEOTN     VIAMQVLLETPNDVDAFIAVGAGTVHDITRFSSYKMKVPFISVPTAPSVDAPLIIRGVKKTIQ-------
DHAT_KLEPN      NVRDGLAVFRREQCDIIVTVGGGSPHDCGKGIGDLYQPPIVAVNTTAGTASEVTRHCVLTNTETKVKFVI
G1PDH_METM7     --------------DSVXXXXXXXXXXXXKLIAHKSKKPFLSVPTTASNDGIASPIVSLTQPS-------
AROB_STRP8      ----------------------------------------------------------------------
AROB_PSEPW      --------ARHDRRTTVVALGGGVIGDMAGFAAACYQRGVIQVPTLSQVDSSVGGKTGINHPLGKNMVGA
AROB_DICT6      RISRELAQRGADRKSAIFAFGGGVIGDLTGFVASIYMRGIIQIPTLAQVDSSIGGKTGINIKEGKNLIGT
G1PDH_THEPD     ------------------GLGGGRPVDVAKYAAFMEGLPFVSVPTAISHDGFASPIVALKDPEG--NPLS
G1PDH_BACST     ERSIVQVLLETDDVDVLIAVGAGTIHDITRFSSYKMRIPFISVPTAPSVDAPLIIRGVKKTIQ-------
AROB_TERTT      ---------------TLIALGGGVVGDMTGFAAACYQRGVIQVPTLSQVDSSVGGKTGVNHPQGKNMIGA
AROB_PSEFS      ETLQLILTARHDRRTTVIALGGGVIGDMAGFAAACYQRGVIQVPTLSQVDSSVGGKTGINHPLGKNMVGA
MEDH_BACMT      QVHEGVDVFKQENCDALVSIGGGSSHDTAKAI--------------------------------------
AROB_STRPZ      ----------------------------------------------------------------------
AROB_STRPM      ----------------------------------------------------------------------
AROB_STRPG      ----------------------------------------------------------------------
AROB_STRP3      ----------------------------------------------------------------------
AROB_STRP1      ----------------------------------------------------------------------
DOIS_BACCI      LQERAIALGANRRT-AIVAVGGGLTGNVAGVAAGMMFRGIALVPTLAASDSVLSIKQAVNLTSGKNLVGF
AROB_THIDA      TLNLVFDALLRERAETLIALGGGVIGDMTGFAAACYQRPFIQIPTLSQVDSSVGGKTGINHPLGKNMIGA
G1PDH_BACLD     EQTLVSALIGVPDADVLIAAGAGTIHDIVRFCAYQRGIPFISVPTAPSVDGFTSAGAPLILKG---KKQT
AROB_CHLCH      --------------------------------------PVIQMPTLAMTDSAIGGKVAINHPLGK--NLI
G1PDH_BACSU     ERSLIVLIHTKQPTDVMIAVGSGTIHDIVRFAAFQRDLPFISYPTAPSVDGFTSAGAILYGTKTTIQ---
AROB_STRP6      ----------------------------------------------------------------------
AROB_PSYCK      QINQIVLMAVHFNRDTLIALGGGVIGDMTGFAAASFMRGVIQIPTLSQVDSSVGGKTGINHPQGKNMIGA
AROB_PELUB      EITSILLKKSFNRNDCLISIGGGITGDVSGFAASTFKRGLVNIPTLSQVDSSIGGKTGVNTKYGKNLIGS
AROB_HYPNA      --------------DTLIAFGGGVIGDMGGLAASLMKRGMVQVPTLAQVDSSVGGKTAVNTPRGKNLIGA
AROB_AERHH      ---------------TLIALGGGVIGDVVGFAAASYQRPFIQVPTLSQVDSSVGGKTAVNHPLGKNMIGA
PGK_STAAW       EIKFIGGVVNDPHKPVVAILGGAKVSDKINVIKNLVDKIIIMAYTFLKAQGKEIGISLLEEDKIDFAKDL
PGK_STAAU       EIKFIGGVVNDPHKPVVAILGGAKVSDKINVIKNLVDKIIIMAYTFLKAQGKEIGISLLEEDKIDFAKDL
PGK_STAAT       EIKFIGGVVNDPHKPVVAILGGAKVSDKINVIKNLVDKIIIMAYTFLKAQGKEIGISLLEEDKIDFAKDL
PGK_STAAS       EIKFIGGVVNDPHKPVVAILGGAKVSDKINVIKNLVDKIIIMAYTFLKAQGKEIGISLLEEDKIDFAKDL
PGK_STAAR       EIKFIGGVVNDPHKPVVAILGGAKVSDKINVIKNLVDKIIIMAYTFLKAQGKEIGISLLEEDKIDFAKDL
PGK_STAAN       EIKFIGGVVNDPHKPVVAILGGAKVSDKINVIKNLVDKIIIMAYTFLKAQGKEIGISLLEEDKIDFAKDL
PGK_STAAM       EIKFIGGVVNDPHKPVVAILGGAKVSDKINVIKNLVDKIIIMAYTFLKAQGKEIGISLLEEDKIDFAKDL
PGK_STAAE       EIKFIGGVVNDPHKPVVAILGGAKVSDKINVIKNLVDKIIIMAYTFLKAQGKEIGISLLEEDKIDFAKDL
PGK_STAAC       EIKFIGGVVNDPHKPVVAILGGAKVSDKINVIKNLVDKIIIMAYTFLKAQGKEIGISLLEEDKIDFAKDL
PGK_STAAB       EIKFIGGVVNDPHKPVVAILGGAKVSDKINVIKNLVDKIIIMAYTFLKAQGKEIGISLLEEDKIDFAKDL
PGK_STAA9       EIKFIGGVVNDPHKPVVAILGGAKVSDKINVIKNLVDKIIIMAYTFLKAQGKEIGISLLEEDKIDFAKDL
PGK_STAA8       EIKFIGGVVNDPHKPVVAILGGAKVSDKINVIKNLVDKIIIMAYTFLKAQGKEIGISLLEEDKIDFAKDL
PGK_STAA3       EIKFIGGVVNDPHKPVVAILGGAKVSDKINVIKNLVDKIIIMAYTFLKAQGKEIGISLLEEDKIDFAKDL
PGK_STAA2       EIKFIGGVVNDPHKPVVAILGGAKVSDKINVIKNLVDKIIIMAYTFLKAQGKEIGISLLEEDKIDFAKDL
PGK_STAA1       EIKFIGGVVNDPHKPVVAILGGAKVSDKINVIKNLVDKIIIMAYTFLKAQGKEIGISLLEEDKIDFAKDL
EUTG_SALTY      DVCAAVAQLREAACDGVVAFGGGQTLSAMTEHSTLRPRPLIAVPTTAGTGSETTNVTVIIDAVSGRKQVL
AROB_PROAC      ---RRLAEANMTRGDIIVGFGGGATTDVAGFLADVIHVPTTV---LAMADAAIGGKTGVNIPAGKNLVGA
YUGJ_BACSU      -VNKGVAICKEQNIDFLLAVGGGSVIDCTKAIA-------------------------------------
G1PDH_METKA     DVKKALEALDEXXXXXXXXXXXXXXXXXXXXXSYRRGIPFISVPTSASHDGIASPFASIRREGRPYSEP-
AROB_RHOOB      --------------DAVVSLGGGAATDLAGFVAATWMRGVIHVPTLAMVDAAVGGKTGINTEAGKNLVGS
AROB_RHILO      -----ILAARLERGDVVIALGGGVIGDLTGFSAGIVRRGMVQVPTLAQVDSSVGGKTGINSPRGKNLVGV
AROB_MARMS      --------AKHNRTTTVIALGGGVVGDMAGFAAATYQRPFIQVPTLSQVDSSVGGKTGVNHPLGKNMIGA
AROB_HAEI8      ---------------TIIALGGGVIGDVAGFVAASYQRGVIQMPTLSQVDSSVGGKTAVNHELGKNMIGA
AROB_ACTSZ      SLNQIFTALLQENHGTLIALGGGVIGDVAGYAAASYQRGIIQIPTLSQVDSSVGGKTAVNHELGKNMIGA


                         +         .         .         .         .         *         .:210
query           FYSKNPDLVLVDTKVISQAPKRLLASGIADGLATWVEARAVMQANGKTMLGQQQTLAGVAIAKKCEETLF
GLDA_BACST      FYKKNPDLVLVDTKIIANAPPRLLASGIADALATWVEARSVIKSGGKTMAGGIPTIAAEAIAEKCEQTLF
GLDA_ECOLI      LLPNNPNMVIVDTKIVAGAPARLLAAGIGDALATWFEARACSRSGATTMAGGKCTQAALALAELCYNTLL
GLDA_ECOL6      LLPNNPNMVIVDTKIVAGAPARLLAAGIGDALATWFEARACSRSGATTMAGGKCTQAALALAELCYNTLL
GLDA_CITFR      IYPKNPDMVVMDTAIIAKAPVRLLVAGMGDALSTWFEAKACYDARATSMAGGQSTVAALSLARLCYDTLL
GLDA_THEMA      FLPRNPDVVLVDTEIVAKAPARFLVAGMGDALATWFEAESCKQKYAPNMTGRLGSMTAYALARLCYETLL
GLDA_PSEPU      MLPTNPALVVVDTAIVARAPARLLAAGIGDALATWFEXXXXXXXXXXTMAGGPATQTALNLARFCYDTLL
GLD1_SCHPO      FYPLNPNLIFIDTDVIVRAPVRFLISGIGDALSTWVETESVIRSNSTSFAGGVASIAGRYIARACKDTLE
Y1167_SYNY3     ALDRCPDLLIVDYELIQRAEPRLLVAGIGDAIAKWYEASVSSGQSSDTF-----TVAAVQQARILRDILF
YBDH_ECOLI      IFDDANFMVLVEPEIILNAPQQYLLAGIGDTLAKWYEA-VVLAPQPETL--PLTVRLGINNAQAIRDVLL
G1PDH_METHJ     VGAHPPIAVVADTGIISQAPHRLMASGCADVISNYT---AILDWEAHRLRGEQISEYAIALSKMTAEILV
G1PDH_METB6     LEAHPPIAIIADTCIIASAPHRLLAAGCADVISNYTAILDWEMAH--RIKGEPMSEYAVALSKMTAEILV
G1PDH_PYRAE     KIVASPVAIIADTSVILSAPSRLLKAGIGDLLGKIIAVRDWQLAH--RLKGEEYSEYAAHLAVTSYKIAA
