[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for spne4:ACF55740.1

[Show Plain Result]


## Summary of Sequence Search
    1::185
    1::185     e-100 100%  185 aa  RRF_STRZT RecName: Full=Ribosome-recycling factor;       
    1::185     e-100 100%  185 aa  RRF_STRZJ RecName: Full=Ribosome-recycling factor;       
    1::185     e-100 100%  185 aa  RRF_STRPJ RecName: Full=Ribosome-recycling factor;       
    1::185     e-100 100%  185 aa  RRF_STRPI RecName: Full=Ribosome-recycling factor;       
    1::185     e-100 100%  185 aa  RRF_STRP4 RecName: Full=Ribosome-recycling factor;       
    1::185     1e-99  99%  185 aa  RRF_STRR6 RecName: Full=Ribosome-recycling factor;       
    1::185     1e-99  99%  185 aa  RRF_STRP2 RecName: Full=Ribosome-recycling factor;       
    1::185     2e-99  99%  185 aa  RRF_STRP7 RecName: Full=Ribosome-recycling factor;       
    1::185     1e-98  98%  185 aa  RRF_STRPS RecName: Full=Ribosome-recycling factor;       
    1::185     1e-98  98%  185 aa  RRF_STRPN RecName: Full=Ribosome-recycling factor;       
    1::185     2e-98  98%  185 aa  RRF_STRZP RecName: Full=Ribosome-recycling factor;       
    1::185     2e-96  95%  185 aa  RRF_STRSV RecName: Full=Ribosome-recycling factor;       
    1::185     9e-94  91%  185 aa  RRF_STRGC RecName: Full=Ribosome-recycling factor;       
    1::185     5e-90  88%  185 aa  RRF_STRMU RecName: Full=Ribosome-recycling factor;       
    1::185     4e-87  85%  185 aa  RRF_STRPM RecName: Full=Ribosome-recycling factor;       
    1::185     5e-87  84%  185 aa  RRF_STRA5 RecName: Full=Ribosome-recycling factor;       
    1::185     5e-87  84%  185 aa  RRF_STRA3 RecName: Full=Ribosome-recycling factor;       
    1::185     5e-87  84%  185 aa  RRF_STRA1 RecName: Full=Ribosome-recycling factor;       
    1::185     1e-86  84%  185 aa  RRF_STRPZ RecName: Full=Ribosome-recycling factor;       
    1::185     1e-86  84%  185 aa  RRF_STRPG RecName: Full=Ribosome-recycling factor;       
    1::185     1e-86  84%  185 aa  RRF_STRPF RecName: Full=Ribosome-recycling factor;       
    1::185     1e-86  84%  185 aa  RRF_STRPD RecName: Full=Ribosome-recycling factor;       
    1::185     1e-86  84%  185 aa  RRF_STRPC RecName: Full=Ribosome-recycling factor;       
    1::185     1e-86  84%  185 aa  RRF_STRPB RecName: Full=Ribosome-recycling factor;       
    1::185     1e-86  84%  185 aa  RRF_STRP6 RecName: Full=Ribosome-recycling factor;       
    1::185     1e-86  84%  185 aa  RRF_STRP3 RecName: Full=Ribosome-recycling factor;       
    1::185     1e-86  84%  185 aa  RRF_STRP1 RecName: Full=Ribosome-recycling factor;       
    1::183     3e-86  85%  185 aa  RRF_STRP8 RecName: Full=Ribosome-recycling factor;       
    1::185     1e-85  84%  185 aa  RRF_STRS7 RecName: Full=Ribosome-recycling factor;       
    1::185     1e-85  84%  185 aa  RRF_STREM RecName: Full=Ribosome-recycling factor;       
    1::185     1e-85  84%  185 aa  RRF_STRE4 RecName: Full=Ribosome-recycling factor;       
    1::185     3e-84  82%  185 aa  RRF_STRU0 RecName: Full=Ribosome-recycling factor;       
    1::185     7e-83  81%  185 aa  RRF_STRTD RecName: Full=Ribosome-recycling factor;       
    1::185     7e-83  81%  185 aa  RRF_STRT2 RecName: Full=Ribosome-recycling factor;       
    1::185     7e-83  81%  185 aa  RRF_STRT1 RecName: Full=Ribosome-recycling factor;       
    1::185     9e-78  78%  185 aa  RRF_STRSY RecName: Full=Ribosome-recycling factor;       
    1::185     9e-78  78%  185 aa  RRF_STRS2 RecName: Full=Ribosome-recycling factor;       
    1::185     4e-71  74%  185 aa  RRF_LACLA RecName: Full=Ribosome-recycling factor;       
    1::185     6e-71  74%  185 aa  RRF_LACLM RecName: Full=Ribosome-recycling factor;       
    1::185     1e-70  73%  185 aa  RRF_LACLS RecName: Full=Ribosome-recycling factor;       
    1::185     4e-70  66%  185 aa  RRF_ENTFA RecName: Full=Ribosome-recycling factor;       
    7::186     2e-64  65%  187 aa  RRF_LACS1 RecName: Full=Ribosome-recycling factor;       
    4::185     2e-63  66%  186 aa  RRF_PEDPA RecName: Full=Ribosome-recycling factor;       
    1::185     2e-63  62%  185 aa  RRF_GEOKA RecName: Full=Ribosome-recycling factor;       
    1::184     5e-63  64%  185 aa  RRF_LACSS RecName: Full=Ribosome-recycling factor;       
    1::184     2e-62  62%  185 aa  RRF_LACGA RecName: Full=Ribosome-recycling factor;       
    1::184     3e-62  62%  185 aa  RRF_LACJO RecName: Full=Ribosome-recycling factor;       
    1::185     6e-62  61%  185 aa  RRF_GEOTN RecName: Full=Ribosome-recycling factor;       
    7::186     7e-62  63%  187 aa  RRF_LACPL RecName: Full=Ribosome-recycling factor;       
    1::185     9e-62  59%  185 aa  RRF_BACP2 RecName: Full=Ribosome-recycling factor;       
    1::185     4e-61  58%  185 aa  RRF_BACHD RecName: Full=Ribosome-recycling factor;       
    1::167     5e-60  67%  185 aa  RRF_LACCB RecName: Full=Ribosome-recycling factor;       
    1::167     5e-60  67%  185 aa  RRF_LACC3 RecName: Full=Ribosome-recycling factor;       
    1::185     7e-60  61%  185 aa  RRF_GEOSW RecName: Full=Ribosome-recycling factor;       
    1::184     1e-59  61%  185 aa  RRF_LACDB RecName: Full=Ribosome-recycling factor;       
    1::184     3e-59  61%  185 aa  RRF_LACDA RecName: Full=Ribosome-recycling factor;       
    1::184     4e-57  58%  185 aa  RRF_LACH4 RecName: Full=Ribosome-recycling factor;       
    1::185     3e-56  54%  185 aa  RRF_CLOAB RecName: Full=Ribosome-recycling factor;       
    4::184     5e-56  53%  184 aa  RRF_STAHJ RecName: Full=Ribosome-recycling factor;       
    1::168     8e-56  60%  185 aa  RRF_BACLD RecName: Full=Ribosome-recycling factor;       
    1::185     1e-55  53%  185 aa  RRF_BACCN RecName: Full=Ribosome-recycling factor;       
    5::184     1e-55  54%  184 aa  RRF_ANATD RecName: Full=Ribosome-recycling factor;       
    5::184     3e-55  53%  184 aa  RRF_CALS8 RecName: Full=Ribosome-recycling factor;       
    1::185     9e-55  54%  185 aa  RRF_CLOPS RecName: Full=Ribosome-recycling factor;       
    1::185     9e-55  54%  185 aa  RRF_CLOPE RecName: Full=Ribosome-recycling factor;       
    1::185     9e-55  54%  185 aa  RRF_CLOP1 RecName: Full=Ribosome-recycling factor;       
    7::186     1e-54  57%  187 aa  RRF_LACRJ RecName: Full=Ribosome-recycling factor;       
    7::186     1e-54  57%  187 aa  RRF_LACRD RecName: Full=Ribosome-recycling factor;       
    4::167     6e-54  56%  184 aa  RRF_STAS1 RecName: Full=Ribosome-recycling factor;       
    1::185     6e-54  52%  185 aa  RRF_DESHD RecName: Full=Ribosome-recycling factor;       
    1::185     7e-54  52%  185 aa  RRF_EXIS2 RecName: Full=Ribosome-recycling factor;       
    1::185     2e-53  52%  185 aa  RRF_DESHY RecName: Full=Ribosome-recycling factor;       
    1::182     2e-53  53%  182 aa  RRF_CYAA5 RecName: Full=Ribosome-recycling factor;       
    1::185     5e-53  51%  185 aa  RRF_CLONN RecName: Full=Ribosome-recycling factor;       
    4::167     8e-53  56%  184 aa  RRF_STACT RecName: Full=Ribosome-recycling factor;       
    6::185     1e-52  50%  185 aa  RRF_OCEIH RecName: Full=Ribosome-recycling factor;       
    1::168     2e-52  59%  185 aa  RRF_BACSK RecName: Full=Ribosome-recycling factor;       
    1::185     3e-52  51%  185 aa  RRF_PELCD RecName: Full=Ribosome-recycling factor;       
    5::184     4e-52  55%  184 aa  RRF_THEPX RecName: Full=Ribosome-recycling factor;       
    5::184     4e-52  55%  184 aa  RRF_THEP3 RecName: Full=Ribosome-recycling factor;       
    1::185     4e-52  51%  185 aa  RRF_CLOB8 RecName: Full=Ribosome-recycling factor;       
    1::185     7e-52  51%  185 aa  RRF_MACCJ RecName: Full=Ribosome-recycling factor;       
    8::181     7e-52  55%  181 aa  RRF_LEUCK RecName: Full=Ribosome-recycling factor;       
    5::185     9e-52  50%  185 aa  RRF_ALKOO RecName: Full=Ribosome-recycling factor;       
    3::182     2e-51  52%  182 aa  RRF_SYNY3 RecName: Full=Ribosome-recycling factor;       
    1::185     2e-51  50%  185 aa  RRF_PELTS RecName: Full=Ribosome-recycling factor;       
    1::185     3e-51  50%  185 aa  RRF_FINM2 RecName: Full=Ribosome-recycling factor;       
    5::184     4e-51  54%  184 aa  RRF_THETN RecName: Full=Ribosome-recycling factor;       
    1::185     4e-51  51%  185 aa  RRF_SYMTH RecName: Full=Ribosome-recycling factor;       
    4::184     7e-51  51%  184 aa  RRF_STAAW RecName: Full=Ribosome-recycling factor;       
    4::184     7e-51  51%  184 aa  RRF_STAAU RecName: Full=Ribosome-recycling factor;       
    4::184     7e-51  51%  184 aa  RRF_STAAS RecName: Full=Ribosome-recycling factor;       
    4::184     7e-51  51%  184 aa  RRF_STAAR RecName: Full=Ribosome-recycling factor;       
    4::184     7e-51  51%  184 aa  RRF_STAAN RecName: Full=Ribosome-recycling factor;       
    4::184     7e-51  51%  184 aa  RRF_STAAM RecName: Full=Ribosome-recycling factor;       
    4::184     7e-51  51%  184 aa  RRF_STAAE RecName: Full=Ribosome-recycling factor;       
    4::184     7e-51  51%  184 aa  RRF_STAAC RecName: Full=Ribosome-recycling factor;       
    4::184     7e-51  51%  184 aa  RRF_STAAB RecName: Full=Ribosome-recycling factor;       
    4::184     7e-51  51%  184 aa  RRF_STAA9 RecName: Full=Ribosome-recycling factor;       
    4::184     7e-51  51%  184 aa  RRF_STAA8 RecName: Full=Ribosome-recycling factor;       
    4::184     7e-51  51%  184 aa  RRF_STAA3 RecName: Full=Ribosome-recycling factor;       
    4::184     7e-51  51%  184 aa  RRF_STAA2 RecName: Full=Ribosome-recycling factor;       
    4::184     7e-51  51%  184 aa  RRF_STAA1 RecName: Full=Ribosome-recycling factor;       
    1::185     7e-51  51%  185 aa  RRF_LISMH RecName: Full=Ribosome-recycling factor;       
    7::182     1e-50  52%  182 aa  RRF_THEEB RecName: Full=Ribosome-recycling factor;       
    7::185     1e-50  54%  186 aa  RRF_LACRE RecName: Full=Ribosome-recycling factor;       
    1::185     2e-50  51%  185 aa  RRF_XYLFA RecName: Full=Ribosome-recycling factor;       
    1::185     2e-50  51%  185 aa  RRF_XYLFT RecName: Full=Ribosome-recycling factor;       
    1::185     2e-50  49%  185 aa  RRF_GEOUR RecName: Full=Ribosome-recycling factor;       
    1::185     2e-50  49%  185 aa  RRF_BACC7 RecName: Full=Ribosome-recycling factor;       
    1::185     2e-50  49%  185 aa  RRF_BACC1 RecName: Full=Ribosome-recycling factor;       
    7::185     2e-50  51%  185 aa  RRF_ALKMQ RecName: Full=Ribosome-recycling factor;       
    1::185     5e-50  50%  185 aa  RRF_LISIN RecName: Full=Ribosome-recycling factor;       
    1::185     5e-50  49%  185 aa  RRF_BACCR RecName: Full=Ribosome-recycling factor;       
    1::185     5e-50  49%  185 aa  RRF_BACC4 RecName: Full=Ribosome-recycling factor;       
    1::185     8e-50  49%  185 aa  RRF_BACA2 RecName: Full=Ribosome-recycling factor;       
    4::184     1e-49  49%  184 aa  RRF_STAES RecName: Full=Ribosome-recycling factor;       
    4::184     1e-49  49%  184 aa  RRF_STAEQ RecName: Full=Ribosome-recycling factor;       
    1::184     1e-49  51%  184 aa  RRF_DESRM RecName: Full=Ribosome-recycling factor;       
    1::184     1e-49  52%  184 aa  RRF_CLOBL RecName: Full=Ribosome-recycling factor;       
    1::185     2e-49  49%  185 aa  RRF_GEOSM RecName: Full=Ribosome-recycling factor;       
    2::184     2e-49  48%  184 aa  RRF_DESDG RecName: Full=Ribosome-recycling factor;       
    1::184     2e-49  52%  184 aa  RRF_CLOBK RecName: Full=Ribosome-recycling factor;       
    1::184     2e-49  52%  184 aa  RRF_CLOBJ RecName: Full=Ribosome-recycling factor;       
    1::184     2e-49  52%  184 aa  RRF_CLOB6 RecName: Full=Ribosome-recycling factor;       
    1::185     2e-49  48%  185 aa  RRF_BACHK RecName: Full=Ribosome-recycling factor;       
    1::185     2e-49  48%  185 aa  RRF_BACCZ RecName: Full=Ribosome-recycling factor;       
    1::185     2e-49  48%  185 aa  RRF_BACC3 RecName: Full=Ribosome-recycling factor;       
    1::185     2e-49  48%  185 aa  RRF_BACC0 RecName: Full=Ribosome-recycling factor;       
    1::185     2e-49  48%  185 aa  RRF_BACAH RecName: Full=Ribosome-recycling factor;       
    1::185     2e-49  48%  185 aa  RRF_BACAC RecName: Full=Ribosome-recycling factor;       
    6::186     3e-49  49%  186 aa  RRF_DESVM RecName: Full=Ribosome-recycling factor;       
    1::185     4e-49  50%  185 aa  RRF_XANCP RecName: Full=Ribosome-recycling factor;       
    1::185     4e-49  50%  185 aa  RRF_XANCB RecName: Full=Ribosome-recycling factor;       
    1::185     4e-49  50%  185 aa  RRF_XANC8 RecName: Full=Ribosome-recycling factor;       
    1::185     4e-49  48%  185 aa  RRF_BACC2 RecName: Full=Ribosome-recycling factor;       
    1::185     4e-49  48%  185 aa  RRF_BACAN RecName: Full=Ribosome-recycling factor;       
    1::185     4e-49  48%  185 aa  RRF_BACAA RecName: Full=Ribosome-recycling factor;       
    7::182     7e-49  51%  182 aa  RRF_CYAP4 RecName: Full=Ribosome-recycling factor;       
    1::185     7e-49  47%  185 aa  RRF_BACWK RecName: Full=Ribosome-recycling factor;       
   12::188     9e-49  47%  188 aa  RRF_LAWIP RecName: Full=Ribosome-recycling factor;       
    3::182     9e-49  49%  182 aa  RRF_CYAP7 RecName: Full=Ribosome-recycling factor;       
    3::162     1e-48  54%  182 aa  RRF_SYNJB RecName: Full=Ribosome-recycling factor;       
    1::184     1e-48  51%  184 aa  RRF_CLOBH RecName: Full=Ribosome-recycling factor;       
    1::184     1e-48  51%  184 aa  RRF_CLOB1 RecName: Full=Ribosome-recycling factor;       
    1::185     2e-48  48%  185 aa  RRF_GEOLS RecName: Full=Ribosome-recycling factor;       
    5::185     2e-48  48%  185 aa  RRF_MOOTA RecName: Full=Ribosome-recycling factor;       
    1::185     2e-48  48%  185 aa  RRF_GEOBB RecName: Full=Ribosome-recycling factor;       
    5::184     2e-48  51%  184 aa  RRF_ACHLI RecName: Full=Ribosome-recycling factor;       
    1::185     3e-48  48%  185 aa  RRF_HELMI RecName: Full=Ribosome-recycling factor;       
    1::185     5e-48  49%  185 aa  RRF_THISH RecName: Full=Ribosome-recycling factor;       
    1::165     5e-48  53%  185 aa  RRF_BREBN RecName: Full=Ribosome-recycling factor;       
    1::185     5e-48  48%  185 aa  RRF_BACSU RecName: Full=Ribosome-recycling factor;       
    1::185     6e-48  50%  185 aa  RRF_XANC5 RecName: Full=Ribosome-recycling factor;       
    1::185     6e-48  50%  185 aa  RRF_XANAC RecName: Full=Ribosome-recycling factor;       
    3::182     6e-48  49%  182 aa  RRF_TRIEI RecName: Full=Ribosome-recycling factor;       
    3::163     8e-48  53%  182 aa  RRF_SYNP2 RecName: Full=Ribosome-recycling factor;       
    1::182     8e-48  48%  182 aa  RRF_NOSP7 RecName: Full=Ribosome-recycling factor;       
    1::185     1e-47  49%  185 aa  RRF_COLP3 RecName: Full=Ribosome-recycling factor;       
    1::184     2e-47  47%  185 aa  RRF_TREDE RecName: Full=Ribosome-recycling factor;       
    1::185     3e-47  49%  185 aa  RRF_XANOR RecName: Full=Ribosome-recycling factor;       
    1::185     3e-47  49%  185 aa  RRF_XANOP RecName: Full=Ribosome-recycling factor;       
    1::185     3e-47  49%  185 aa  RRF_XANOM RecName: Full=Ribosome-recycling factor;       
    9::184     3e-47  49%  184 aa  RRF_EUBR3 RecName: Full=Ribosome-recycling factor;       
    1::184     3e-47  46%  185 aa  RRF_DESAA RecName: Full=Ribosome-recycling factor;       
    1::185     3e-47  47%  185 aa  RRF_CORGL RecName: Full=Ribosome-recycling factor;       
    1::185     3e-47  47%  185 aa  RRF_CORGB RecName: Full=Ribosome-recycling factor;       
   30::183     3e-47  53%  183 aa  RRF_CLOTE RecName: Full=Ribosome-recycling factor;       
    1::185     4e-47  50%  185 aa  RRF_IDILO RecName: Full=Ribosome-recycling factor;       
    1::185     5e-47  48%  185 aa  RRF_LISW6 RecName: Full=Ribosome-recycling factor;       
    1::185     5e-47  48%  185 aa  RRF_LISMO RecName: Full=Ribosome-recycling factor;       
    1::185     5e-47  48%  185 aa  RRF_LISMF RecName: Full=Ribosome-recycling factor;       
    1::185     5e-47  48%  185 aa  RRF_LISMC RecName: Full=Ribosome-recycling factor;       
    1::184     5e-47  48%  184 aa  RRF_DESPS RecName: Full=Ribosome-recycling factor;       
   12::187     7e-47  51%  187 aa  RRF_NITWN RecName: Full=Ribosome-recycling factor;       
    8::190     7e-47  48%  190 aa  RRF_FUSNN RecName: Full=Ribosome-recycling factor;       
    1::184     7e-47  49%  185 aa  RRF_ACTSZ RecName: Full=Ribosome-recycling factor;       
    1::185     9e-47  43%  185 aa  RRF_SYNAS RecName: Full=Ribosome-recycling factor;       
    1::185     9e-47  47%  185 aa  RRF_DEHSC RecName: Full=Ribosome-recycling factor;       
    1::185     9e-47  46%  185 aa  RRF_CORDI RecName: Full=Ribosome-recycling factor;       
    1::185     9e-47  46%  185 aa  RRF_CLOK5 RecName: Full=Ribosome-recycling factor;       
    1::185     9e-47  46%  185 aa  RRF_CLOK1 RecName: Full=Ribosome-recycling factor;       
    5::185     1e-46  47%  185 aa  RRF_SHESA RecName: Full=Ribosome-recycling factor;       
    1::185     1e-46  47%  185 aa  RRF_DEHE1 RecName: Full=Ribosome-recycling factor;       
    1::185     1e-46  46%  185 aa  RRF_SHESW RecName: Full=Ribosome-recycling factor;       
    1::185     1e-46  46%  185 aa  RRF_SHEPC RecName: Full=Ribosome-recycling factor;       
    1::184     1e-46  49%  185 aa  RRF_HAES2 RecName: Full=Ribosome-recycling factor;       
    1::184     1e-46  49%  185 aa  RRF_HAES1 RecName: Full=Ribosome-recycling factor;       
    1::184     1e-46  49%  185 aa  RRF_HAEIN RecName: Full=Ribosome-recycling factor;       
    1::184     1e-46  49%  185 aa  RRF_HAEIG RecName: Full=Ribosome-recycling factor;       
    1::185     1e-46  46%  185 aa  RRF_GEOMG RecName: Full=Ribosome-recycling factor;       
    8::163     1e-46  54%  183 aa  RRF_CLOTH RecName: Full=Ribosome-recycling factor;       
    8::185     1e-46  48%  185 aa  RRF_ACIC1 RecName: Full=Ribosome-recycling factor;       
    4::182     2e-46  47%  182 aa  RRF_PROM1 RecName: Full=Ribosome-recycling factor;       
    9::185     2e-46  48%  185 aa  RRF_MYCS2 RecName: Full=Ribosome-recycling factor;       
    1::184     2e-46  49%  185 aa  RRF_HAEI8 RecName: Full=Ribosome-recycling factor;       
    1::185     2e-46  49%  185 aa  RRF_VIBPA RecName: Full=Ribosome-recycling factor;       
    5::185     2e-46  46%  185 aa  RRF_SHESR RecName: Full=Ribosome-recycling factor;       
    5::185     2e-46  46%  185 aa  RRF_SHESM RecName: Full=Ribosome-recycling factor;       
    4::182     2e-46  47%  182 aa  RRF_PROMT RecName: Full=Ribosome-recycling factor;       
    1::184     2e-46  48%  185 aa  RRF_HAEPS RecName: Full=Ribosome-recycling factor;       
    1::185     2e-46  45%  185 aa  RRF_DESAH RecName: Full=Ribosome-recycling factor;       
    1::185     3e-46  45%  185 aa  RRF_SHEB5 RecName: Full=Ribosome-recycling factor;       
    1::185     3e-46  45%  185 aa  RRF_SHEB2 RecName: Full=Ribosome-recycling factor;       
    8::188     3e-46  44%  188 aa  RRF_PHEZH RecName: Full=Ribosome-recycling factor;       
    1::185     3e-46  45%  185 aa  RRF_CORA7 RecName: Full=Ribosome-recycling factor;       
    1::185     4e-46  45%  185 aa  RRF_SHEDO RecName: Full=Ribosome-recycling factor;       
    1::185     4e-46  45%  185 aa  RRF_SHEB9 RecName: Full=Ribosome-recycling factor;       
    1::185     4e-46  45%  185 aa  RRF_SHEB8 RecName: Full=Ribosome-recycling factor;       
    3::182     4e-46  47%  182 aa  RRF_GLOVI RecName: Full=Ribosome-recycling factor;       
    5::185     4e-46  46%  185 aa  RRF_CLOD6 RecName: Full=Ribosome-recycling factor;       
    1::161     4e-46  53%  185 aa  RRF_CLOBB RecName: Full=Ribosome-recycling factor;       
    1::161     4e-46  53%  185 aa  RRF_CLOBA RecName: Full=Ribosome-recycling factor;       
    1::185     4e-46  46%  185 aa  RRF_CAMLR RecName: Full=Ribosome-recycling factor;       
    1::185     6e-46  49%  185 aa  RRF_VIBHB RecName: Full=Ribosome-recycling factor;       
    5::185     6e-46  46%  185 aa  RRF_SHEON RecName: Full=Ribosome-recycling factor;       
    1::184     6e-46  48%  185 aa  RRF_HAEDU RecName: Full=Ribosome-recycling factor;       
    1::185     7e-46  49%  185 aa  RRF_VIBCM RecName: Full=Ribosome-recycling factor;       
    1::185     7e-46  49%  185 aa  RRF_VIBCH RecName: Full=Ribosome-recycling factor;       
    1::185     7e-46  49%  185 aa  RRF_VIBC3 RecName: Full=Ribosome-recycling factor;       
    1::184     7e-46  47%  185 aa  RRF_SHEHH RecName: Full=Ribosome-recycling factor;       
    4::171     7e-46  49%  184 aa  RRF_PROAC RecName: Full=Ribosome-recycling factor;       
    1::185     9e-46  46%  185 aa  RRF_PELPD RecName: Full=Ribosome-recycling factor;       
    1::184     9e-46  47%  185 aa  RRF_MANSM RecName: Full=Ribosome-recycling factor;       
    1::185     9e-46  47%  185 aa  RRF_MAGSM RecName: Full=Ribosome-recycling factor;       
    1::185     9e-46  43%  185 aa  RRF_HELHP RecName: Full=Ribosome-recycling factor;       