G1PDH_METBU     VQANAPMAVIADTEIIANAPYRLLAAGCGD-----------IISNCTAVLDWQ-------LASRLQNVQF
G1PDH_THESM     IKARPPVAVIADVNIIKTAPYRYLAAGVGD------------------MVSNLTAVKDWELAHRIRGEYF
G1PDH_NITMS     IVATAPLGVFVDIDIIKKAPSRLLASGCGDLVANIIAVKDWQLGHQKT--GEYYGTYSAELAMMSAMMVL
G1PDH_PYRCJ     KISSSPVAIIADTSIILSAPSRLLKAGIGDLLGKIIAVRDWQLAH--RLKGEEYSEYAAHLSLTSYKIAV
G1PDH_PYRAR     IVA-SPIAIIADTTVILNAPSRLLKAGIGDLLGKIVAVRDWQLAH--RLKGEEYSEYAAHLALTSYRIVV
G1PDH_PYRIL     KIMASPIAIVADTSIILNAPSRLLKAGVGDLLGKIIAVRDWKLAH--RLKGEEYSEYASHLSLTSYRIVV
G1PDH_SULAC     IKAKEPLAIISDVEILASAPRRLINAGIGDTLGKITAVRDWRLAHKLRGEYYGDYTASLALMSARHALSC
G1PDH_METAC     VQAQAPIAVVADTEIISAAPFRFLVAGCGDIISNYT---AVLDWE---------------LASRLRNEYF
G1PDH_HALMA     -AAEPPLAVIADTEVLAEAPWRLTTAGCADIISNYTAVRDWQLAHRLKNVHYSE-YAG-ALSQMTAEMLV
G1PDH_NATPD     -AAHPPLAVIADTELIANSPWRLTTAGCADIISNYTAVKDWQLAH-RLKNVEYSEYAG-ALSQMTAEMLV
G1PDH_METST     LKANAPFALIADTTIISQAPYRFTAAGFSD------------------IISNLTAVEDWKLAYKLINEPF
G1PDH_METPE     -LTAHPPLVVADTGIIAAAPHRLLAAGCADIISNYTAILDWELSN--RLRGEPISEYAITLSRMTAEILM
G1PDH_METMA     IQAQAPLAVIADTEIISAAPYRFLAAGCGDIISNYLASRLRNEYFGEYAAALSRMAARVVIEN-------
G1PDH_METBF     AQAQAPIAVIADTEIISAAPFRFLAAGCGDIISNYLASRLRNEYFGXXXXXXXXXXXRVII--EC-----
G1PDH_METS5     VKAKMPYAIIADINVLSSAPRRLINSGIGDTIGKLVAVR-------------------------------
G1PDH_IGNH4     VKTKTPIAVVADIEVIARAPERLNRAGIGDVLAKFSAVRDWRLAHVLKGEYYGSYAASLALMSAKHVLKY
G1PDH_PYRFU     IKARPPVAVIADIRIIKSAPRRYLAAGVGDVISNITAVRDWKLAH--KIKGEYFSEYAAALSLMSAKMVM
G1PDH_METJA     FMVDAPIAIIADTEIIKKSPRRLLSAGMGDNITAVLDWKLAYKEKGE-KYSESSAIFSKTIAKELISYVL
G1PDH_THENV     KVVASPIAIVADTSIILSAPRRLLRAGVGDLLGKVVAVRDWQLAH--RLKGXXXXXXXXXXXXXXXRIVV
G1PDH_CENSY     ITATAPLGVFVDIGVIRKAPARLLASGCGDLVANMIAVRD--WELGRDRKGEYYGRYAASLALMSAKIVM
G1PDH_METTP     IPTRAPLAIIADTGIISKAPPRLMSAGCGDIISNY-----------------------------------
G1PDH_PYRHO     IKAKPPIAVIADIDVIKTAPKRYLAAGVGDIVSNITAVRDWKLAH--KLKGEYFSEYAASLSLMSAKMVI
G1PDH_PICTO     -EATMPSAIVADTSIMVLAPYRYVAAGAADVISNITAVLDWKLAN--RLKGEEFSSTAAVMSEYAGRELI
G1PDH_CALMQ     KVRKTPLAIIVDTGIVAEAPRVFLLAGIGELLGKKV---ALMDWRGHRIKGEDYSESAAMLALSSHMIIM
G1PDH_METLZ     SVAAHPPLAIVDTGIIAGAPHRLMAAGYADMVANYT---AVMDWDSKSKTGEQVSEYAMTLSMITAE-LM
G1PDH_HALSA     -SAAPPLAVIADTGVIADAPWELTTAGCADIISNYTAVKDWRLAN-------------------------
G1PDH_HALS3     -SAAPPLAVIADTGVIADAPWELTTAGCADIISNYTAVKDWRLAN-------------------------
G1PDH_STAMF     XXXXXXYAIIADIDMISKAPPRLIRSGVGD------------------LLGKLTAVKDWQLAHRLKGEYY
G1PDH_PYRKO     VKAVPPVAVIADVKVIKTAPYRYLAAGVGDTISNLTAVRDWQLAH--RIKGEYYSEYAASLSLMSAKMVM
G1PDH_META3     ITAESPIAIIADLNIIKKSPKRLLSAGMGDIVSTAVLDWKLSYKETKEPYSESSAIFSKTIAMELVEFVL
G1PDH_METS3     -----PIAVIADSKIIANSPFRLLSAGCADLISNFTAIKDWQLAHRLKNESYSESAASLSIMSAKMITDN
G1PDH_METMJ     LAAEPPIAVVADTAVIASAPHRLLASGCADIIANYT---AILDWESHRLRGEPLSEYALTLSRMTAEILF
G1PDH_THEAC     -----PIGVIADTAIMIKAPYRYLAAGAADVIS---NLSAVKDWKLAHRLKGXXXXXXXXXXXXXXXXXV
G1PDH_PYRAB     IKARPPIAVIADIEVIKTAPRRYLAAGVGDVISNITAVRDWKLAH--KLKGEYFSEYAAALSLMSAKMVI
G1PDH_UNCMA     MQAEAPLCVLADTSIIVRSPYKLLAAGCGDVISNYT---AVLDWK---------------LASRLRNIYF
G1PDH_THEVO     -----PIGVIADTSVMIKAPYRYLAAGAADVISNWKLAHRLRGXXXXXXXXXXXXXXXXXVISQVGE---
G1PDH_BACA2     IQTKAPIALFADTNVLKEAPRSMTAAGFGDSLADWEISR--------RLAGEPYSEAGAKLVK-------
AROB_LACSS      FYQ--PELVLIDPQMLETLPQRQLVTGYAE----VVKIAALVGADFWNLV--QQIESPTAILDKAPEL--
G1PDH_BACSK     LVA--PIALFADTVVLQHAPPALIAAGFGD----------------------------------------
EUTG_ECOLI      AHSLMPDVAILDAALTEGVPSHVTAMTGIDALTHAIEAYSALNA--------------------------
G1PDH_BACHD     FQTQAPIALFADLDFLTQAPRSMVAAGFGDMLG---KSTSLVDWQVSHMLNDEPFCPAVFHMTKSALTMC
G1PDH_HALWD     XXXXXXXXXXXXXXXXXXXPWELTTAGCADIISNYTAVKDWQLAH-RLQDVEYSEYAG-ALSQMTAEMLV
G1PDH_KORCO     IRVEAPTAILADTTIINRASPITFKSGFGDLVAKITAVRDWELAYKLRDEPYSEYAASMSLLSAKIAMDH
AROB_AGRRK      FHQ--PDLVLADTDVLNTLSQREFRAGYAEGLIDKPDFFAWLEAN------WQDVFSGGAAR--------
G1PDH_SULIL     VKAKEPLAIIVDIEILSLSPRRLINAGIGDTIGKIIAVR-------------------------------
G1PDH_METM5     YMTEXXXXXXXXXXXXKKSPKKLLSAGMGD----------------------------------------
ADH4_SCHPO      IIDKHPILSVNDPETMYGLPPSLTAATGMDALTHAVEAYVSTAAN-------------------------
AROB_RHIL3      FHQ--PDLVLADTDVLNSLSEREFRAGYAEGLIDKPDFFAWLEANWKSVFGGSARIEAIA----------
G1PDH_HALLT     XXXXXXXXXXXXTTLIADAPWRLTTAGCADIISNYTAVK-------------------------------
AROB_THETN      FYQ--PKMVYIDTSVLGTLNKR----EVLGGLAEVIKYGVIWDFDLFTYI--EENLGDILRLKKEDLTYI
AROB_RHOPA      FHQ--PVLVLADTAILDTLSPRQFRAGYAEAFFAWLEA------------NHAELFSGGAAREHAVATSC
AROB_RHILW      FHQ--PDLVLADTDVLNTLSEREFRAGYAEGLIDKPDFFAWLEANWKAVF-----------------TGG
AROB_DECAR      FYQ--PRLVLADLSTLDTLPDRELKAGLAEGLIRDPDFFVWLEANLEKLLVRDKSALAYAVHRSC-----
AROB_CYAP7      FHQ--PRLVLIDPQVLKTLPPREFRAGMAEVIKYGV----IWDANLFSQLAAKKXXXXXXXXXXXXQTII
G1PDH_SULIY     VKAKEPLAIIADIEILSLSPRRLINAGIGDTIGKIIAVR-------------------------------
G1PDH_SULIN     VKAKEPLAIIADIEILSLSPRRLINAGIGDTIGKIIAVR-------------------------------
G1PDH_SULIM     VKAKEPLAIIADIEILSLSPRRLINAGIGDTIGKIIAVR-------------------------------
G1PDH_SULIK     VKAKEPLAIIADIEILSLSPRRLINAGIGDTIGKIIAVR-------------------------------
G1PDH_SULIA     VKAKEPLAIIADIEILSLSPRRLINAGIGDTIGKIIAVR-------------------------------
AROB_AZOSE      FYQ--PRVVLADTATLDTLPDRELKAGLAEALFDWLEAHI------ERVLAREPEALAFAIERSC-----
AROB_RHOPT      FHQ--PVLVLADTAILDTLSPRQFRAGYAEAFFAWLEA------------NHAELFSGGAAREHAVATSC
AROB_PSEU2      FYQ--PSVVLIDTASLNTLPERELSAGLAEVILTWLEEHV------DALRGLDQAALTVAIERSCAAKAL
AROB_PSE14      FYQ--PSVVLIDTTSLNTLPERELSAGLAEVILTWLEEHV------DALRGLDQAALTVAIERSCAAKAL
AROB_PSESM      FYQ--PSVVLIDTTSLNTLPERELSAGLAEVILTWLEEHV------DALRGLDQAALTVAIERSCAAKAL
AROB_LACLM      GTFTQPDGVLIDPEVLKTLGQREFCEGLGEVIKCALIADKDLW-NLLTDLSAKDLLENFA---KIEEIIY
GBSB_BACSU      FNTGGPHLTIIDPELHVSMPPHVTAMTGIDALAHAIECYTMKFAQPIT---DAVALMAIEYAAHYIKRAF
ADH2_ECOLI      IVDKHPLLSVNDSSLMIGMPKSLTAATGMDALTHAIEAYVSIAAKAVTMIAENLPLADGSNAKAREAMAY
G1PDH_SULTO     VKAKGPIAIIADINVLASAPRRLINAGIGD----------------------------------------
AROB_MICAN      FYQ--PKLVLIDPDVLKTLPVREFRAGMAEVIKYGVDAELFQQLEDSDNLASFSQIDGELL-----QTII
ADH1_CLOSA      AFNITPDVAVVDSELAETMPPKLTAHTGMDALTHAIEAYVATLHSPFT-----DPLAMQAI-EMINEHLF
G1PDH_METTH     LEASSPIGVIADTEIISRAPFRLLASGCADIISNY-----------------------------------
AROB_RHIE6      FHQ--PDLVLADTDVLNSLSEREFRAGYAEGLIDKPDFFAWLEANWKAVF-----------------TGG
AROB_AGRT5      FHQ--PDLVLADTAVLDTLSPREFRAGYAEGLIDKPDFFFWLEKNWDDITGGPARIEAIA----------
AROB_SYNY3      FY--QPRLVYIDPVVLKTLPEREFRAGMAEVIKYGV----IWDSELFTALEEAEDLSSI---DRLPDELL
G1PDH_GEOTN     --AQAPIAVFADTDVLCQAPKAMIAAGFGDMVAKY-----------------------------------
DHAT_KLEPN      VSWRNPSVSINDPLLMIGKPAALTAATGMDALTHAVEAYISKDANPVTDAAAMQAIRLIA----------
G1PDH_METM7     YMTEAPIAIIADTEIIKKSPKKLLSAGMGD----------------------------------------
AROB_STRP8      ----------------------------------------------------------------------
AROB_PSEPW      FYQ--PNAVLIDTTTLNTLPERELSAGLAEVIKYGLIC-------DKPFLGWLED--NIKALRALEPAAL
AROB_DICT6      FY--HPDAVIIDIKTLNTLPEREYRSGIAE----------------------------------------
G1PDH_THEPD     IFTXXXXXXXXXXXXXXXXPRRLLASGVGDGKVTSVDARLAQRLTGE-----------------------
G1PDH_BACST     --AQAPIAVFAHTGVLCQSPKEMIAAGFGDMVAKY-----------------------------------
AROB_TERTT      FYQ--PQAVVIDTQVLDTLPERELSAGLAEGIIADIPFFEWLETNMPALLARESEALAYAIEVSC-----
AROB_PSEFS      FYQ--PQAVLIDTATLNTLPPRELSAGLAEVIKTWLEEH-------------------VDALRNLDQVAL
MEDH_BACMT      ----------------------------------------------------------------------
AROB_STRPZ      ----------------------------------------------------------------------
AROB_STRPM      ----------------------------------------------------------------------
AROB_STRPG      ----------------------------------------------------------------------
AROB_STRP3      ----------------------------------------------------------------------
AROB_STRP1      ----------------------------------------------------------------------
DOIS_BACCI      YYP--PRFVFADTRILSESPPRQVKAGMCE----LVKNMLILENDNKEFTEDDLNSANVYSPKQLETFI-
AROB_THIDA      FYQ--PKLVLADAATLGTLPARELSAGLAEGLIWDVEFLAWLEANMDRLRALDAEAISHAIYRSCE----
G1PDH_BACLD     VQTTAPIALFADLELLCQAPQNMVAAGFGDSLADWEISR--------LLAGEPYCPAASRLTREALDQCL
AROB_CHLCH      GFFHLPELVLIDPATLASLPRREIYAGLAE----VVKYGFIADANFFDMLE-----AHFSEVATLQEPYL
G1PDH_BACSU     --TKAPSXXXXXXXXXXXXPQSMVAAGFGDSLADWEISR--------HLAGEPYSPAGAKIVQ-------
AROB_STRP6      ----------------------------------------------------------------------
AROB_PSYCK      FWQ--PQMVLADMSTLKTLPARELSAGLAEALIMDAEFLTWLEHNLPAMMALDLAVLGEAVKRCCQ----
AROB_PELUB      FYQ--PSLVISDTNFLNSLPKREVVCGYGESLINGKKFFYFLNKNGKKIIQLKSPFIQTAIHQSC-----
AROB_HYPNA      FYQ--PRLVIADTALLATLPARELKAGYAE----------------------------------------
AROB_AERHH      FYQ--PRHVVIDTECLQTLPAREFAAGMAEGIIWDVEFFCWLEANMSRLQAQEPAALAYAIRRCCE----
PGK_STAAW       LEKHGDKIVLVDTKVAKE----------------------------------------------------
PGK_STAAU       LEKHGDKIVLVDTKVAKE----------------------------------------------------
PGK_STAAT       LEKHGDKIVLVDTKVAKE----------------------------------------------------
PGK_STAAS       LEKHGDKIVLVDTKVAKE----------------------------------------------------
PGK_STAAR       LEKHGDKIVLVDTKVAKE----------------------------------------------------
PGK_STAAN       LEKHGDKIVLVDTKVAKE----------------------------------------------------
PGK_STAAM       LEKHGDKIVLVDTKVAKE----------------------------------------------------
PGK_STAAE       LEKHGDKIVLVDTKVAKE----------------------------------------------------
PGK_STAAC       LEKHGDKIVLVDTKVAKE----------------------------------------------------
PGK_STAAB       LEKHGDKIVLVDTKVAKE----------------------------------------------------
PGK_STAA9       LEKHGDKIVLVDTKVAKE----------------------------------------------------
PGK_STAA8       LEKHGDKIVLVDTKVAKE----------------------------------------------------
PGK_STAA3       LEKHGDKIVLVDTKVAKE----------------------------------------------------
PGK_STAA2       LEKHGDKIVLVDTKVAKE----------------------------------------------------
PGK_STAA1       LEKHGDKIVLVDTKVAKE----------------------------------------------------
EUTG_SALTY      AHSLMPDVAILDAAVTEGVPPNVTAMTGIDALTHAIEAYSALNA--------------------------
AROB_PROAC      FH--EPIGVLCDTELLTTLPAREVRSGLAE----------------------------------------
YUGJ_BACSU      ----------------------------------------------------------------------
G1PDH_METKA     --AQAPLAILADIEVIREAPERLIRAGVGD----------------------------------------
AROB_RHOOB      FHE--PSAVLIDLATLETVPRNEIVAGMAEVVKT------------------------------------
AROB_RHILO      FLQ--PKLVLADTEVLDTLPIREFRAGYAEGLIDRPELFAWLEANWQKVFAGGPERA-QAIAEAC-----
AROB_MARMS      FYQ--PQAVIIDTETLQSLPQRELSAGMAE----------------------------------------
AROB_HAEI8      FYQ--PSMVIIDTLTLNTLPKREVNAGLAE----------------------------------------
AROB_ACTSZ      FYQ--PITVIIDTTTLNTLPKREVNAGLAE----------------------------------------


                         .         .         .         +         .         .         .:280
query           ADGLQAMAACEAKVVTPALENIVEANTXXXXXXXXXXXXXXXHAIHNGFTALTGDIHHLTHGEKVAYGTL
GLDA_BACST      KYGKLAYESVKAKVVTPALEAVVEANTXXXXXXXXXXXXXXXHAIHNGFTALEGEIHHLTHGEKVAFGTL