    3::182     9e-46  47%  182 aa  RRF_ANASP RecName: Full=Ribosome-recycling factor;       
    8::188     1e-45  48%  188 aa  RRF_GLUDA RecName: Full=Ribosome-recycling factor;       
    1::184     1e-45  48%  185 aa  RRF_ACTPJ RecName: Full=Ribosome-recycling factor;       
    1::184     1e-45  48%  185 aa  RRF_ACTP7 RecName: Full=Ribosome-recycling factor;       
    1::184     1e-45  48%  185 aa  RRF_ACTP2 RecName: Full=Ribosome-recycling factor;       
    1::185     2e-45  49%  185 aa  RRF_VIBVY RecName: Full=Ribosome-recycling factor;       
    1::184     2e-45  47%  185 aa  RRF_SHEPA RecName: Full=Ribosome-recycling factor;       
    1::185     2e-45  45%  185 aa  RRF_RHOOB RecName: Full=Ribosome-recycling factor;       
    9::185     2e-45  45%  185 aa  RRF_MYCGI RecName: Full=Ribosome-recycling factor;       
    8::185     2e-45  46%  185 aa  RRF_CORK4 RecName: Full=Ribosome-recycling factor;       
    1::185     2e-45  49%  185 aa  RRF_VIBF1 RecName: Full=Ribosome-recycling factor;       
    1::185     2e-45  46%  185 aa  RRF_MYCA9 RecName: Full=Ribosome-recycling factor;       
    1::185     3e-45  49%  185 aa  RRF_VIBFM RecName: Full=Ribosome-recycling factor;       
    1::184     3e-45  44%  185 aa  RRF_THEP1 RecName: Full=Ribosome-recycling factor;       
   10::182     3e-45  47%  182 aa  RRF_SYNP6 RecName: Full=Ribosome-recycling factor;       
   10::182     3e-45  47%  182 aa  RRF_SYNE7 RecName: Full=Ribosome-recycling factor;       
    1::185     3e-45  45%  185 aa  RRF_RHOSR RecName: Full=Ribosome-recycling factor;       
    7::187     3e-45  46%  187 aa  RRF_PARD8 RecName: Full=Ribosome-recycling factor;       
    9::185     3e-45  47%  185 aa  RRF_MYCSS RecName: Full=Ribosome-recycling factor;       
    9::185     3e-45  47%  185 aa  RRF_MYCSK RecName: Full=Ribosome-recycling factor;       
    9::185     3e-45  47%  185 aa  RRF_MYCSJ RecName: Full=Ribosome-recycling factor;       
    1::185     3e-45  45%  185 aa  RRF_HALHL RecName: Full=Ribosome-recycling factor;       
    1::185     4e-45  45%  185 aa  RRF_THICR RecName: Full=Ribosome-recycling factor;       
    1::185     4e-45  45%  185 aa  RRF_SHELP RecName: Full=Ribosome-recycling factor;       
    1::185     4e-45  48%  185 aa  RRF_METCA RecName: Full=Ribosome-recycling factor;       
    1::184     6e-45  43%  185 aa  RRF_THEAB RecName: Full=Ribosome-recycling factor;       
    1::184     6e-45  47%  185 aa  RRF_SHEPW RecName: Full=Ribosome-recycling factor;       
    1::184     6e-45  48%  185 aa  RRF_PASMU RecName: Full=Ribosome-recycling factor;       
    5::187     6e-45  46%  187 aa  RRF_BRASO RecName: Full=Ribosome-recycling factor;       
    1::185     8e-45  47%  185 aa  RRF_TOLAT RecName: Full=Ribosome-recycling factor;       
    1::185     8e-45  44%  185 aa  RRF_COREF RecName: Full=Ribosome-recycling factor;       
    9::185     8e-45  47%  185 aa  RRF_ALTMD RecName: Full=Ribosome-recycling factor;       
    1::184     1e-44  42%  185 aa  RRF_THENN RecName: Full=Ribosome-recycling factor;       
    8::188     1e-44  46%  188 aa  RRF_CAUSK RecName: Full=Ribosome-recycling factor;       
    4::182     1e-44  46%  182 aa  RRF_PROMM RecName: Full=Ribosome-recycling factor;       
   23::185     1e-44  50%  185 aa  RRF_MYCVP RecName: Full=Ribosome-recycling factor;       
    1::185     1e-44  43%  185 aa  RRF_DESOH RecName: Full=Ribosome-recycling factor;       
    1::184     2e-44  44%  185 aa  RRF_THEM4 RecName: Full=Ribosome-recycling factor;       
    1::185     2e-44  45%  185 aa  RRF_SHESH RecName: Full=Ribosome-recycling factor;       
    1::185     2e-44  43%  185 aa  RRF_SHEFN RecName: Full=Ribosome-recycling factor;       
    1::185     2e-44  50%  185 aa  RRF_ALISL RecName: Full=Ribosome-recycling factor;       
   10::183     2e-44  46%  185 aa  RRF_ZYMMO RecName: Full=Ribosome-recycling factor;       
    1::184     2e-44  46%  185 aa  RRF_PHOLL RecName: Full=Ribosome-recycling factor;       
    9::185     2e-44  46%  185 aa  RRF_MYCMM RecName: Full=Ribosome-recycling factor;       
    1::184     3e-44  43%  185 aa  RRF_THESQ RecName: Full=Ribosome-recycling factor;       
    1::184     3e-44  43%  185 aa  RRF_THEMA RecName: Full=Ribosome-recycling factor;       
    8::187     3e-44  47%  187 aa  RRF_RHOPB RecName: Full=Ribosome-recycling factor;       
    1::185     3e-44  46%  185 aa  RRF_COXBN RecName: Full=Ribosome-recycling factor;       
    1::185     3e-44  46%  185 aa  RRF_COXB2 RecName: Full=Ribosome-recycling factor;       
    1::185     3e-44  46%  185 aa  RRF_COXB1 RecName: Full=Ribosome-recycling factor;       
   10::182     4e-44  47%  182 aa  RRF_SYNS3 RecName: Full=Ribosome-recycling factor;       
    6::186     4e-44  48%  186 aa  RRF_PORG3 RecName: Full=Ribosome-recycling factor;       
    1::185     4e-44  46%  185 aa  RRF_LEGPL RecName: Full=Ribosome-recycling factor;       
    1::185     4e-44  46%  185 aa  RRF_LEGPH RecName: Full=Ribosome-recycling factor;       
    1::185     4e-44  46%  185 aa  RRF_LEGPC RecName: Full=Ribosome-recycling factor;       
    1::185     4e-44  46%  185 aa  RRF_LEGPA RecName: Full=Ribosome-recycling factor;       
   12::187     5e-44  48%  187 aa  RRF_XANP2 RecName: Full=Ribosome-recycling factor;       
    4::186     5e-44  43%  186 aa  RRF_NITSB RecName: Full=Ribosome-recycling factor;       
    9::185     5e-44  46%  185 aa  RRF_MYCUA RecName: Full=Ribosome-recycling factor;       
    1::185     5e-44  44%  185 aa  RRF_CHLSY RecName: Full=Ribosome-recycling factor;       
    1::185     5e-44  44%  185 aa  RRF_CHLAA RecName: Full=Ribosome-recycling factor;       
    6::186     5e-44  48%  186 aa  RRF_BORPE RecName: Full=Ribosome-recycling factor;       
    6::186     5e-44  48%  186 aa  RRF_BORPA RecName: Full=Ribosome-recycling factor;       
   10::184     5e-44  46%  184 aa  RRF_BORBZ RecName: Full=Ribosome-recycling factor;       
    6::186     5e-44  48%  186 aa  RRF_BORBR RecName: Full=Ribosome-recycling factor;       
   10::184     5e-44  46%  184 aa  RRF_BORAP RecName: Full=Ribosome-recycling factor;       
    1::185     7e-44  44%  185 aa  RRF_RHOE4 RecName: Full=Ribosome-recycling factor;       
    1::185     7e-44  45%  185 aa  RRF_RHOCS RecName: Full=Ribosome-recycling factor;       
    1::185     9e-44  43%  185 aa  RRF_ROSS1 RecName: Full=Ribosome-recycling factor;       
    6::186     9e-44  48%  186 aa  RRF_PORGI RecName: Full=Ribosome-recycling factor;       
    4::180     9e-44  50%  180 aa  RRF_OENOB RecName: Full=Ribosome-recycling factor;       
    1::185     9e-44  44%  185 aa  RRF_CHLAD RecName: Full=Ribosome-recycling factor;       
    1::185     9e-44  43%  185 aa  RRF_CAMJR RecName: Full=Ribosome-recycling factor;       
    1::184     1e-43  48%  184 aa  RRF_CLOBM RecName: Full=Ribosome-recycling factor;       
    8::188     1e-43  46%  188 aa  RRF_CAUCR RecName: Full=Ribosome-recycling factor;       
    8::188     1e-43  46%  188 aa  RRF_CAUCN RecName: Full=Ribosome-recycling factor;       
   10::184     1e-43  46%  184 aa  RRF_BORGA RecName: Full=Ribosome-recycling factor;       
   10::182     2e-43  46%  182 aa  RRF_SYNPW RecName: Full=Ribosome-recycling factor;       
    1::185     2e-43  43%  185 aa  RRF_ROSCS RecName: Full=Ribosome-recycling factor;       
    1::185     2e-43  45%  185 aa  RRF_PSEAE RecName: Full=Ribosome-recycling factor;       
    1::185     2e-43  45%  185 aa  RRF_PSEAB RecName: Full=Ribosome-recycling factor;       
    1::185     2e-43  45%  185 aa  RRF_PSEA8 RecName: Full=Ribosome-recycling factor;       
    8::186     2e-43  46%  186 aa  RRF_BDEBA RecName: Full=Ribosome-recycling factor;       
   10::182     2e-43  46%  182 aa  RRF_SYNSC RecName: Full=Ribosome-recycling factor;       
    9::185     3e-43  46%  185 aa  RRF_NOCFA RecName: Full=Ribosome-recycling factor;       
   27::185     3e-43  50%  185 aa  RRF_MYCTU RecName: Full=Ribosome-recycling factor;       
   27::185     3e-43  50%  185 aa  RRF_MYCTA RecName: Full=Ribosome-recycling factor;       
   27::185     3e-43  50%  185 aa  RRF_MYCBO RecName: Full=Ribosome-recycling factor;       
    1::185     3e-43  44%  185 aa  RRF_TERTT RecName: Full=Ribosome-recycling factor;       
    1::185     3e-43  44%  185 aa  RRF_PSEA7 RecName: Full=Ribosome-recycling factor;       
    1::182     3e-43  45%  182 aa  RRF_PROMA RecName: Full=Ribosome-recycling factor;       
    8::181     3e-43  47%  181 aa  RRF_MESFL RecName: Full=Ribosome-recycling factor;       
    1::185     3e-43  46%  185 aa  RRF_COXBU RecName: Full=Ribosome-recycling factor;       
    1::185     3e-43  46%  185 aa  RRF_COXBR RecName: Full=Ribosome-recycling factor;       
    1::185     3e-43  43%  185 aa  RRF_CAMJ8 RecName: Full=Ribosome-recycling factor;       
    1::185     3e-43  43%  185 aa  RRF_CAMC1 RecName: Full=Ribosome-recycling factor;       
    9::185     4e-43  46%  185 aa  RRF_MYCLE RecName: Full=Ribosome-recycling factor;       
    9::185     4e-43  46%  185 aa  RRF_MYCLB RecName: Full=Ribosome-recycling factor;       
    1::185     4e-43  43%  185 aa  RRF_CAMJJ RecName: Full=Ribosome-recycling factor;       
   46::227     4e-43  49%  227 aa  RRFC_DAUCA RecName: Full=Ribosome-recycling factor, chloroplastic; 
   10::182     6e-43  46%  182 aa  RRF_SYNS9 RecName: Full=Ribosome-recycling factor;       
   10::182     6e-43  45%  182 aa  RRF_SYNPX RecName: Full=Ribosome-recycling factor;       
   17::190     6e-43  47%  190 aa  RRF_MAGSA RecName: Full=Ribosome-recycling factor;       
    6::186     6e-43  45%  186 aa  RRF_LEPCP RecName: Full=Ribosome-recycling factor;       
    1::184     6e-43  47%  185 aa  RRF_EDWI9 RecName: Full=Ribosome-recycling factor;       
    1::185     7e-43  44%  185 aa  RRF_SHEWM RecName: Full=Ribosome-recycling factor;       
    1::184     7e-43  45%  185 aa  RRF_PROMH RecName: Full=Ribosome-recycling factor;       
    1::184     7e-43  44%  185 aa  RRF_ERWCT RecName: Full=Ribosome-recycling factor;       
   11::182     7e-43  46%  183 aa  RRF_DEIGD RecName: Full=Ribosome-recycling factor;       
    1::172     7e-43  45%  185 aa  RRF_CORJK RecName: Full=Ribosome-recycling factor;       
    1::185     7e-43  43%  185 aa  RRF_CAMJE RecName: Full=Ribosome-recycling factor;       
    1::185     7e-43  44%  185 aa  RRF_CAMC5 RecName: Full=Ribosome-recycling factor;       
    4::188     7e-43  43%  188 aa  RRF_ANAD2 RecName: Full=Ribosome-recycling factor;       
   27::185     1e-42  49%  185 aa  RRF_MYCPA RecName: Full=Ribosome-recycling factor;       
   27::185     1e-42  49%  185 aa  RRF_MYCA1 RecName: Full=Ribosome-recycling factor;       
    3::183     1e-42  47%  183 aa  RRF_BIFLO RecName: Full=Ribosome-recycling factor;       
    3::183     1e-42  47%  183 aa  RRF_BIFLD RecName: Full=Ribosome-recycling factor;       
    1::185     1e-42  46%  185 aa  RRF_AZOSB RecName: Full=Ribosome-recycling factor;       
    1::185     1e-42  43%  185 aa  RRF_SALAI RecName: Full=Ribosome-recycling factor;       
    1::172     1e-42  44%  185 aa  RRF_CORU7 RecName: Full=Ribosome-recycling factor;       
    3::183     1e-42  46%  183 aa  RRF_BIFLI RecName: Full=Ribosome-recycling factor;       
    1::185     2e-42  43%  185 aa  RRF_CAMJD RecName: Full=Ribosome-recycling factor;       
    9::189     2e-42  46%  189 aa  RRF_THIDA RecName: Full=Ribosome-recycling factor;       
    1::184     2e-42  43%  184 aa  RRF_PSYWF RecName: Full=Ribosome-recycling factor;       
    9::185     2e-42  45%  185 aa  RRF_METFK RecName: Full=Ribosome-recycling factor;       
    4::188     2e-42  42%  188 aa  RRF_ANASK RecName: Full=Ribosome-recycling factor;       
    3::182     3e-42  44%  183 aa  RRF_TREPS RecName: Full=Ribosome-recycling factor;       
    3::182     3e-42  44%  183 aa  RRF_TREPA RecName: Full=Ribosome-recycling factor;       
    5::186     3e-42  45%  186 aa  RRF_SINMW RecName: Full=Ribosome-recycling factor;       
    1::185     3e-42  45%  185 aa  RRF_MICLC RecName: Full=Ribosome-recycling factor;       
    4::184     3e-42  46%  184 aa  RRF_BIFAA RecName: Full=Ribosome-recycling factor;       
    1::185     4e-42  42%  185 aa  RRF_SALTO RecName: Full=Ribosome-recycling factor;       
    1::186     4e-42  45%  186 aa  RRF_RICBR RecName: Full=Ribosome-recycling factor;       
    1::186     4e-42  45%  186 aa  RRF_RICB8 RecName: Full=Ribosome-recycling factor;       
   27::185     4e-42  49%  185 aa  RRF_MYCBT RecName: Full=Ribosome-recycling factor;       
   27::185     4e-42  49%  185 aa  RRF_MYCBP RecName: Full=Ribosome-recycling factor;       
   11::186     4e-42  41%  186 aa  RRF_MARMM RecName: Full=Ribosome-recycling factor;       
    6::184     4e-42  44%  184 aa  RRF_LEPBL RecName: Full=Ribosome-recycling factor;       
    6::184     4e-42  44%  184 aa  RRF_LEPBJ RecName: Full=Ribosome-recycling factor;       
   10::183     4e-42  45%  184 aa  RRF_BORBU RecName: Full=Ribosome-recycling factor;       
    4::188     4e-42  42%  188 aa  RRF_ANADE RecName: Full=Ribosome-recycling factor;       
    1::184     5e-42  45%  185 aa  RRF_YERPY RecName: Full=Ribosome-recycling factor;       
    1::184     5e-42  45%  185 aa  RRF_YERPS RecName: Full=Ribosome-recycling factor;       
    1::184     5e-42  45%  185 aa  RRF_YERPP RecName: Full=Ribosome-recycling factor;       
    1::184     5e-42  45%  185 aa  RRF_YERPN RecName: Full=Ribosome-recycling factor;       
    1::184     5e-42  45%  185 aa  RRF_YERPG RecName: Full=Ribosome-recycling factor;       
    1::184     5e-42  45%  185 aa  RRF_YERPE RecName: Full=Ribosome-recycling factor;       
    1::184     5e-42  45%  185 aa  RRF_YERPB RecName: Full=Ribosome-recycling factor;       
    1::184     5e-42  45%  185 aa  RRF_YERPA RecName: Full=Ribosome-recycling factor;       
    1::184     5e-42  45%  185 aa  RRF_YERP3 RecName: Full=Ribosome-recycling factor;       
    1::185     5e-42  44%  185 aa  RRF_THERP RecName: Full=Ribosome-recycling factor;       
    6::188     5e-42  43%  188 aa  RRF_GRABC RecName: Full=Ribosome-recycling factor;       
    8::186     6e-42  44%  186 aa  RRF_RALPJ RecName: Full=Ribosome-recycling factor;       
   11::186     6e-42  44%  186 aa  RRF_BURVG RecName: Full=Ribosome-recycling factor;       
   11::186     6e-42  45%  186 aa  RRF_BURTA RecName: Full=Ribosome-recycling factor;       
   11::186     6e-42  44%  186 aa  RRF_BURCH RecName: Full=Ribosome-recycling factor;       
   11::186     6e-42  44%  186 aa  RRF_BURCC RecName: Full=Ribosome-recycling factor;       
   11::186     6e-42  44%  186 aa  RRF_BURCA RecName: Full=Ribosome-recycling factor;       
   10::186     8e-42  45%  186 aa  RRF_BURPP RecName: Full=Ribosome-recycling factor;       
   10::186     8e-42  45%  186 aa  RRF_BURP8 RecName: Full=Ribosome-recycling factor;       
   11::186     8e-42  44%  186 aa  RRF_BURCM RecName: Full=Ribosome-recycling factor;       
   11::186     8e-42  44%  186 aa  RRF_BURA4 RecName: Full=Ribosome-recycling factor;       
    7::186     1e-41  45%  186 aa  RRF_RHOPT RecName: Full=Ribosome-recycling factor;       
    7::186     1e-41  45%  186 aa  RRF_RHOPA RecName: Full=Ribosome-recycling factor;       
    5::186     1e-41  44%  186 aa  RRF_RHIME RecName: Full=Ribosome-recycling factor;       
    1::185     1e-41  44%  185 aa  RRF_NOCSJ RecName: Full=Ribosome-recycling factor;       
   19::185     1e-41  49%  185 aa  RRF_HAHCH RecName: Full=Ribosome-recycling factor;       
    6::186     1e-41  43%  186 aa  RRF_DESVV RecName: Full=Ribosome-recycling factor;       
    6::186     1e-41  43%  186 aa  RRF_DESVH RecName: Full=Ribosome-recycling factor;       
   11::186     1e-41  44%  186 aa  RRF_BURCJ RecName: Full=Ribosome-recycling factor;       
    1::184     1e-41  45%  184 aa  RRF_ACIAD RecName: Full=Ribosome-recycling factor;       
   89::271     1e-41  44%  271 aa  RRFC_SPIOL RecName: Full=Ribosome-recycling factor, chloroplastic; 
    8::186     1e-41  45%  186 aa  RRF_CUPTR RecName: Full=Ribosome-recycling factor;       
    6::186     1e-41  43%  186 aa  RRF_BURPS RecName: Full=Ribosome-recycling factor;       
    6::186     1e-41  43%  186 aa  RRF_BURP6 RecName: Full=Ribosome-recycling factor;       
    6::186     1e-41  43%  186 aa  RRF_BURP1 RecName: Full=Ribosome-recycling factor;       
    6::186     1e-41  43%  186 aa  RRF_BURP0 RecName: Full=Ribosome-recycling factor;       
    6::186     1e-41  43%  186 aa  RRF_BURMS RecName: Full=Ribosome-recycling factor;       
    6::186     1e-41  43%  186 aa  RRF_BURMA RecName: Full=Ribosome-recycling factor;       
    6::186     1e-41  43%  186 aa  RRF_BURM9 RecName: Full=Ribosome-recycling factor;       
    6::186     1e-41  43%  186 aa  RRF_BURM7 RecName: Full=Ribosome-recycling factor;       
   10::185     1e-41  45%  185 aa  RRF_AZOSE RecName: Full=Ribosome-recycling factor;       
    4::182     2e-41  46%  182 aa  RRF_PROMS RecName: Full=Ribosome-recycling factor;       
   10::186     2e-41  45%  186 aa  RRF_BURXL RecName: Full=Ribosome-recycling factor;       
    6::186     2e-41  46%  186 aa  RRF_BORPD RecName: Full=Ribosome-recycling factor;       
    6::186     2e-41  46%  186 aa  RRF_BORA1 RecName: Full=Ribosome-recycling factor;       
    1::184     2e-41  45%  184 aa  RRF_ACIBY RecName: Full=Ribosome-recycling factor;       
    1::184     2e-41  45%  184 aa  RRF_ACIBT RecName: Full=Ribosome-recycling factor;       
    1::184     2e-41  45%  184 aa  RRF_ACIB5 RecName: Full=Ribosome-recycling factor;       
    1::184     2e-41  45%  184 aa  RRF_ACIB3 RecName: Full=Ribosome-recycling factor;       
   11::186     2e-41  45%  186 aa  RRF_RICFE RecName: Full=Ribosome-recycling factor;       
    6::186     2e-41  43%  186 aa  RRF_POLNA RecName: Full=Ribosome-recycling factor;       
    8::187     2e-41  44%  187 aa  RRF_PARL1 RecName: Full=Ribosome-recycling factor;       
    3::184     2e-41  42%  184 aa  RRF_LEPIN RecName: Full=Ribosome-recycling factor;       
    3::184     2e-41  42%  184 aa  RRF_LEPIC RecName: Full=Ribosome-recycling factor;       
    8::187     2e-41  43%  187 aa  RRF_FLAJ1 RecName: Full=Ribosome-recycling factor;       
   11::182     2e-41  45%  183 aa  RRF_DEIDV RecName: Full=Ribosome-recycling factor;       
    1::185     2e-41  44%  185 aa  RRF_BEUC1 RecName: Full=Ribosome-recycling factor;       
    1::184     2e-41  45%  184 aa  RRF_ACIBS RecName: Full=Ribosome-recycling factor;       
   84::247     2e-41  48%  266 aa  RRFC_ORYSJ RecName: Full=Ribosome-recycling factor, chloroplastic; 
   84::247     2e-41  48%  266 aa  RRFC_ORYSI RecName: Full=Ribosome-recycling factor, chloroplastic; 
    1::185     3e-41  43%  185 aa  RRF_SYNFM RecName: Full=Ribosome-recycling factor;       
    5::185     3e-41  47%  185 aa  RRF_NITMU RecName: Full=Ribosome-recycling factor;       
    1::185     3e-41  44%  185 aa  RRF_CHRVO RecName: Full=Ribosome-recycling factor;       
    7::186     3e-41  46%  186 aa  RRF_BEII9 RecName: Full=Ribosome-recycling factor;       
   10::186     4e-41  45%  186 aa  RRF_UNCTG RecName: Full=Ribosome-recycling factor;       
    8::187     4e-41  43%  187 aa  RRF_FLAPJ RecName: Full=Ribosome-recycling factor;       
    6::186     4e-41  43%  186 aa  RRF_DELAS RecName: Full=Ribosome-recycling factor;       
    1::185     4e-41  44%  185 aa  RRF_CARHZ RecName: Full=Ribosome-recycling factor;       
    8::186     4e-41  46%  186 aa  RRF_BACTN RecName: Full=Ribosome-recycling factor;       
    1::185     4e-41  44%  185 aa  RRF_AERS4 RecName: Full=Ribosome-recycling factor;       
    1::184     5e-41  44%  185 aa  RRF_YERE8 RecName: Full=Ribosome-recycling factor;       
    1::185     5e-41  44%  185 aa  RRF_RUTMC RecName: Full=Ribosome-recycling factor;       
    6::186     5e-41  43%  186 aa  RRF_RALSO RecName: Full=Ribosome-recycling factor;       
    1::184     5e-41  43%  184 aa  RRF_PSYA2 RecName: Full=Ribosome-recycling factor;       
    3::182     5e-41  43%  182 aa  RRF_MICAN RecName: Full=Ribosome-recycling factor;       
    8::169     5e-41  48%  185 aa  RRF_KINRD RecName: Full=Ribosome-recycling factor;       
    1::185     5e-41  45%  185 aa  RRF_DICNV RecName: Full=Ribosome-recycling factor;       
    1::184     5e-41  46%  184 aa  RRF_BIFA0 RecName: Full=Ribosome-recycling factor;       
    4::186     5e-41  45%  186 aa  RRF_BACV8 RecName: Full=Ribosome-recycling factor;       
    6::185     7e-41  43%  186 aa  RRF_RHOBA RecName: Full=Ribosome-recycling factor;       
    4::182     7e-41  45%  182 aa  RRF_PROM9 RecName: Full=Ribosome-recycling factor;       
   11::186     7e-41  44%  186 aa  RRF_BURS3 RecName: Full=Ribosome-recycling factor;       
   10::188     9e-41  42%  188 aa  RRF_RHOS5 RecName: Full=Ribosome-recycling factor;       
    8::187     9e-41  44%  187 aa  RRF_RHOPS RecName: Full=Ribosome-recycling factor;       
    1::185     9e-41  43%  185 aa  RRF_PSEFS RecName: Full=Ribosome-recycling factor;       