GLDA_ECOLI      EEGEKAMLAAEQHVVTPALERVIEANTYLSGVGFESGGLAAAHAVHNGLTAIP-DAHHYYHGEKVAFGTL
GLDA_ECOL6      EEGEKAMLAAEQHVVTPALERVIEANTYLSGVGFESGGLAAAHAVHNGLTAIP-DAHHYYHGEKVAFGTL
GLDA_CITFR      AEGEKARFAAQAGVVTDALERIVEANTYLSGIGFESSGLAGAHAIHNGFTILE-ECHHLYHGEKVAFGTL
GLDA_THEMA      EYGVLAKRSVEEKSVTPALEKIVEANTXXXXXXXXXXXXXXXHAIHNGLTVLE-NTHKYLHGEKVAIGVL
GLDA_PSEPU      EEGEKAMLAVQAQVVTPALERIVEANTYLSGVGFESXXXXXXXXXXNGLTAV-AETHHFYHGEKVAFGVL
GLD1_SCHPO      KYALSAILSNTRGVCTEAFENVVEANTLMSGLGFENGGLAAAHAIHNGMTAIHGPVHRLMHGEKVAYGTL
Y1167_SYNY3     QKSAEALAQPGSETWREVVDASLLMAGVIGGLGGANCRTVAAHAVHNGLTQLP-QAHHALHGEKVAYGIL
YBDH_ECOLI      NSSEQALSDQQNQQLTQSFCDVVDAXXXXXXXXDRFTRVAAAHAVHNGLTVLP-QTEKFLHGTKVAYGIL
G1PDH_METHJ     KDA-NLIKPGQEEAAWIVVKALVSSGVSMAIAGSSRPASGGEHKFGHALERLMPGA--ALHGEACGIGSI
G1PDH_METB6     ADLIRPNQEQSAWFVTKAL---VSSGVAMSIAGSSRPASGGEHKFSHALDRLAP--NKALHGESCGIGTI
G1PDH_PYRAE     TNARRIRNFTREEDVRVLVKALIGCGVAMGIAGSSRPCSGSEHLFHAIELRLQEESSEAVHGELVALGTI
G1PDH_METBU     SEYAAALASMTAQILIDSADSIPELESSVRMVVKALVSSGVAMSIAGSSRPASGSEHMFSHGEQCGVGTI
G1PDH_THESM     SEYAASLSLMSAKMVIKNADIIRLSNEESVRKVIKALISSGVAMSIAGSSRPASGAEHLLHGEQCGVGTI
G1PDH_NITMS     DNSSKAKNGLDARVIVEAL---ISAGVASCIAGSSRPCSGAEHLFSHALDKIAPG--KGLHGEKCGIGSI
G1PDH_PYRCJ     GNAQKIKNFIREEDVRVLVKALIGCGVAMGIAGSSRPCSGSEHLFAHAIEVRVEKEDEVVHGELVALGTI
G1PDH_PYRAR     SNAFRIKNFTKEEDVRVLVKALIGCGVAMGIAGSSRPCSGSEHLFAHAVELLLGEKNNAIHGELVALGTV
G1PDH_PYRIL     ANAARIVREEDVRVLVKALIGCVAMGIAGSSRPCSGSEHLFAHAIEIRLEESGGD---AIHGELVALGTI
G1PDH_SULAC     TKIINKDIRAGVRVLTEAL---ISSGVAMGMAGSTRPASGSEHLFAHAIELLYPNLG--LHGELVALGTI
G1PDH_METAC     GEYAAALSRMAARVVIENADSIPEHETSARLVVKALVSNGVAMSIAGSSRPASGSEHMFSHGEQCGVGTI
G1PDH_HALMA     ADSIKQGLEESSWIVVKAL---VSSGVAMSIADSSRPASGAEHLFSHQLDRLVPD--GALHGHQVGVGSI
G1PDH_NATPD     DNSASIKRGLEAWIVVKAL---VSSGVAMSIAGSSRPASGAEHLISHQLDRIAPET--ALHGHQVGVASI
G1PDH_METST     SDSAAALSVMTAKLLIDEADNIHPNNNSASVVVKGLISSGMAISIAGNSRPASGSEHKFSHGEQCGVGTI
G1PDH_METPE     KNA-PMIRPHQEESAWMVVKALVSSGVAMAIAGSSRPASGGEHKFSHALERLAPG--KALHGEACGIGTI
G1PDH_METMA     ADSIKPDHETSARLVVKALSNGVAMSIAGSSRPASGSEHMFSHALDRIAPKAA------LHGEQCGVGTI
G1PDH_METBF     ADSIKPEHETSARLVVKALSNGVAMSIAGSSRPASGSEHMFSHALDKIAP------KPALHGEQCGVGTI
G1PDH_METS5     ----------------------------------------------------------------------
G1PDH_IGNH4     SPLLKALSEDGLRILVEAL---ISSGVAMCIAGSSRPASGSEHLFSHALDVIAN--RPALHGEQVGVGTI
G1PDH_PYRFU     RDA-EIIRIGDDEGVRKVVKALISSGVAMSIAGSSRPASGAEHLFSHALDLLLE--KPALHGEQTGIGTI
G1PDH_METJA     NSDLSEYHNKLVKALVGSGIAIAIANS---SRPASGSEHLFSHALDKLKEEYNLNINSL-HGEQCGIGTI
G1PDH_THENV     ANAGKIGNFVREEDVRALVKALIGCGVAMGIAGSSRPCSGSEHLFHAIERRLEGAEGEAIHGELVALGAI
G1PDH_CENSY     ENAARAREGVDERVVVEAL---ISAGVASCIAGSSRPCSGAEHLFSHALDRIAPGAG--LHGEKCGIGSI
G1PDH_METTP     ----------------------------------------------------------------------
G1PDH_PYRHO     RDA-EIIRLGQDEGIRKVVKALISSGVAMSIAGSSRPASGAEHLFSHALDMLLD--KPALHGEQTGIGTI
G1PDH_PICTO     E---------RSSMIQPGLEESIWLVTKQILXXXXXXXXXXXXRPASGSEHLFSHAIEIIHGEQCAMGSL
G1PDH_CALMQ     VNKLTRHGEEETRIVVKAL---LGCGVAMAIAGSTRPCSGSEHLFSHSLDLLAREVKQAMHGMQVALSSV
G1PDH_METLZ     VENAEKIKAFDENAAWIVVKALFASGVAMSIAGSSRPASGGEHKFAHMLERLVPG--KVLHGEACGVGTI
G1PDH_HALSA     ----------------------------------------------------------------------
G1PDH_HALS3     ----------------------------------------------------------------------
G1PDH_STAMF     GEYAAQLALLSAKHVIRYHELIASGNPDGIRIVVEALISSGVAMCIAGSSRPASGSEHLLHGEQVALGTI
G1PDH_PYRKO     RNA-DIIRLGNEESVRKVIKALISTGVAMSIAGSSRPASGAEHLFSHALDMLLD--KPALHGEQTGLGTI
G1PDH_META3     SNDKNNLEEYPKKLVKALXXXXXXXXXXXXXRPASGSEHLFSHSLDIITKKLNLNINGI-HGEQCGIGTI
G1PDH_METS3     VDSIKPGLEESARLV---VKTLFXXXXXXXXXXXXRPASGSEHTFSHALDKILD--KPCLHGEQCGVGTI
G1PDH_METMJ     ADLIKPHSEESAWLVTKAL---VSSGVAMSIAGSSRPGSGGEHKFSHALEKLAPG--KGLHGEKCGIGAI
G1PDH_THEAC     LSQINEIKKYEESSVWLVTKNILASGTAMAIAGNSRPGSGSEHLFAHALEA--AGVENMLHGEMCAMGTV
G1PDH_PYRAB     RDA-EIIRLGNDEGVRKVIKALISSGVAMSIAGSSRPASGAEHLFSHALDLLLD--KPALHGEQTGIGTI
G1PDH_UNCMA     SEYAAALSQMTAEIVVPGLEEVVKALVXXXXXXXXXXXXXXXXXXEHKFSHVLDRIKPALHGEQCGVGTI
G1PDH_THEVO     ------IRKYDESSVWLVTKNILASGTAMAIAGNSRPGSGSEHLFAHALEA--AGVNNMLHGEMCAMGTI
G1PDH_BACA2     ----------------------------------------------------------------------
AROB_LACSS      ---IARSIAYKAQIV---MADVQESG--------QRRLLNFGHTIGHAVESLADG--ELTHGEAVSIGLI
G1PDH_BACSK     ----------------------------------------------------------------------
EUTG_ECOLI      ----------------------------------------------------------------------
G1PDH_BACHD     MEHADEIAACNEQGIRLLTEALIMSGLAMLIFGHSHPASGAEHHLSHYWEMASGGTQPL-HGAKVGYAT-
G1PDH_HALWD     SDAIKQGFEESAWLVAKAL---VSSGVAMSIAGSSRPASGAEHLISHQLDRLVPDA--ALHGHQVGVASI
G1PDH_KORCO     AHEIRTRLEESTRILVKAL---IGSGVAMSIAGSSRPASGSEHMFSHALDILSSEVKPAPHGIQVAIGTI
AROB_AGRRK      ---IEAIAACQAKVVADERENGPRA------------LLNLGHTFGHALEAATADSRRLVHGEGVAIGMV
G1PDH_SULIL     ----------------------------------------------------------------------
G1PDH_METM5     ----------------------------------------------------------------------
ADH4_SCHPO      ----------------------------------------------------------------------
AROB_RHIL3      -------ASCQAKVVADERENGQRA------------LLNLGHTFGHALEAATADSSRLVHGEGVSIGMV
G1PDH_HALLT     ----------------------------------------------------------------------
AROB_THETN      -----VKRSCEIKAKVVSLDEKEE---------NLRAILNFGHTIGHAIEALTGYERYI-HGEAVAIGMA
AROB_RHOPA      RAKAAIVARDERETGDRALLNL-------------------GHTFGHALEAATGFSDRLFHGEGVAIGMV
AROB_RHILW      AARIEAIAACQAKA-----DVVVADERENGPRALLNLGHTFGHALE---TATAYDSSRLVHGEGVSIGMV