    4::182     9e-41  46%  182 aa  RRF_PROM5 RecName: Full=Ribosome-recycling factor;       
    1::171     9e-41  49%  185 aa  RRF_PHOPR RecName: Full=Ribosome-recycling factor;       
    1::168     9e-41  46%  185 aa  RRF_MYXXD RecName: Full=Ribosome-recycling factor;       
   12::182     9e-41  43%  183 aa  RRF_DEIRA RecName: Full=Ribosome-recycling factor;       
    1::185     9e-41  40%  185 aa  RRF_CAMFF RecName: Full=Ribosome-recycling factor;       
   11::186     9e-41  44%  186 aa  RRF_BURM1 RecName: Full=Ribosome-recycling factor;       
    7::186     9e-41  41%  186 aa  RRF_BRUSU RecName: Full=Ribosome-recycling factor;       
    7::186     9e-41  41%  186 aa  RRF_BRUSI RecName: Full=Ribosome-recycling factor;       
    7::186     9e-41  41%  186 aa  RRF_BRUO2 RecName: Full=Ribosome-recycling factor;       
    7::186     9e-41  41%  186 aa  RRF_BRUC2 RecName: Full=Ribosome-recycling factor;       
    7::186     9e-41  41%  186 aa  RRF_BRUAB RecName: Full=Ribosome-recycling factor;       
    7::186     9e-41  41%  186 aa  RRF_BRUA2 RecName: Full=Ribosome-recycling factor;       
    7::186     9e-41  41%  186 aa  RRF_BRUA1 RecName: Full=Ribosome-recycling factor;       
   11::186     1e-40  44%  186 aa  RRF_RICPU RecName: Full=Ribosome-recycling factor;       
    1::185     1e-40  46%  185 aa  RRF_PSEA6 RecName: Full=Ribosome-recycling factor;       
    7::186     1e-40  41%  186 aa  RRF_BRUME RecName: Full=Ribosome-recycling factor;       
    7::186     1e-40  41%  186 aa  RRF_BRUMB RecName: Full=Ribosome-recycling factor;       
    1::185     2e-40  41%  185 aa  RRF_SORC5 RecName: Full=Ribosome-recycling factor;       
    1::185     2e-40  44%  185 aa  RRF_SODGM RecName: Full=Ribosome-recycling factor;       
   10::188     2e-40  41%  188 aa  RRF_RHOSK RecName: Full=Ribosome-recycling factor;       
   10::188     2e-40  41%  188 aa  RRF_RHOS1 RecName: Full=Ribosome-recycling factor;       
    8::186     2e-40  42%  186 aa  RRF_RALME RecName: Full=Ribosome-recycling factor;       
    8::186     2e-40  44%  186 aa  RRF_RALEH RecName: Full=Ribosome-recycling factor;       
    1::184     2e-40  40%  185 aa  RRF_KOSOT RecName: Full=Ribosome-recycling factor;       
    7::186     2e-40  45%  186 aa  RRF_BACFR RecName: Full=Ribosome-recycling factor;       
    7::186     2e-40  45%  186 aa  RRF_BACFN RecName: Full=Ribosome-recycling factor;       
   10::188     2e-40  41%  188 aa  RRF_RHOS4 RecName: Full=Ribosome-recycling factor;       
    8::187     2e-40  43%  187 aa  RRF_RHOP2 RecName: Full=Ribosome-recycling factor;       
   10::184     2e-40  43%  184 aa  RRF_BORT9 RecName: Full=Ribosome-recycling factor;       
    8::172     2e-40  48%  185 aa  RRF_ARTCA RecName: Full=Ribosome-recycling factor;       
    1::185     2e-40  41%  185 aa  RRF_AGRT5 RecName: Full=Ribosome-recycling factor;       
    7::186     2e-40  42%  186 aa  RRF_AGRRK RecName: Full=Ribosome-recycling factor;       
   13::186     3e-40  44%  186 aa  RRF_RICM5 RecName: Full=Ribosome-recycling factor;       
    1::184     3e-40  42%  184 aa  RRF_PSYCK RecName: Full=Ribosome-recycling factor;       
   11::186     3e-40  44%  186 aa  RRF_RICCN RecName: Full=Ribosome-recycling factor;       
   11::186     3e-40  44%  186 aa  RRF_RICCK RecName: Full=Ribosome-recycling factor;       
   13::186     3e-40  45%  186 aa  RRF_RHOFD RecName: Full=Ribosome-recycling factor;       
    8::186     3e-40  43%  186 aa  RRF_RALEJ RecName: Full=Ribosome-recycling factor;       
   11::186     3e-40  43%  186 aa  RRF_METSB RecName: Full=Ribosome-recycling factor;       
   11::186     3e-40  43%  186 aa  RRF_METPP RecName: Full=Ribosome-recycling factor;       
    1::185     3e-40  42%  185 aa  RRF_GEOSF RecName: Full=Ribosome-recycling factor;       
    4::184     5e-40  40%  184 aa  RRF_DESMR RecName: Full=Ribosome-recycling factor;       
   11::186     6e-40  44%  186 aa  RRF_RICAE RecName: Full=Ribosome-recycling factor;       
   10::165     6e-40  48%  186 aa  RRF_POLNS RecName: Full=Ribosome-recycling factor;       
    3::186     6e-40  42%  186 aa  RRF_AGRVS RecName: Full=Ribosome-recycling factor;       
  100::275     6e-40  45%  275 aa  RRFC_ARATH RecName: Full=Ribosome-recycling factor, chloroplastic; 
    4::186     8e-40  38%  186 aa  RRF_WOLSU RecName: Full=Ribosome-recycling factor;       
   11::186     8e-40  44%  186 aa  RRF_RICRS RecName: Full=Ribosome-recycling factor;       
   11::186     8e-40  44%  186 aa  RRF_RICRO RecName: Full=Ribosome-recycling factor;       
    1::185     8e-40  44%  185 aa  RRF_FRATW RecName: Full=Ribosome-recycling factor;       
    1::185     8e-40  44%  185 aa  RRF_FRATO RecName: Full=Ribosome-recycling factor;       
    1::185     8e-40  44%  185 aa  RRF_FRATN RecName: Full=Ribosome-recycling factor;       
    1::185     8e-40  44%  185 aa  RRF_FRATM RecName: Full=Ribosome-recycling factor;       
    1::185     8e-40  44%  185 aa  RRF_FRATH RecName: Full=Ribosome-recycling factor;       
    1::185     8e-40  44%  185 aa  RRF_FRATF RecName: Full=Ribosome-recycling factor;       
    6::185     8e-40  44%  185 aa  RRF_CLAMS RecName: Full=Ribosome-recycling factor;       
    6::185     8e-40  44%  185 aa  RRF_CLAM3 RecName: Full=Ribosome-recycling factor;       
   11::186     1e-39  44%  186 aa  RRF_RICAH RecName: Full=Ribosome-recycling factor;       
    1::185     1e-39  41%  185 aa  RRF_GEOSL RecName: Full=Ribosome-recycling factor;       
    1::185     1e-39  44%  185 aa  RRF_FRATT RecName: Full=Ribosome-recycling factor;       
    1::185     1e-39  44%  185 aa  RRF_FRAT1 RecName: Full=Ribosome-recycling factor;       
   10::168     1e-39  46%  185 aa  RRF_ERYLH RecName: Full=Ribosome-recycling factor;       
    6::186     1e-39  43%  186 aa  RRF_DIAST RecName: Full=Ribosome-recycling factor;       
    6::186     1e-39  43%  186 aa  RRF_BARQU RecName: Full=Ribosome-recycling factor;       
    6::186     1e-39  43%  186 aa  RRF_ACISJ RecName: Full=Ribosome-recycling factor;       
    6::186     1e-39  44%  186 aa  RRF_ACIAC RecName: Full=Ribosome-recycling factor;       
   11::186     1e-39  43%  186 aa  RRF_RICPR RecName: Full=Ribosome-recycling factor;       
    8::186     1e-39  41%  186 aa  RRF_AMOA5 RecName: Full=Ribosome-recycling factor;       
    1::168     1e-39  47%  185 aa  RRF_ALCBS RecName: Full=Ribosome-recycling factor;       
    1::184     2e-39  50%  184 aa  RRF_STRM5 RecName: Full=Ribosome-recycling factor;       
    7::186     2e-39  41%  186 aa  RRF_OCHA4 RecName: Full=Ribosome-recycling factor;       
    1::184     2e-39  42%  185 aa  RRF_BAUCH RecName: Full=Ribosome-recycling factor;       
    7::186     2e-39  41%  186 aa  RRF_RHIEC RecName: Full=Ribosome-recycling factor;       
    7::186     2e-39  41%  186 aa  RRF_RHIE6 RecName: Full=Ribosome-recycling factor;       
    6::186     2e-39  43%  186 aa  RRF_BART1 RecName: Full=Ribosome-recycling factor;       
    8::172     3e-39  45%  185 aa  RRF_RENSM RecName: Full=Ribosome-recycling factor;       
    8::186     3e-39  41%  186 aa  RRF_POLSJ RecName: Full=Ribosome-recycling factor;       
   10::164     3e-39  48%  185 aa  RRF_NOVAD RecName: Full=Ribosome-recycling factor;       
    9::185     3e-39  41%  185 aa  RRF_FRAAA RecName: Full=Ribosome-recycling factor;       
   10::183     3e-39  43%  184 aa  RRF_BORHD RecName: Full=Ribosome-recycling factor;       
   13::187     4e-39  43%  187 aa  RRF_ROSDO RecName: Full=Ribosome-recycling factor;       
    1::185     4e-39  45%  185 aa  RRF_PSEPG RecName: Full=Ribosome-recycling factor;       
    1::182     4e-39  42%  182 aa  RRF_PROM4 RecName: Full=Ribosome-recycling factor;       
   14::188     4e-39  43%  188 aa  RRF_DINSH RecName: Full=Ribosome-recycling factor;       
    7::183     5e-39  44%  183 aa  RRF_GRAFK RecName: Full=Ribosome-recycling factor;       
   10::184     5e-39  42%  184 aa  RRF_BORRA RecName: Full=Ribosome-recycling factor;       
   10::184     5e-39  42%  184 aa  RRF_BORDL RecName: Full=Ribosome-recycling factor;       
    6::186     5e-39  43%  186 aa  RRF_BARHE RecName: Full=Ribosome-recycling factor;       
    8::185     5e-39  44%  185 aa  RRF_ARTS2 RecName: Full=Ribosome-recycling factor;       
    7::186     7e-39  41%  186 aa  RRF_RHILW RecName: Full=Ribosome-recycling factor;       
    5::185     7e-39  43%  185 aa  RRF_NITEC RecName: Full=Ribosome-recycling factor;       
    5::187     7e-39  43%  187 aa  RRF_BRASB RecName: Full=Ribosome-recycling factor;       
    1::161     9e-39  43%  185 aa  RRF_THELT RecName: Full=Ribosome-recycling factor;       
    1::185     9e-39  37%  185 aa  RRF_SULNB RecName: Full=Ribosome-recycling factor;       
    1::165     9e-39  44%  185 aa  RRF_SHEAM RecName: Full=Ribosome-recycling factor;       
    9::189     9e-39  39%  189 aa  RRF_SALRD RecName: Full=Ribosome-recycling factor;       
   11::186     9e-39  42%  186 aa  RRF_RICTY RecName: Full=Ribosome-recycling factor;       
    5::186     9e-39  41%  186 aa  RRF_RHISN RecName: Full=Ribosome-recycling factor;       
    1::185     1e-38  41%  185 aa  RRF_SACEN RecName: Full=Ribosome-recycling factor;       
    7::186     1e-38  42%  186 aa  RRF_RHIL3 RecName: Full=Ribosome-recycling factor;       
   23::172     1e-38  46%  185 aa  RRF_STRCO RecName: Full=Ribosome-recycling factor;       
    1::185     1e-38  45%  185 aa  RRF_PSEE4 RecName: Full=Ribosome-recycling factor;       
    4::182     1e-38  45%  182 aa  RRF_PROM2 RecName: Full=Ribosome-recycling factor;       
    1::185     2e-38  44%  185 aa  RRF_PSEPK RecName: Full=Ribosome-recycling factor;       
    1::185     2e-38  44%  185 aa  RRF_PSEP1 RecName: Full=Ribosome-recycling factor;       
    4::182     2e-38  45%  182 aa  RRF_PROMP RecName: Full=Ribosome-recycling factor;       
    1::184     2e-38  41%  185 aa  RRF_PECCP RecName: Full=Ribosome-recycling factor;       
    1::185     2e-38  39%  185 aa  RRF_HELAH RecName: Full=Ribosome-recycling factor;       
   38::188     2e-38  46%  188 aa  RRF_GLUOX RecName: Full=Ribosome-recycling factor;       
    9::184     2e-38  41%  185 aa  RRF_THET8 RecName: Full=Ribosome-recycling factor;       
    9::184     2e-38  41%  185 aa  RRF_THET2 RecName: Full=Ribosome-recycling factor;       
    1::185     2e-38  42%  185 aa  RRF_NEIG1 RecName: Full=Ribosome-recycling factor;       
    6::186     2e-38  43%  186 aa  RRF_CHLTE RecName: Full=Ribosome-recycling factor;       
    1::185     2e-38  38%  185 aa  RRF_ARCB4 RecName: Full=Ribosome-recycling factor;       
    1::184     3e-38  49%  184 aa  RRF_STRMK RecName: Full=Ribosome-recycling factor;       
   10::163     3e-38  47%  184 aa  RRF_SPHAL RecName: Full=Ribosome-recycling factor;       
   13::187     3e-38  42%  187 aa  RRF_SILPO RecName: Full=Ribosome-recycling factor;       
    8::187     3e-38  43%  187 aa  RRF_RHOP5 RecName: Full=Ribosome-recycling factor;       
   28::165     3e-38  51%  186 aa  RRF_POLSQ RecName: Full=Ribosome-recycling factor;       
    1::185     4e-38  38%  185 aa  RRF_HELPY RecName: Full=Ribosome-recycling factor;       
    1::185     4e-38  38%  185 aa  RRF_HELP2 RecName: Full=Ribosome-recycling factor;       
    1::185     4e-38  43%  185 aa  RRF_AZOVD RecName: Full=Ribosome-recycling factor;       
    6::184     7e-38  42%  186 aa  RRF_VEREI RecName: Full=Ribosome-recycling factor;       
    9::183     7e-38  42%  183 aa  RRF_UREU1 RecName: Full=Ribosome-recycling factor;       
    1::185     7e-38  44%  185 aa  RRF_PSEPW RecName: Full=Ribosome-recycling factor;       
    1::185     7e-38  41%  185 aa  RRF_NEIMF RecName: Full=Ribosome-recycling factor;       
    1::185     7e-38  41%  185 aa  RRF_NEIMB RecName: Full=Ribosome-recycling factor;       
    1::185     7e-38  41%  185 aa  RRF_NEIMA RecName: Full=Ribosome-recycling factor;       
    1::172     7e-38  44%  183 aa  RRF_LEPBP RecName: Full=Ribosome-recycling factor;       
    1::172     7e-38  44%  183 aa  RRF_LEPBA RecName: Full=Ribosome-recycling factor;       
    1::185     7e-38  38%  185 aa  RRF_HELPH RecName: Full=Ribosome-recycling factor;       
    6::188     7e-38  43%  188 aa  RRF_BRAJA RecName: Full=Ribosome-recycling factor;       
    6::186     9e-38  40%  186 aa  RRF_PELPB RecName: Full=Ribosome-recycling factor;       
    7::185     9e-38  41%  185 aa  RRF_NITEU RecName: Full=Ribosome-recycling factor;       
    1::185     9e-38  41%  185 aa  RRF_NEIM0 RecName: Full=Ribosome-recycling factor;       
    1::185     9e-38  38%  185 aa  RRF_CAMHC RecName: Full=Ribosome-recycling factor;       
    1::185     1e-37  38%  185 aa  RRF_HELPG RecName: Full=Ribosome-recycling factor;       
    1::185     2e-37  42%  185 aa  RRF_SYNWW RecName: Full=Ribosome-recycling factor;       
    1::185     2e-37  42%  185 aa  RRF_ALHEH RecName: Full=Ribosome-recycling factor;       
   10::172     2e-37  44%  185 aa  RRF_SPHWW RecName: Full=Ribosome-recycling factor;       
    1::185     2e-37  42%  185 aa  RRF_PSEMY RecName: Full=Ribosome-recycling factor;       
    1::185     2e-37  38%  185 aa  RRF_HELPS RecName: Full=Ribosome-recycling factor;       
    1::185     3e-37  38%  185 aa  RRF_HELPJ RecName: Full=Ribosome-recycling factor;       
    1::185     3e-37  44%  185 aa  RRF_CHRSD RecName: Full=Ribosome-recycling factor;       
    1::184     4e-37  41%  185 aa  RRF_ERWT9 RecName: Full=Ribosome-recycling factor;       
   15::187     5e-37  41%  187 aa  RRF_PARZE RecName: Full=Ribosome-recycling factor;       
   10::173     5e-37  45%  186 aa  RRF_JANMA RecName: Full=Ribosome-recycling factor;       
   13::187     6e-37  41%  187 aa  RRF_SILST RecName: Full=Ribosome-recycling factor;       
    1::184     8e-37  42%  185 aa  RRF_SERP5 RecName: Full=Ribosome-recycling factor;       
    9::184     8e-37  39%  184 aa  RRF_RHILO RecName: Full=Ribosome-recycling factor;       
    1::185     8e-37  42%  185 aa  RRF_PSEPF RecName: Full=Ribosome-recycling factor;       
    1::185     8e-37  41%  185 aa  RRF_MARMS RecName: Full=Ribosome-recycling factor;       
    1::185     8e-37  40%  185 aa  RRF_EHRCJ RecName: Full=Ribosome-recycling factor;       
    1::185     1e-36  39%  185 aa  RRF_SACD2 RecName: Full=Ribosome-recycling factor;       
    6::186     1e-36  41%  186 aa  RRF_CHLPB RecName: Full=Ribosome-recycling factor;       
    1::185     1e-36  41%  185 aa  RRF_EHRRG RecName: Full=Ribosome-recycling factor;       
    6::186     1e-36  40%  186 aa  RRF_CHLP8 RecName: Full=Ribosome-recycling factor;       
    9::183     2e-36  42%  183 aa  RRF_UREPA RecName: Full=Ribosome-recycling factor;       
    9::183     2e-36  42%  183 aa  RRF_UREP2 RecName: Full=Ribosome-recycling factor;       
    6::186     2e-36  39%  186 aa  RRF_CHLPD RecName: Full=Ribosome-recycling factor;       
    1::172     2e-36  43%  185 aa  RRF_AERHH RecName: Full=Ribosome-recycling factor;       
    1::183     2e-36  40%  185 aa  RRF_WOLTR RecName: Full=Ribosome-recycling factor;       
   12::187     3e-36  39%  187 aa  RRF_METPB RecName: Full=Ribosome-recycling factor;       
   23::172     4e-36  44%  185 aa  RRF_STRAW RecName: Full=Ribosome-recycling factor;       
    1::185     4e-36  41%  185 aa  RRF_EHRRW RecName: Full=Ribosome-recycling factor;       
    7::186     4e-36  39%  186 aa  RRF_AZOC5 RecName: Full=Ribosome-recycling factor;       
    3::186     5e-36  39%  186 aa  RRF_PROA2 RecName: Full=Ribosome-recycling factor;       
    6::186     7e-36  39%  186 aa  RRF_PELLD RecName: Full=Ribosome-recycling factor;       
    1::185     7e-36  40%  185 aa  RRF_NEOSM RecName: Full=Ribosome-recycling factor;       
   12::187     7e-36  39%  187 aa  RRF_METEP RecName: Full=Ribosome-recycling factor;       
   12::187     7e-36  39%  187 aa  RRF_METC4 RecName: Full=Ribosome-recycling factor;       
    1::183     7e-36  40%  185 aa  RRF_KOCRD RecName: Full=Ribosome-recycling factor;       
    1::185     9e-36  37%  185 aa  RRF_SULDN RecName: Full=Ribosome-recycling factor;       
    1::181     9e-36  38%  182 aa  RRF_HYDS0 RecName: Full=Ribosome-recycling factor;       
    1::185     1e-35  38%  185 aa  RRF_EHRCR RecName: Full=Ribosome-recycling factor;       
    3::187     1e-35  38%  187 aa  RRF_ANADF RecName: Full=Ribosome-recycling factor;       
    6::186     2e-35  39%  186 aa  RRF_PROVI RecName: Full=Ribosome-recycling factor;       
    4::183     2e-35  42%  184 aa  RRF_ONYPE RecName: Full=Ribosome-recycling factor;       
    8::141     2e-35  50%  185 aa  RRF_ARTAT RecName: Full=Ribosome-recycling factor;       
    6::186     2e-35  39%  186 aa  RRF_CHLL2 RecName: Full=Ribosome-recycling factor;       
   23::172     3e-35  43%  185 aa  RRF_THEFY RecName: Full=Ribosome-recycling factor;       
    1::185     3e-35  40%  185 aa  RRF_LARHH RecName: Full=Ribosome-recycling factor;       
    1::185     3e-35  38%  185 aa  RRF_HALOH RecName: Full=Ribosome-recycling factor;       
    1::185     3e-35  39%  185 aa  RRF_PSEU2 RecName: Full=Ribosome-recycling factor;       
    1::185     3e-35  39%  185 aa  RRF_PSE14 RecName: Full=Ribosome-recycling factor;       
    7::173     3e-35  43%  186 aa  RRF_LEIXX RecName: Full=Ribosome-recycling factor;       
    5::181     3e-35  42%  184 aa  RRF_AYWBP RecName: Full=Ribosome-recycling factor;       
   10::166     4e-35  43%  186 aa  RRF_HERAR RecName: Full=Ribosome-recycling factor;       
    1::185     6e-35  39%  185 aa  RRF_PSESM RecName: Full=Ribosome-recycling factor;       
    1::184     7e-35  40%  185 aa  RRF_KLEP3 RecName: Full=Ribosome-recycling factor;       
   27::181     1e-34  45%  184 aa  RRF_NATTJ RecName: Full=Ribosome-recycling factor;       
    1::185     1e-34  38%  185 aa  RRF_FRAP2 RecName: Full=Ribosome-recycling factor;       
    5::167     1e-34  41%  186 aa  RRF_CYTH3 RecName: Full=Ribosome-recycling factor;       
    1::185     4e-34  39%  185 aa  RRF_PSEF5 RecName: Full=Ribosome-recycling factor;       
    1::184     5e-34  40%  185 aa  RRF_SHISS RecName: Full=Ribosome-recycling factor;       
    1::184     5e-34  40%  185 aa  RRF_SHIFL RecName: Full=Ribosome-recycling factor;       
    1::184     5e-34  40%  185 aa  RRF_SHIF8 RecName: Full=Ribosome-recycling factor;       
    1::184     5e-34  40%  185 aa  RRF_SHIDS RecName: Full=Ribosome-recycling factor;       
    1::184     5e-34  40%  185 aa  RRF_SHIBS RecName: Full=Ribosome-recycling factor;       
    1::184     5e-34  40%  185 aa  RRF_SHIB3 RecName: Full=Ribosome-recycling factor;       
    1::173     5e-34  40%  186 aa  RRF_RUBXD RecName: Full=Ribosome-recycling factor;       
    1::184     5e-34  40%  185 aa  RRF_ESCF3 RecName: Full=Ribosome-recycling factor;       
    1::184     5e-34  40%  185 aa  RRF_ECOUT RecName: Full=Ribosome-recycling factor;       
    1::184     5e-34  40%  185 aa  RRF_ECOSM RecName: Full=Ribosome-recycling factor;       
    1::184     5e-34  40%  185 aa  RRF_ECOSE RecName: Full=Ribosome-recycling factor;       
    1::184     5e-34  40%  185 aa  RRF_ECOLU RecName: Full=Ribosome-recycling factor;       
    1::184     5e-34  40%  185 aa  RRF_ECOLI RecName: Full=Ribosome-recycling factor;       
    1::184     5e-34  40%  185 aa  RRF_ECOLC RecName: Full=Ribosome-recycling factor;       
    1::184     5e-34  40%  185 aa  RRF_ECOL6 RecName: Full=Ribosome-recycling factor;       
    1::184     5e-34  40%  185 aa  RRF_ECOL5 RecName: Full=Ribosome-recycling factor;       
    1::184     5e-34  40%  185 aa  RRF_ECOHS RecName: Full=Ribosome-recycling factor;       
    1::184     5e-34  40%  185 aa  RRF_ECODH RecName: Full=Ribosome-recycling factor;       
    1::184     5e-34  40%  185 aa  RRF_ECOBW RecName: Full=Ribosome-recycling factor;       
    1::184     5e-34  40%  185 aa  RRF_ECO8A RecName: Full=Ribosome-recycling factor;       
    1::184     5e-34  40%  185 aa  RRF_ECO81 RecName: Full=Ribosome-recycling factor;       
    1::184     5e-34  40%  185 aa  RRF_ECO7I RecName: Full=Ribosome-recycling factor;       
    1::184     5e-34  40%  185 aa  RRF_ECO5E RecName: Full=Ribosome-recycling factor;       
    1::184     5e-34  40%  185 aa  RRF_ECO57 RecName: Full=Ribosome-recycling factor;       
    1::184     5e-34  40%  185 aa  RRF_ECO55 RecName: Full=Ribosome-recycling factor;       
    1::184     5e-34  40%  185 aa  RRF_ECO45 RecName: Full=Ribosome-recycling factor;       
    1::184     5e-34  40%  185 aa  RRF_ECO27 RecName: Full=Ribosome-recycling factor;       
    1::184     5e-34  40%  185 aa  RRF_ECO24 RecName: Full=Ribosome-recycling factor;       
    9::184     1e-33  40%  184 aa  RRF_HYPNA RecName: Full=Ribosome-recycling factor;       
   16::187     1e-33  40%  188 aa  RRF_BLOPB RecName: Full=Ribosome-recycling factor;       
    3::187     2e-33  37%  187 aa  RRF_NITOC RecName: Full=Ribosome-recycling factor;       
    5::132     2e-33  50%  181 aa  RRF_LEUMM RecName: Full=Ribosome-recycling factor;       
    8::185     2e-33  38%  185 aa  RRF_FRASN RecName: Full=Ribosome-recycling factor;       