AROB_DECAR      ANKAEVVAADERESGERALLNL---------------GHTFGHAIETGL-----GYGEWLHGEAVAAGTL
AROB_CYAP7      TRSCQAKADVVSKDEKEALRAILN----------------YGHTIGHGIESLTG-YSQIIHGEGVAIGMV
G1PDH_SULIY     ----------------------------------------------------------------------
G1PDH_SULIN     ----------------------------------------------------------------------
G1PDH_SULIM     ----------------------------------------------------------------------
G1PDH_SULIK     ----------------------------------------------------------------------
G1PDH_SULIA     ----------------------------------------------------------------------
AROB_AZOSE      ANKAEVVAADETEQGERALLNL---------------GHTFGHAIETGM-----GYGNWLHGEAVAAGTM
AROB_RHOPT      RAKAAIVARDERETGDRALLNL-------------------GHTFGHALEAATGFSDRLFHGEGVAIGMV
AROB_PSEU2      VVG-----ADERESGVRATLNL---------------GHTFGHAIHMGYGV-------WLHGEAVAAGTV
AROB_PSE14      VVG-----ADERESGVRATLNL---------------GHTFGHAIHMGYGV-------WLHGEAVAAGTV
AROB_PSESM      VVG-----ADERESGVRATLNL---------------GHTFGHAIHMGYGV-------WLHGEAVAAGTV
AROB_LACLM      -------RSCEVKVVDDELDNGVR--------LYLNFGHTIGHAVEN-----TAGYGKVMHGEAVAIGMV
GBSB_BACSU      ADG-------------------------------------------------------------------
ADH2_ECOLI      AQFLAGMA--------------------------------------------------------------
G1PDH_SULTO     ----------------------------------------------------------------------
AROB_MICAN      TKSCQAKADVVSKDEKEALRAILN----------------YGHTIAHGIESLTG-YTSVNHGEAVALGMV
ADH1_CLOSA      KSYEGDKEAREQMHYAQCLAGMAFSNALL--------------GICHSMAHKTGAVFHIPHG--CANAIY
G1PDH_METTH     ----------------------------------------------------------------------
AROB_RHIE6      AARIEAIASCQAKVVADERENGQRA------------LLNLGHTFGHALEAATADSRRLVHGEGVSIGMV
AROB_AGRT5      -------TSCQAKVVADEKENGVRA------------LLNLGHTFGHALEAATNDSKRLVHGEGVAIGMV
AROB_SYNY3      TKIIQ--RSCQAK---------VDVVSQDEKEAGLRAILNYGHTVGHGVESLTG-YGVINHGEAVAIG--
G1PDH_GEOTN     ----------------------------------------------------------------------
DHAT_KLEPN      ----------------------------------------------------------------------
G1PDH_METM7     ----------------------------------------------------------------------
AROB_STRP8      ------------------------------------------------------DFYH--HGEAIAIGMV
AROB_PSEPW      TEAIQRSCAAKAAVVADERESGVRATLNLGHTFG--------HAIHMGYGVWL-------HGEAVAAGTV
AROB_DICT6      ----------------------------------------------------------------------
G1PDH_THEPD     ----------------------------------------------------------------------
G1PDH_BACST     ----------------------------------------------------------------------
AROB_TERTT      AIKARVVAQDEKESGIRAILNL---------------GHTFGHAIHQGY----GD---WVHGEAVGAGMV
AROB_PSEFS      TEAISRSCAAKALVV-----NADERESGVRATLNLGHTFGHAIETHMGYGVWL-------HGEAVAAGTV
MEDH_BACMT      ----------------------------------------------------------------------
AROB_STRPZ      ------------------------------------------------------DFYH--HGEAIAIGMV
AROB_STRPM      ------------------------------------------------------DFYH--HGEAIAIGMV
AROB_STRPG      ------------------------------------------------------DFYH--HGEAIAIGMV
AROB_STRP3      ------------------------------------------------------DFYH--HGEAIAIGMV
AROB_STRP1      ------------------------------------------------------DFYH--HGEAIAIGMV
DOIS_BACCI      -------NFCISAKMSVLSEDIYEKK--------KGLIFEYGHTI--GHAIELAEQGGITHGEAIAVGMI
AROB_THIDA      ----------------------------------------------------------------------
G1PDH_BACLD     -DRKDDIAAKMRDGIEKLMESLILSGLVMLVLDHSRPASGGEHHLSHEMKALENNKRQVLHGAKVGYRSL
AROB_CHLCH      TEAVKTSALIKQDVVTRDFREL----------DGLRATLNFGHTFAHGLEKL-ADYRHLRHGEAVTMGLV
G1PDH_BACSU     ----EALAAC------------------------------------------------------------
AROB_STRP6      ------------------------------------------------------DFYH--HGEAIAIGMV
AROB_PSYCK      ----------------------------------------------------------------------
AROB_PELUB      ----------------------------------------------------------------------
AROB_HYPNA      ----------------------------------------------------------------------
AROB_AERHH      ----------------------------------------------------------------------
PGK_STAAW       ----------------------------------------------------------------------
PGK_STAAU       ----------------------------------------------------------------------
PGK_STAAT       ----------------------------------------------------------------------
PGK_STAAS       ----------------------------------------------------------------------
PGK_STAAR       ----------------------------------------------------------------------
PGK_STAAN       ----------------------------------------------------------------------
PGK_STAAM       ----------------------------------------------------------------------
PGK_STAAE       ----------------------------------------------------------------------
PGK_STAAC       ----------------------------------------------------------------------
PGK_STAAB       ----------------------------------------------------------------------
PGK_STAA9       ----------------------------------------------------------------------
PGK_STAA8       ----------------------------------------------------------------------
PGK_STAA3       ----------------------------------------------------------------------
PGK_STAA2       ----------------------------------------------------------------------
PGK_STAA1       ----------------------------------------------------------------------
EUTG_SALTY      ----------------------------------------------------------------------
AROB_PROAC      ----------------------------------------------------------------------
YUGJ_BACSU      ----------------------------------------------------------------------
G1PDH_METKA     ----------------------------------------------------------------------
AROB_RHOOB      ----------------------------------------------------------------------
AROB_RHILO      ----------------------------------------------------------------------
AROB_MARMS      ----------------------------------------------------------------------
AROB_HAEI8      ----------------------------------------------------------------------
AROB_ACTSZ      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           VQLLLENRPKEELDKYIEFYKKIGMPTTLKEMHLDQVGYDDLIKVGKQATMEGETIHQMPFKISPSDVAQ
GLDA_BACST      VQLALEEHSQQEIERYIELYLSLDLPVTLEDIKLKDASREDILKVAKAATAEGETIH-------------
GLDA_ECOLI      TQLVLENAPVEEIETVAALSHAVGLPITLAQLDIKEDVPAKMRIVAEAACAEGETIHNMPGGATPDQVYA
GLDA_ECOL6      TQLVLENAPVEEIETVAALSHAVGLPITLAQLDIKEDVPAKMRIVAEAACAEGETIHNMPGGATPDQVYA
GLDA_CITFR      AQLVLQNSPMEEIETVLNFCQKVGLPVTLAEMGVKDDIDGKIMAVAKATCAEGETIHNMPFSVTPESVHA
GLDA_THEMA      ASLFLTDKPRKMIEEVYSFCEEVGLPTTLAEIGLDGVSDEDLMKVAEKACDKNETIHNEPQPVTSKDVFF
GLDA_PSEPU      VQLALENASNAEMQEVMSLCHAVGLPITLAQLDITEDIPTKMRAVAELACAPGETIHNMPGGVTVEQVYG
GLD1_SCHPO      VQVVLEDWPLEDFNNLASFMAKCHLPITLEELGIPNVTDEELLMVGRATLRPDESIHNMSKKFNPSQIAD
Y1167_SYNY3     VQLRLEQLAATARRQLLSFYDEIGLPKTLQDLGLGRISLEELRQTAEFTCLPNSDIHRLPFTVTPETLMA
YBDH_ECOLI      VQSALLGQ-DDVLAQLTGAYQRFHLPTTLAELEVDINNQAEIDKVIAHTLRPVESIHYLPVTLTPDTLRA
G1PDH_METHJ     MTMYLHGGDWREIRSSL---ARIGAPTTPRELNIDEVIVEALMK--------------------------
G1PDH_METB6     ISMYLHGGDWRGIRQSL---RTIGAPVTPTDVGIDEIAVEALL-MAKTIRPERFTIFDM-----------
G1PDH_PYRAE     IMAYLHGINWRRIKKIAEI---VGLPTTLKQAGID-----------------------------------
G1PDH_METBU     LMMYLHG---GDWKKISDALKLIGAPTTAKELGIE-----------------------------------
G1PDH_THESM     IMAYLHGL---NWKKIRETLKRVGAPTNAYELEID-----------------------------------
G1PDH_NITMS     MIAKLQG---QDWKKIVKTLKDVGAPTTAKQIGLTE----------------------------------
G1PDH_PYRCJ     IMAYLHGINWRRIKRIADI---IGLPTSLRQANID-----------------------------------
G1PDH_PYRAR     VMAYLHGMNWRRIKRVA---KEVGLPTTLKQIGID-----------------------------------
G1PDH_PYRIL     IMAYLHGINWRRVKK---IAKLVGLPTTLREAGID-----------------------------------
G1PDH_SULAC     MMAYIHGINWRRIRRAM---KKIGLPVTSKQIGIPDEGIIKALTIAHSIRPERYTI--------------
G1PDH_METAC     MMMYLHGGNWQEIR---DALKKIGAPTNAEELGIE-----------------------------------
G1PDH_HALMA     MTEYLHSGQKGKWRDARDALAAIGAPTTADELGID-----------------------------------
G1PDH_NATPD     VTEYLHSGEGGDWRRVRDALASIDAPTTAAELGID-----------------------------------
G1PDH_METST     MMMYLQGGDWQNIKSVLE---KVNAPTTAKELGIDE----------------------------------
G1PDH_METPE     IMMYLHGGDWRGIRTALQ---QIGAPTTPAEL-----GIPDEVAVA--ALMMAKTIRPERFSILDSGLTE
G1PDH_METMA     MMMYLHGGNWQEIR---DALKKIGAPTNAEELGIE-----------------------------------
G1PDH_METBF     MMMYLHGGNWQEIR---EALKKIGAPVTAEELGIE-----------------------------------
G1PDH_METS5     ----------------------------------------------------------------------
G1PDH_IGNH4     MMLYLHG--SKLWRKVRKVLRDLNLPTTAEELGVEDEKIIEALTIAHKIRPERYTI--------------
G1PDH_PYRFU     IMAYLHG---INWRKIKETLQKVGAPTTAYELGVD-----------------------------------
G1PDH_METJA     MMSYLHEKENKKLEKIKMSLKKVDAPTTAKELGFDE----------------------------------
G1PDH_THENV     VMAYLHGINWRRIKKAA---GAVGLPTTLKQAGID-----------------------------------
G1PDH_CENSY     MMAKLQGQDWKGIAGAL---KSVGAPTTARQIGLDR---EDLIE--------------------------
G1PDH_METTP     ----------------------------------------------------------------------
G1PDH_PYRHO     IMAYLHG---INWKKIRDTLKIVGAPTTAYELGID-----------------------------------
G1PDH_PICTO     ISMYLHGGDWELLK---NTYRKIGLNT-------------------------------------------
G1PDH_CALMQ     IMLYLHG---ANWRRIIKIMKMLGLPTSFKELGYDK----------------------------------
G1PDH_METLZ     ISMIMH---EGDWKKIRNSLRLIGAPTTPKDLGISDEIVIEAILRAKEIRPERYTI--------------
G1PDH_HALSA     ----------------------------------------------------------------------
G1PDH_HALS3     ----------------------------------------------------------------------
G1PDH_STAMF     MMLYLYGDP--XXXXXXXXXXXXGLPTTAEEI--------------------------------------
G1PDH_PYRKO     IMAYLHGMKWERVR---ETLKRVGAPTNAYELGID-----------------------------------
G1PDH_META3     ISAYLHNITIGEYENIKLSLEKVGAPTI-----GEQLGYDKNILI-------------------------
G1PDH_METS3     LMMYLYGGDW----KFIDSLKAVGAPTSAKELGISDENVIDALTMAHTIRPERYTI--------------
G1PDH_METMJ     ITMYLHGGDWEGIR---DSLKKIGAPTTPA-----AIGVDDETAVA--ALLAARTIRPERFTI-------
G1PDH_THEAC     ISMYLHDENWQQI---------------------------------------------------------
G1PDH_PYRAB     IMAYLHG---INWRKIKETLKTVGAPTSAYELGID-----------------------------------
G1PDH_UNCMA     LMMYLHG---GDWEKIRDALNTIGAPVTAREMGIE-----------------------------------
G1PDH_THEVO     VSLYLHD---DNWQKIRDVFESLGVSVKARDYGLKE----------------------------------
G1PDH_BACA2     ----------------------------------------------------------------------
AROB_LACSS      AISRLFEQPTQIAAQLQTVLERVGLPVT------------------------------------------
G1PDH_BACSK     ----------------------------------------------------------------------
EUTG_ECOLI      ----------------------------------------------------------------------
G1PDH_BACHD     --MLISALYKNEARKKIETFQGEGSP--------------------------------------------
G1PDH_HALWD     VTAYLHTGENGEWEDIRAALADVGAPTTATELGIDE----------------------------------