    8::185     2e-33  38%  185 aa  RRF_FRASC RecName: Full=Ribosome-recycling factor;       
    1::185     2e-33  38%  185 aa  RRF_BUCCC RecName: Full=Ribosome-recycling factor;       
    2::184     3e-33  40%  184 aa  RRF_CLOPH RecName: Full=Ribosome-recycling factor;       
    1::185     4e-33  38%  185 aa  RRF_VESOH RecName: Full=Ribosome-recycling factor;       
    1::184     4e-33  38%  185 aa  RRF_SALTY RecName: Full=Ribosome-recycling factor;       
    1::184     4e-33  38%  185 aa  RRF_SALTI RecName: Full=Ribosome-recycling factor;       
    1::184     4e-33  38%  185 aa  RRF_SALSV RecName: Full=Ribosome-recycling factor;       
    1::184     4e-33  38%  185 aa  RRF_SALPC RecName: Full=Ribosome-recycling factor;       
    1::184     4e-33  38%  185 aa  RRF_SALPB RecName: Full=Ribosome-recycling factor;       
    1::184     4e-33  38%  185 aa  RRF_SALNS RecName: Full=Ribosome-recycling factor;       
    1::184     4e-33  38%  185 aa  RRF_SALHS RecName: Full=Ribosome-recycling factor;       
    1::184     4e-33  38%  185 aa  RRF_SALG2 RecName: Full=Ribosome-recycling factor;       
    1::184     4e-33  38%  185 aa  RRF_SALEP RecName: Full=Ribosome-recycling factor;       
    1::184     4e-33  38%  185 aa  RRF_SALDC RecName: Full=Ribosome-recycling factor;       
    1::184     4e-33  38%  185 aa  RRF_SALCH RecName: Full=Ribosome-recycling factor;       
    1::184     4e-33  38%  185 aa  RRF_SALAR RecName: Full=Ribosome-recycling factor;       
    1::184     4e-33  38%  185 aa  RRF_SALA4 RecName: Full=Ribosome-recycling factor;       
    3::163     9e-33  42%  183 aa  RRF_PARUW RecName: Full=Ribosome-recycling factor;       
   10::164     2e-32  47%  184 aa  RRF_PHYAS RecName: Full=Ribosome-recycling factor;       
    6::186     2e-32  37%  186 aa  RRF_CHLCH RecName: Full=Ribosome-recycling factor;       
    1::184     2e-32  38%  185 aa  RRF_BUCAP RecName: Full=Ribosome-recycling factor;       
    1::183     3e-32  38%  185 aa  RRF_WOLPP RecName: Full=Ribosome-recycling factor;       
    1::171     3e-32  41%  185 aa  RRF_PSYIN RecName: Full=Ribosome-recycling factor;       
    6::186     3e-32  37%  186 aa  RRF_BARBK RecName: Full=Ribosome-recycling factor;       
    9::186     3e-32  35%  187 aa  RRF_PETMO RecName: Full=Ribosome-recycling factor;       
    3::180     3e-32  35%  180 aa  RRF_CHLAB RecName: Full=Ribosome-recycling factor;       
    8::183     5e-32  42%  183 aa  RRF_OLICO RecName: Full=Ribosome-recycling factor;       
   12::187     5e-32  36%  187 aa  RRF_METRJ RecName: Full=Ribosome-recycling factor;       
    1::184     5e-32  37%  185 aa  RRF_BUCAT RecName: Full=Ribosome-recycling factor;       
    1::184     5e-32  37%  185 aa  RRF_BUCA5 RecName: Full=Ribosome-recycling factor;       
    1::184     6e-32  38%  185 aa  RRF_SALPK RecName: Full=Ribosome-recycling factor;       
    1::184     6e-32  38%  185 aa  RRF_SALPA RecName: Full=Ribosome-recycling factor;       
   23::188     6e-32  43%  188 aa  RRF_AKKM8 RecName: Full=Ribosome-recycling factor;       
    1::184     8e-32  37%  185 aa  RRF_BUCAI RecName: Full=Ribosome-recycling factor;       
    3::180     1e-31  34%  180 aa  RRF_CHLFF RecName: Full=Ribosome-recycling factor;       
    8::180     1e-31  35%  180 aa  RRF_CHLCV RecName: Full=Ribosome-recycling factor;       
    1::167     1e-31  40%  184 aa  RRF_FERNB RecName: Full=Ribosome-recycling factor;       
   13::184     3e-31  38%  184 aa  RRF_JANSC RecName: Full=Ribosome-recycling factor;       
   24::186     4e-31  36%  186 aa  RRF_MESSB RecName: Full=Ribosome-recycling factor;       
   13::188     7e-31  38%  188 aa  RRF_ACICJ RecName: Full=Ribosome-recycling factor;       
   21::183     9e-31  40%  183 aa  RRF_MYCPE RecName: Full=Ribosome-recycling factor;       
    4::183     1e-30  36%  183 aa  RRF_MYCMO RecName: Full=Ribosome-recycling factor;       
    1::182     2e-30  35%  182 aa  RRF_MYCMS RecName: Full=Ribosome-recycling factor;       
   13::187     2e-30  35%  187 aa  RRF_PARDP RecName: Full=Ribosome-recycling factor;       
   23::186     4e-30  37%  186 aa  RRF_METI4 RecName: Full=Ribosome-recycling factor;       
    1::182     6e-30  35%  182 aa  RRF_MYCCT RecName: Full=Ribosome-recycling factor;       
   11::181     7e-30  39%  181 aa  RRF_TROWT RecName: Full=Ribosome-recycling factor;       
   11::181     7e-30  39%  181 aa  RRF_TROW8 RecName: Full=Ribosome-recycling factor;       
    3::180     9e-30  34%  180 aa  RRF_CHLPN RecName: Full=Ribosome-recycling factor;       
    1::164     1e-28  38%  185 aa  RRF_ENT38 RecName: Full=Ribosome-recycling factor;       
    3::159     2e-28  38%  179 aa  RRF_CHLTA RecName: Full=Ribosome-recycling factor;       
    3::179     4e-28  34%  179 aa  RRF_CHLMU RecName: Full=Ribosome-recycling factor;       
    1::169     7e-28  35%  185 aa  RRF_WIGBR RecName: Full=Ribosome-recycling factor;       
   12::187     7e-28  34%  187 aa  RRF_METS4 RecName: Full=Ribosome-recycling factor;       
   12::187     3e-27  32%  187 aa  RRF_METNO RecName: Full=Ribosome-recycling factor;       
   30::168     4e-27  41%  188 aa  RRF_BLOFL RecName: Full=Ribosome-recycling factor;       
    6::185     6e-27  30%  186 aa  RRF_COPPD RecName: Full=Ribosome-recycling factor;       
    6::166     1e-26  36%  187 aa  RRF_ORITI RecName: Full=Ribosome-recycling factor;       
    6::166     2e-26  36%  187 aa  RRF_ORITB RecName: Full=Ribosome-recycling factor;       
    7::187     5e-26  32%  187 aa  RRF_MYCPU RecName: Full=Ribosome-recycling factor;       
   24::183     5e-26  38%  183 aa  RRF_MYCGA RecName: Full=Ribosome-recycling factor;       
    1::185     4e-25  32%  185 aa  RRF_HAMD5 RecName: Full=Ribosome-recycling factor;       
    3::159     9e-25  36%  179 aa  RRF_CHLTB RecName: Full=Ribosome-recycling factor;       
    3::159     9e-25  36%  179 aa  RRF_CHLT2 RecName: Full=Ribosome-recycling factor;       
    3::159     2e-24  36%  179 aa  RRF_CHLTR RecName: Full=Ribosome-recycling factor;       
    1::183     2e-24  33%  185 aa  RRF_WOLPM RecName: Full=Ribosome-recycling factor;       
    7::183     2e-24  34%  183 aa  RRF_MYCGE RecName: Full=Ribosome-recycling factor;       
   11::183     6e-24  30%  183 aa  RRF_BUCBP RecName: Full=Ribosome-recycling factor;       
    1::183     5e-23  31%  185 aa  RRF_WOLWR RecName: Full=Ribosome-recycling factor;       
   11::138     1e-18  35%  184 aa  RRF_MYCPN RecName: Full=Ribosome-recycling factor;       
   85::261     3e-18  31%  262 aa  RRFM_BOVIN RecName: Full=Ribosome-recycling factor, mitochondrial; 
   85::261     5e-18  31%  262 aa  RRFM_HUMAN RecName: Full=Ribosome-recycling factor, mitochondrial; 
   83::261     1e-17  32%  262 aa  RRFM_MOUSE RecName: Full=Ribosome-recycling factor, mitochondrial; 
    8::184     4e-17  26%  184 aa  RRF_AQUAE RecName: Full=Ribosome-recycling factor;       
   83::261     4e-17  31%  262 aa  RRFM_RAT RecName: Full=Ribosome-recycling factor, mitochondrial;   
   50::231     6e-13  25%  233 aa  RRF1_CANGA RecName: Full=Ribosome-recycling factor, mitochondrial; 
   65::239     2e-11  26%  241 aa  RRF1_KLULA RecName: Full=Ribosome-recycling factor, mitochondrial; 
   49::230     3e-11  25%  230 aa  RRF1_YEAST RecName: Full=Ribosome-recycling factor, mitochondrial; 
   83::257     5e-10  25%  257 aa  RRF1_DEBHA RecName: Full=Ribosome-recycling factor, mitochondrial; 
   46::225     2e-09  22%  226 aa  RRF1_ASHGO RecName: Full=Ribosome-recycling factor, mitochondrial; 
   99::242     6e-08  26%  264 aa  RRF1_YARLI RecName: Full=Ribosome-recycling factor, mitochondrial; 
   98::235     1e-07  24%  238 aa  RRFM_CAEEL RecName: Full=Probable ribosome-recycling factor,
  165::258     1e-04  26%  443 aa  HSLU_MARAV RecName: Full=ATP-dependent hsl protease ATP-binding
  308::375     5e-04  32%  587 aa  TRI29_MOUSE RecName: Full=Tripartite motif-containing protein 29;
    7::83      7e-04  32%  183 aa  VATE_METAC RecName: Full=V-type ATP synthase subunit E;AltName:
  297::404     7e-04  28%  419 aa  GLYA_STRU0 RecName: Full=Serine hydroxymethyltransferase;       
  313::363     9e-04  38%  389 aa  ODPA1_ARATH RecName: Full=Pyruvate dehydrogenase E1 component
   69::130     9e-04  43%  155 aa  ATPX_RHDSA RecName: Full=ATP synthase subunit b',
    1::185

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MANVIIEKAKERMTQSHQSLAREFGGIRAGRANASLLDRVHVEYYGVETPLNQIASITIPEARVLLVTPF
RRF_STRZT       MANVIIEKAKERMTQSHQSLAREFGGIRAGRANASLLDRVHVEYYGVETPLNQIASITIPEARVLLVTPF
RRF_STRZJ       MANVIIEKAKERMTQSHQSLAREFGGIRAGRANASLLDRVHVEYYGVETPLNQIASITIPEARVLLVTPF
RRF_STRPJ       MANVIIEKAKERMTQSHQSLAREFGGIRAGRANASLLDRVHVEYYGVETPLNQIASITIPEARVLLVTPF
RRF_STRPI       MANVIIEKAKERMTQSHQSLAREFGGIRAGRANASLLDRVHVEYYGVETPLNQIASITIPEARVLLVTPF
RRF_STRP4       MANVIIEKAKERMTQSHQSLAREFGGIRAGRANASLLDRVHVEYYGVETPLNQIASITIPEARVLLVTPF
RRF_STRR6       MANVIIEKAKERMTQSHQSLAREFGGIRAGRANASLLDRVHVEYYGVETPLNQIASITIPEARVLLVTPF
RRF_STRP2       MANVIIEKAKERMTQSHQSLAREFGGIRAGRANASLLDRVHVEYYGVETPLNQIASITIPEARVLLVTPF
RRF_STRP7       MANAIIEKAKERMTQSHQSLAREFGGIRAGRANASLLDRVHVEYYGVETPLNQIASITIPEARVLLVTPF
RRF_STRPS       MANAIIEKAKERMTQSHQSLAREFGGIRAGRANASLLDRVHVEYYGVETPLNQIASITIPEARVLLVTPF
RRF_STRPN       MANAIIEKAKERMTQSHQSLAREFGGIRAGRANASLLDRVHVEYYGVETPLNQIASITIPEARVLLVTPF
RRF_STRZP       MANAIIEKAKERMTQSHQSLAREFGGIRAGRANASLLDRIHVEYYGVETPLNQIASITIPEARVLLVTPF
RRF_STRSV       MANAIVEKAKERMTHSHQSLAREFGSIRAGRANASLLDRIHVEYYGVETPLNQIASITIPEARVLLVTPF
RRF_STRGC       MANAIVEKAKERMSHSHQNLAREFGAVRAGRANASLLDRISVEYYGVETPLNQIASITIPEARVLLVTPF
RRF_STRMU       MANAIVEKAKERFEQSHQSLAREFGSIRAGRANASLLDRIEVEYYGVPTPLNQLASITVPEARVLLVSPF
RRF_STRPM       MANAIIETAKERFAQSHQSLSREYASIRAGRANASLLDRIQVDYYGAPTPLNQLASITVPEARVLLISPF
RRF_STRA5       MTKEIVTKAQERFEQSHQSLSREFAGIRAGRANASLLDRIQVEYYGAPTPLNQLASITVPEARVLLISPF
RRF_STRA3       MTKEIVTKAQERFEQSHQSLSREFAGIRAGRANASLLDRIQVEYYGAPTPLNQLASITVPEARVLLISPF
RRF_STRA1       MTKEIVTKAQERFEQSHQSLSREFAGIRAGRANASLLDRIQVEYYGAPTPLNQLASITVPEARVLLISPF
RRF_STRPZ       MANAIIETAKERFAQSHQSLSREYASIRAGRANASLLDRIQVDYYGAPTPLNQLASITVPEARVLLISPF
RRF_STRPG       MANAIIETAKERFAQSHQSLSREYASIRAGRANASLLDRIQVDYYGAPTPLNQLASITVPEARVLLISPF
RRF_STRPF       MANAIIETAKERFAQSHQSLSREYASIRAGRANASLLDRIQVDYYGAPTPLNQLASITVPEARVLLISPF
RRF_STRPD       MANAIIETAKERFAQSHQSLSREYASIRAGRANASLLDRIQVDYYGAPTPLNQLASITVPEARVLLISPF
RRF_STRPC       MANAIIETAKERFAQSHQSLSREYASIRAGRANASLLDRIQVDYYGAPTPLNQLASITVPEARVLLISPF
RRF_STRPB       MANAIIETAKERFAQSHQSLSREYASIRAGRANASLLDRIQVDYYGAPTPLNQLASITVPEARVLLISPF