G1PDH_KORCO     MMAYLQGQDKMIKEKLIE----AGVPTTAEE---------------------------------------
AROB_AGRRK      LAHEFSSRSPDDAKRVDAHLKTVGLPTRMAEVLMDAIAQDKKVKSGQ-----------------------
G1PDH_SULIL     ----------------------------------------------------------------------
G1PDH_METM5     ----------------------------------------------------------------------
ADH4_SCHPO      ----------------------------------------------------------------------
AROB_RHIL3      LAYEFSARSPDDARRVERHLKEVGLPTRMSETLMDAIAQDKKVKSGK-----------------------
G1PDH_HALLT     ----------------------------------------------------------------------
AROB_THETN      YEARLAFNDEGYLERILNLIKRAGLPADYE--GIEKTDMLNAIKLDKK-MREGRINFVLPVGLGKVDI--
AROB_RHOPA      LAAEFSAEPATDAERLAKHLAEVGLPTRLQDI--------------------------------------
AROB_RHILW      LAHEFSARSPDDARRVERHLQEVGLPTRMSETLMDAIAQDKKVKSGK-----------------------
AROB_DECAR      IAAELSCRDADSVARIEKIFVRSGLPVKAPDLYLELMSHDKKVQDGK-----------------------
AROB_CYAP7      IAVKLQLWSEQEANRQDALIKKAGLPTEVPEAIIEALQTDKKVKAGK-----------------------
G1PDH_SULIY     ----------------------------------------------------------------------
G1PDH_SULIN     ----------------------------------------------------------------------
G1PDH_SULIM     ----------------------------------------------------------------------
G1PDH_SULIK     ----------------------------------------------------------------------
G1PDH_SULIA     ----------------------------------------------------------------------
AROB_AZOSE      MAAELSRR--------------------------------------------------------------
AROB_RHOPT      LAAEFSAEPAADAQRLAKHLADVGLPTRLQDI--------------------------------------
AROB_PSEU2      MALEMSSRSTQERDRGIRLFQRAGLPVVLEHMAIDKKVIDGXXXXXXXXXM-GEAVITDEY---PKEVLQ
AROB_PSE14      MALEMSSRSTQDRDRGIRLFQRAGLPVVLEHMAIDKKVIDGRLRLVLLRQM-GEAVITDDY---PKEVLQ
AROB_PSESM      MALEMSSRSTQERDRGIRLFQRAGLPVVLEHMAIDKKVIDGRLRLVLLRQI-GEAVITDDY---PQEVLQ
AROB_LACLM      ISKIAEKKPLGITDEIRKMVKKYGLP--------------------------------------------
GBSB_BACSU      ----------------------------------------------------------------------
ADH2_ECOLI      ----------------------------------------------------------------------
G1PDH_SULTO     ----------------------------------------------------------------------
AROB_MICAN      IAVKLGMWTAGENQRQTDLIEKAALETRMPPLNADEM---------------------------------
ADH1_CLOSA      LPYVIKFNSKTSLERYAKIAKQISLAGNTNEELV-----DSLINLVKETTLKEYGIHEQEFK--------
G1PDH_METTH     ----------------------------------------------------------------------
AROB_RHIE6      LAHEFSARSPDDARRVERHLQAVGLPTRMAEIPMDAIAQDKKVKGGK-----------------------
AROB_AGRT5      LSARLNLASPDDAARVEAHLKAVGLPTTMKDI--------------------------------------
AROB_SYNY3      ----------------------------------------------------------------------
G1PDH_GEOTN     ----------------------------------------------------------------------
DHAT_KLEPN      ----------------------------------------------------------------------
G1PDH_METM7     ----------------------------------------------------------------------
AROB_STRP8      VKLAVSKRPKEDLDSLLQVFERYQLPTTLERADVSATSLFDVFKTDKK----------------------
AROB_PSEPW      MALEMSMRDQSERDRAIRLLQDAGLPVVMEHMAVDKKVIDGRLRLVLLRQM-GEAVVTDDY---PKEILQ
AROB_DICT6      ----------------------------------------------------------------------
G1PDH_THEPD     ----------------------------------------------------------------------
G1PDH_BACST     ----------------------------------------------------------------------
AROB_TERTT      LACELSSRDAKECDRAVALIAAAGLPT-------------------------------------------
AROB_PSEFS      MALDMSQRSAQERDRGIRLFQRAGLPVILEHMAIDKKVIDGRLRLVLLRHM-GEAVVTDDY---PKEILQ
MEDH_BACMT      ----------------------------------------------------------------------
AROB_STRPZ      VDAKLAVSPKEDLDSLLQVFERYQLPTTLERADVSATSLFDVFKTDKK----------------------
AROB_STRPM      VDAKLAVSPKEDLDSLLQVFERYQLPTTLERADVSATSLFDVFKTDKK----------------------
AROB_STRPG      VDAKLAVSPKEDLDSLLQVFERYQLPTTLERADVSATSLFDVFKTDKK----------------------
AROB_STRP3      VDAKLAVSPKEDLDSLLQVFERYQLPTTLERADVSATSLFDVFKTDKK----------------------
AROB_STRP1      VDAKLAVSPKEDLDSLLQVFERYQLPTTLERADVSATSLFDVFKTDKK----------------------
DOIS_BACCI      YAAKIANRPEHDVSAHYWLLNKIG----------------------------------------------
AROB_THIDA      ----------------------------------------------------------------------
G1PDH_BACLD     IGASLGDQHAEQAKKMAEWMRRIGGPVSFKELDVEE----------------------------------
AROB_CHLCH      CALYLSHR--------------------------------------------------------------
G1PDH_BACSU     ----------------------------------------------------------------------
AROB_STRP6      VDAKLAVSPKEDLDSLLQVFERYQLPTSLERADVSATSLFDVFKTDKK----------------------
AROB_PSYCK      ----------------------------------------------------------------------
AROB_PELUB      ----------------------------------------------------------------------
AROB_HYPNA      ----------------------------------------------------------------------
AROB_AERHH      ----------------------------------------------------------------------
PGK_STAAW       ----------------------------------------------------------------------
PGK_STAAU       ----------------------------------------------------------------------
PGK_STAAT       ----------------------------------------------------------------------
PGK_STAAS       ----------------------------------------------------------------------
PGK_STAAR       ----------------------------------------------------------------------
PGK_STAAN       ----------------------------------------------------------------------
PGK_STAAM       ----------------------------------------------------------------------
PGK_STAAE       ----------------------------------------------------------------------
PGK_STAAC       ----------------------------------------------------------------------
PGK_STAAB       ----------------------------------------------------------------------
PGK_STAA9       ----------------------------------------------------------------------
PGK_STAA8       ----------------------------------------------------------------------
PGK_STAA3       ----------------------------------------------------------------------
PGK_STAA2       ----------------------------------------------------------------------
PGK_STAA1       ----------------------------------------------------------------------
EUTG_SALTY      ----------------------------------------------------------------------
AROB_PROAC      ----------------------------------------------------------------------
YUGJ_BACSU      ----------------------------------------------------------------------
G1PDH_METKA     ----------------------------------------------------------------------
AROB_RHOOB      ----------------------------------------------------------------------
AROB_RHILO      ----------------------------------------------------------------------
AROB_MARMS      ----------------------------------------------------------------------
AROB_HAEI8      ----------------------------------------------------------------------
AROB_ACTSZ      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           AIIAVDAYxxxx
GLDA_BACST      ------------
GLDA_ECOLI      ALLVADQY----
GLDA_ECOL6      ALLVADQY----
GLDA_CITFR      AILTAD------
GLDA_THEMA      ALKAADRY----
GLDA_PSEPU      ALLVAD------
GLD1_SCHPO      AIKAVDSY----
Y1167_SYNY3     AMVS--------
YBDH_ECOLI      AFKKVESF----
G1PDH_METHJ     ------------
G1PDH_METB6     ------------
G1PDH_PYRAE     ------------
G1PDH_METBU     ------------
G1PDH_THESM     ------------
G1PDH_NITMS     ------------
G1PDH_PYRCJ     ------------
G1PDH_PYRAR     ------------
G1PDH_PYRIL     ------------
G1PDH_SULAC     ------------
G1PDH_METAC     ------------
G1PDH_HALMA     ------------
G1PDH_NATPD     ------------
G1PDH_METST     ------------
G1PDH_METPE     ------------
G1PDH_METMA     ------------
G1PDH_METBF     ------------
G1PDH_METS5     ------------
G1PDH_IGNH4     ------------
G1PDH_PYRFU     ------------
G1PDH_METJA     ------------
G1PDH_THENV     ------------
G1PDH_CENSY     ------------
G1PDH_METTP     ------------
G1PDH_PYRHO     ------------
G1PDH_PICTO     ------------
G1PDH_CALMQ     ------------
G1PDH_METLZ     ------------
G1PDH_HALSA     ------------
G1PDH_HALS3     ------------
G1PDH_STAMF     ------------
G1PDH_PYRKO     ------------
G1PDH_META3     ------------
G1PDH_METS3     ------------
G1PDH_METMJ     ------------
G1PDH_THEAC     ------------
G1PDH_PYRAB     ------------
G1PDH_UNCMA     ------------
G1PDH_THEVO     ------------
G1PDH_BACA2     ------------
AROB_LACSS      ------------
G1PDH_BACSK     ------------
EUTG_ECOLI      ------------
G1PDH_BACHD     ------------
G1PDH_HALWD     ------------
G1PDH_KORCO     ------------
AROB_AGRRK      ------------
G1PDH_SULIL     ------------
G1PDH_METM5     ------------
ADH4_SCHPO      ------------
AROB_RHIL3      ------------
G1PDH_HALLT     ------------
AROB_THETN      ------------
AROB_RHOPA      ------------
AROB_RHILW      ------------
AROB_DECAR      ------------
AROB_CYAP7      ------------
G1PDH_SULIY     ------------
G1PDH_SULIN     ------------
G1PDH_SULIM     ------------
G1PDH_SULIK     ------------
G1PDH_SULIA     ------------
AROB_AZOSE      ------------
AROB_RHOPT      ------------
AROB_PSEU2      ATLVAD------
AROB_PSE14      ATLVAD------
AROB_PSESM      ATLVAD------
AROB_LACLM      ------------
GBSB_BACSU      ------------
ADH2_ECOLI      ------------
G1PDH_SULTO     ------------
AROB_MICAN      ------------
ADH1_CLOSA      ------------
G1PDH_METTH     ------------
AROB_RHIE6      ------------
AROB_AGRT5      ------------
AROB_SYNY3      ------------
G1PDH_GEOTN     ------------
DHAT_KLEPN      ------------
G1PDH_METM7     ------------
AROB_STRP8      ------------
AROB_PSEPW      ATLSAD------
AROB_DICT6      ------------
G1PDH_THEPD     ------------
G1PDH_BACST     ------------
AROB_TERTT      ------------
AROB_PSEFS      ATLGAD------
MEDH_BACMT      ------------
AROB_STRPZ      ------------
AROB_STRPM      ------------
AROB_STRPG      ------------
AROB_STRP3      ------------
AROB_STRP1      ------------
DOIS_BACCI      ------------
AROB_THIDA      ------------
G1PDH_BACLD     ------------
AROB_CHLCH      ------------
G1PDH_BACSU     ------------
AROB_STRP6      ------------
AROB_PSYCK      ------------
AROB_PELUB      ------------
AROB_HYPNA      ------------
AROB_AERHH      ------------
PGK_STAAW       ------------
PGK_STAAU       ------------
PGK_STAAT       ------------
PGK_STAAS       ------------
PGK_STAAR       ------------
PGK_STAAN       ------------
PGK_STAAM       ------------
PGK_STAAE       ------------
PGK_STAAC       ------------
PGK_STAAB       ------------
PGK_STAA9       ------------
PGK_STAA8       ------------
PGK_STAA3       ------------
PGK_STAA2       ------------
PGK_STAA1       ------------
EUTG_SALTY      ------------
AROB_PROAC      ------------
YUGJ_BACSU      ------------
G1PDH_METKA     ------------
AROB_RHOOB      ------------
AROB_RHILO      ------------
AROB_MARMS      ------------
AROB_HAEI8      ------------
AROB_ACTSZ      ------------