RRF_STRP6       MANAIIETAKERFAQSHQSLSREYASIRAGRANASLLDRIQVDYYGAPTPLNQLASITVPEARVLLISPF
RRF_STRP3       MANAIIETAKERFAQSHQSLSREYASIRAGRANASLLDRIQVDYYGAPTPLNQLASITVPEARVLLISPF
RRF_STRP1       MANAIIETAKERFAQSHQSLSREYASIRAGRANASLLDRIQVDYYGAPTPLNQLASITVPEARVLLISPF
RRF_STRP8       MANAIIETAKERFAQSHQSLSREYASIRAGRANASLLDRIQVDYYGAPTPLNQLASITVPEARVLLISPF
RRF_STRS7       MANAIIETAKERFTQSHHSLAREYASIRAGRANASLLDRIQVDYYGAPTPLNQLASITVPEARVLLISPF
RRF_STREM       MANAIIETAKERFTQSHHSLAREYASIRAGRANASLLDRIQVDYYGAPTPLNQLASITVPEARVLLISPF
RRF_STRE4       MANAIIETAKERFTQSHHSLAREYASIRAGRANASLLDRIQVDYYGAPTPLNQLASITVPEARVLLISPF
RRF_STRU0       MANAIIEKANQRFEQSFQSLSREYASIRAGRANASLLDRIQVEYYGVPTPLNQLASITVPEARVLLISPF
RRF_STRTD       MTNAIIEKAKERFAHTHESLAREFGAIRAGRANASLLDRITVEYYGAPTPLNQLASITVPEARVLLISPF
RRF_STRT2       MTNTIIEKAKERFAHTHESLAREFGAIRAGRANASLLDRITVEYYGAPTPLNQLASITVPEARVLLISPF
RRF_STRT1       MTNTIIEKAKERFAHTHESLAREFGAIRAGRANASLLDRITVEYYGAPTPLNQLASITVPEARVLLISPF
RRF_STRSY       MSKEIIAKAQERMNQSHQSLAREFSHIRAGRANASLLDRISVEYYGSPTPLNQLAGITVPEARVLLITPF
RRF_STRS2       MSKEIIAKAQERMNQSHQSLAREFSHIRAGRANASLLDRISVEYYGSPTPLNQLAGITVPEARVLLITPF
RRF_LACLA       MANEIVTTAQDRMKQSLGSLQRDLGHIRAGRANASLLDRVQVVYYGAPTPLNQLASITIPEARVLMVTPF
RRF_LACLM       MANEIVTTAQERMKHSLASLQRDLGHLRAGRANASLLDRVQVVYYGAPTPLNQLASITIPEARVLMVTPF
RRF_LACLS       MANEIVTTAQERMKHSLASLQRDLGHLRAGRANASLLDRVQVVYYGAPTPLNQLASITIPEARVLMVTPF
RRF_ENTFA       MSKEVLATAKEKMTKAEESLRRELGQIRAGRANASLLDRIQVEYYGAPTPVNQLASINIPEARVLMITPF
RRF_LACS1       ----IIKEAQEKMTKAEDSLRRELGNIRAGRANASLLNRINVEYYGAPTPLNQMAQISVPEARVLLVTPY
RRF_PEDPA       --NEIIQKAEEKMQKAQNVLERDLGSIRAGRANASLLDKVSVDYYGAPTPLNQMASITIPEPRVLLVTPY
RRF_GEOKA       MAKQVIQQAKEKMDKAVQAFTRELASIRAGRANAGLLEKVTVDYYGVPTPINQLASISVPEARLLVIQPY
RRF_LACSS       MANPILEQAKENMEKAEASLRRTLGQIRAGRANASLVNRVNVEYYGAMTPLNQIAAITIPEARVLLITPY
RRF_LACGA       MANEVIEKAKDNMKKSIAVFQKELGGIRAGVANASLLEGIKVDYYGVPTPLTQMSSVSIPEARVLMVTPY
RRF_LACJO       MANEVIEKAKDNMKKSIAVFQKELGGIRAGVANASLLDGIKVNYYGVPTPLTQMSSVSIPEARVLMVTPY
RRF_GEOTN       MAKQVIQQAKEKMDKAVQAFSRELATVRAGRANAGLLEKVTVDYYGVATPINQLATISVPEARMLVIQPY
RRF_LACPL       ----ILKEAQERMKKAEAALQRELGNIRAGRANASLLNRISADYYGAQTPLNQMAAITVPEPRVLMVTPF
RRF_BACP2       MSKEVLNQTKEKMEKAVQAYGRELATVRAGRANASLLDKVTVDYYGAQTPLNQIASITVPEARMLIITPY
RRF_BACHD       MSKEVLNDAEQRMTKATEALGRELAKLRAGRANPAMLDRITVEYYGAETPLNQLATISVPEARLLVIQPF
RRF_LACCB       MANQIIDQAKVNMGKTEESLQRELGNIRAGRANASLLNQITVEYYGAPTPLNQMAAITIPEPRVLQVSPY
RRF_LACC3       MANQIIDQAKVNMGKTEESLQRELGNIRAGRANASLLNQITVEYYGAPTPLNQMAAITIPEPRVLQVSPY
RRF_GEOSW       MVQQIINTAKEKMDKAVQAFTRELATIRAGRANPSLLEKVTVDYYGMPTPIIQLASISVPEARLLVIQPY
RRF_LACDB       MNNETIAKAKRNMNKSIEVYQSNLATVRAGVANASLLDRVMVEYYGVPTPLVQMAGITIPEPRVLMITPY
RRF_LACDA       MNNETIAKAKRNMNKSIEVYQSNLATVRAGVANASLLDRVMVEYYGVPTPLVQMAGITIPEPRVLMITPY
RRF_LACH4       MNNETIKKAQDNMDKSIKVYQKRLASIRAGVANAALLDNVQVEYYGAPTPLTQMSSITIPEPRVLLITPY
RRF_CLOAB       MISDIIKELEEKMTKSISALKKELTSMKAGRANPAMLDRIEVDYYGTMTPLNQLANISVPESRVLMIQPW
RRF_STAHJ       ----IIQDTKARMSKSIDNLSRELANISAGRANSNLLSGVTVDYYGAPTPVQQLASINVPEARLLVISPY
RRF_BACLD       MSTQVMNETKERMQKAISAYQRELATVRAGRANPSLLDKVAVEYYGAQTPLNQIASITVPEARMLVITPY
RRF_BACCN       MGQQVIKSSTEKMEKAVAAYSRELATVRAGRASASILDKVQVDYYGAPTPVVQLANITVPEARLLVIQPY
RRF_ANATD       -----IQVAEEKMKKAIETLKEEFATIRAGRANPHILDKVMVDYYGVPTPIPQVASITVPEARMIVIQPW
RRF_CALS8       -----IQIAEEKMKKAIETLKEEFATVRAGRANPHILDKVMVDYYGVPTPIPQLASITVPEARMIVIQPW
RRF_CLOPS       MIKDVIKKSEEKMNKTINSLNSELATMKAGRANPTMLDRIQVEYYGSMCPLNQVANVSSPEPRLLVITPW
RRF_CLOPE       MIKDVIKKSEEKMNKTINSLNSELATMKAGRANPTMLDRIQVEYYGSMCPLNQVANVSSPEPRLLVITPW
RRF_CLOP1       MIKDVIKKSEEKMNKTINSLNSELATMKAGRANPTMLDRIQVEYYGSMCPLNQVANVSSPEPRLLVITPW
RRF_LACRJ       ----ILNDAKQKMAKSGYALQRTLADIRAGQANASLLNSVKVEYYGAPTPLNQVASITIPEARQLLITPY
RRF_LACRD       ----ILNDAKQKMAKSGYALQRTLADIRAGQANASLLNSVKVEYYGAPTPLNQVASITIPEARQLLITPY
RRF_STAS1       ----IINETKSKMQKSIDNLSRELANISAGRANSNLLNGVNVDYYGAPTPVQQLASISVPEARLLVISPY
RRF_DESHD       MINDVLKEAEDRMVKAVEALKREYATIRAGRANPNMLDKITVEYYGTQTPVNQLANISVPEPRMLTIQPW
RRF_EXIS2       MSQAIMKQAEERMEKAHLSLKKELATLRAGRANVSILDPVQVDYYGSPTPLNQVANVNTPEARLILITPW
RRF_DESHY       MINDVLKEAEDRMVKAVEALKREYATIRAGRANPNMLDKITVEYYGTQTPVNQLANISVPEPRMLTIQPW
RRF_CYAA5       ---MMLDDLKENMQKSVEATQRSFNTIRTGRANASILDRVTVEYYGTETPLYQLANISTPDATTIMIQPY
RRF_CLONN       MIKDILNKSEEKMLKSISVLKKDLGSMKAGKANPAMLDRVNVEYYGSETPINQLANVSSPEPRVLLIQPW
RRF_STACT       ----ILSETRSRMKKSIESLSRELATINAGRANSNLLAGVKVDYYGAPTPVQQLASINVPEPRLLVVSPY
RRF_OCEIH       -----LKEMEQKMEQAVQALSKNLASVRAGRANPSILDSVFVDYYGASTPLNQLASVGAPEARLLTITPY
RRF_BACSK       MTKEIKADAKTRMDKAIDVLSRELAKLRAGRANPALLDRVTVEYYGAQTPLNQLASVTVPEARLLLITPY
RRF_PELCD       MYNDVIKKARSGMDKAVESLKKDMTKVRTGRASTSLLDDVMVDYYGTPTPLNQVGTLAVPEPRLITIQPW
RRF_THEPX       -----LKASEEKMQKSLSVLKNELAAIRAGRANPALLDRIMVDYYGTPTPLNRLATITAPEPRVLVVQPW
RRF_THEP3       -----LKASEEKMQKSLSVLKNELAAIRAGRANPALLDRIMVDYYGTPTPLNRLATITAPEPRVLVVQPW
RRF_CLOB8       MIKDIIQNAEEKMKKTISVLKSDLSTMKAGRANPTMLDRIHVEYYGSMCPLSQVANVSAPEPRVLMITPW
RRF_MACCJ       MTTEIMNELKSKMEKSIESLQRDFAAIRAGHANANLLDRVSVVYYGAETPVQQLAGISVPEPRMLLVTPY
RRF_LEUCK       --------AKSRMQGAQDALQRELTSIRTGRANPHILDRIEVEYYGAMTPLNQVASISVPEARVLLITPF
RRF_ALKOO       ----IHKNLEEKMNKTINALKDELASIRAGRANPAMLDRIVVEYYGSPTPIKQIAAITAPEPRIISIQPY
RRF_SYNY3       -----LAELKDHMQKSVEATQRSFNTIRTGRANASLLDRITVEYYGAETPLKSLATIGTPDASTIVIQPF
RRF_PELTS       MAGELIKEAESNMKKTIEVVKKEFASLRAGRATPALLDKVMVNYYGTPTPVNQLANISVPEARLLVVQPW
RRF_FINM2       MSKQILKDMETKADKTLHALKEELKTVRAGRANPSILDNIMVEYYGTSTPLKQVATISAPEARLLTIQPW
RRF_THETN       -----LKDSEERMKKTLNVLKSELAAIRAGRANPALLDRITVNYYGTPTPLNRLATITAPEPRVLVVQPW
RRF_SYMTH       MTKEIIKDAEERMKKAVEVFRQELAGMRANRATPALLDKVRVEAYGSEVPVNNVATIEVPDPRTLVIKPW
RRF_STAAW       ----IINETKSRMQKSIESLSRELANISAGRANSNLLNGVTVDYYGAPTPVQQLASINVPEARLLVISPY
RRF_STAAU       ----IINETKSRMQKSIESLSRELANISAGRANSNLLNGVTVDYYGAPTPVQQLASINVPEARLLVISPY
RRF_STAAS       ----IINETKSRMQKSIESLSRELANISAGRANSNLLNGVTVDYYGAPTPVQQLASINVPEARLLVISPY
RRF_STAAR       ----IINETKSRMQKSIESLSRELANISAGRANSNLLNGVTVDYYGAPTPVQQLASINVPEARLLVISPY
RRF_STAAN       ----IINETKSRMQKSIESLSRELANISAGRANSNLLNGVTVDYYGAPTPVQQLASINVPEARLLVISPY
RRF_STAAM       ----IINETKSRMQKSIESLSRELANISAGRANSNLLNGVTVDYYGAPTPVQQLASINVPEARLLVISPY
RRF_STAAE       ----IINETKSRMQKSIESLSRELANISAGRANSNLLNGVTVDYYGAPTPVQQLASINVPEARLLVISPY
RRF_STAAC       ----IINETKSRMQKSIESLSRELANISAGRANSNLLNGVTVDYYGAPTPVQQLASINVPEARLLVISPY
RRF_STAAB       ----IINETKSRMQKSIESLSRELANISAGRANSNLLNGVTVDYYGAPTPVQQLASINVPEARLLVISPY
RRF_STAA9       ----IINETKSRMQKSIESLSRELANISAGRANSNLLNGVTVDYYGAPTPVQQLASINVPEARLLVISPY
RRF_STAA8       ----IINETKSRMQKSIESLSRELANISAGRANSNLLNGVTVDYYGAPTPVQQLASINVPEARLLVISPY
RRF_STAA3       ----IINETKSRMQKSIESLSRELANISAGRANSNLLNGVTVDYYGAPTPVQQLASINVPEARLLVISPY
RRF_STAA2       ----IINETKSRMQKSIESLSRELANISAGRANSNLLNGVTVDYYGAPTPVQQLASINVPEARLLVISPY
RRF_STAA1       ----IINETKSRMQKSIESLSRELANISAGRANSNLLNGVTVDYYGAPTPVQQLASINVPEARLLVISPY
RRF_LISMH       MSKEVLSKSKEKMEKAEQALTRQLGTIRAGRANASLLDRLSVDYYGAATPVNQMASISVPEARMLLITPY
RRF_THEEB       ---------EERMQKSVEATQHDFNSIRTGRANAALLDRVMVDYYGTETPLRSLANVSTPDATTILIQPY
RRF_LACRE       ----ILNEAKDKMAKSGDALRRTLADIRAGRANASLLNGVKVDYYGAPTPLNQVASITIPEARQLLVTPY
RRF_XYLFA       MLNQIKQDAQDRMTKSIDALRNSLASVRTGRASPSLLDGIKIKAYGTDTPLNQVASISVSEGRSLVITVF
RRF_XYLFT       MLNQIKQDAQDRMTKSIDALRNSLASVRTGRASPSLLDGIKIKAYGTDTPLNQVASISVSEGRSLVITVF
RRF_GEOUR       MTKDVINNMSTHMDKTIDALRKEYQRVRTGRASTGLLDEIKVDFYGTPSPINQVATLAVPEPRTITLQPW
RRF_BACC7       MGQQVLKSANEKMEKAVAAYSRELATVRAGRANASVLDKVQVDYYGAPTPVVQLANITVPEARLLVIQPY
RRF_BACC1       MGQQVLKSANEKMEKAVAAYSRELATVRAGRANASVLDKVQVDYYGAPTPVVQLANITVPEARLLVIQPY
RRF_ALKMQ       ------KRLEEKMTKTLGVLKDDFNSIRAGKANPSMLDRITVDYYGSITPLKQVASVSAPEPRLLIIQPY
RRF_LISIN       MSKEVLSKSKEKMEKAEQALTRQLGTIRAGRANASLLDRLTVDYYGAATPVNQMASISVPEARMLLITPY
RRF_BACCR       MGQQVLKSSNEKMEKAVAAYSRELATVRAGRANASVLDKVQVDYYGAPTPVVQLANITVPEARLLVIQPY
RRF_BACC4       MGQQVLKSSNEKMEKAVAAYSRELATVRAGRANASVLDKVQVDYYGAPTPVVQLANITVPEARLLVIQPY
RRF_BACA2       MSNEVLTQTKERMEKAVAAYSRELASVRAGRANPSLLDKVTVEYYGAQTPLNQLSSINVPEARMLVVTPY
RRF_STAES       ----IIKDTKSRMQKSIDNLSRELANISAGRANSNLLNGVTVDYYGAPTPVQQLASINVPEARLLVISPY
RRF_STAEQ       ----IIKDTKSRMQKSIDNLSRELANISAGRANSNLLNGVTVDYYGAPTPVQQLASINVPEARLLVISPY
RRF_DESRM       MVKELISSAEDHMKKSVDVVRREFASLRAGRATPSILDKVTVSYYGTPTPLNQLANISVPEARVLVIQPW
RRF_CLOBL       MIKEILKKADEKMGKTIVALKRELASMKAGRANPAMLDRIEAEYYGSMTPLNQLGNISIPEARVLLIQPW
RRF_GEOSM       MVKDVISNMNVHMGKSIESLRKEYQKVRTGRATTSLLDDIKIDSYGTLSPLNQVATLAIPEARTITISPW
RRF_DESDG       --DTILLETEERMEKAVAALDREFGRLRTGRASTSLVDSIKVDYYGTPTPINQLASVAVPDSRTITIQPW
RRF_CLOBK       MIKEILKKADEKMGKTIVALKRELASMKAGRANPAMLDRIEAEYYGSMTPLNQLGNISVPEARVLLIQPW
RRF_CLOBJ       MIKEILKKADEKMGKTIVALKRELASMKAGRANPAMLDRIEAEYYGSMTPLNQLGNISVPEARVLLIQPW
RRF_CLOB6       MIKEILKKADEKMGKTIVALKRELASMKAGRANPAMLDRIEAEYYGSMTPLNQLGNISVPEARVLLIQPW
RRF_BACHK       MGQQVLKSSNEKMEKAVAAYSRELATVRAGRASASVLDKVQVDYYGAPTPVVQLANITVPEARLLVIQPY
RRF_BACCZ       MGQQVLKSSNEKMEKAVAAYSRELATVRAGRASASVLDKVQVDYYGAPTPVVQLANITVPEARLLVIQPY
RRF_BACC3       MGQQVLKSSNEKMEKAVAAYSRELATVRAGRASASVLDKVQVDYYGAPTPVVQLANITVPEARLLVIQPY
RRF_BACC0       MGQQVLKSSNEKMEKAVAAYSRELATVRAGRASASVLDKVQVDYYGAPTPVVQLANITVPEARLLVIQPY
RRF_BACAH       MGQQVLKSSNEKMEKAVAAYSRELATVRAGRASASVLDKVQVDYYGAPTPVVQLANITVPEARLLVIQPY
RRF_BACAC       MGQQVLKSSNEKMEKAVAAYSRELATVRAGRASASVLDKVQVDYYGAPTPVVQLANITVPEARLLVIQPY
RRF_DESVM       ----ILLDAEERMEKALGSLDREFAKLRTGRASTSLVDNIKVDYYGTPTPISQLASVSVPDSRTLTIQPW
RRF_XANCP       MLNQIKQDAQTRMTKSIDALRHSLTTVRTGRASPALLDNIKVKAYGTDTPLNQVASISVSEGRSLVISLF
RRF_XANCB       MLNQIKQDAQTRMTKSIDALRHSLTTVRTGRASPALLDNIKVKAYGTDTPLNQVASISVSEGRSLVISLF
RRF_XANC8       MLNQIKQDAQTRMTKSIDALRHSLTTVRTGRASPALLDNIKVKAYGTDTPLNQVASISVSEGRSLVISLF
RRF_BACC2       MGQQVLKSSNEKMEKAVAAYSRELATVRAGRASSSVLDKVQVDYYGAPTPVVQLANITVPEARLLVIQPY
RRF_BACAN       MGQQVLKFSNEKMEKAVAAYSRELATVRAGRASASVLDKVQVDYYGAPTPVVQLANITVPEARLLVIQPY
RRF_BACAA       MGQQVLKFSNEKMEKAVAAYSRELATVRAGRASASVLDKVQVDYYGAPTPVVQLANITVPEARLLVIQPY
RRF_CYAP4       ---------EDHMQKSVEATQRAFNTIRTGRANTSLLDRVTVEYYGAETPLRSLANISTPDSSTIAIQPF
RRF_BACWK       MGQQVLKSSNEKMEKAVAAYSRELATVRAGRASSSVLDKVQVDYYGAPTPVVQLANITVPEARLLVIQPY
RRF_LAWIP       --------SQERMVKAITSLEKEFTKLRTGRASTSIVDTIKVDYYGTPTPINQLASIAIPDSSSITIQPW
RRF_CYAP7       -----LSEVQDNMQKTIESTQRSFNTIRTGRANSALLDRVMVDYYGTETPLKSLANITTPDATTIAIQPY
RRF_SYNJB       -----LAEIEELMNKAVQATQRSFNTVRTGRANSSLLDRIQVEYYGVPTPLKALASLTTPDSSTLLIQPF
RRF_CLOBH       MIKEILKKADEKMGKTIVALKKELASMKAGRANPAMLDRIEAEYYGSMTPLNQLGNISVPEARVLLIQPW
RRF_CLOB1       MIKEILKKADEKMGKTIVALKKELASMKAGRANPAMLDRIEAEYYGSMTPLNQLGNISVPEARVLLIQPW
RRF_GEOLS       MYKSVITEMKAHMEKSVEDLRKEYQRIRTGRASTSLLDEVKVDYYGNPSSLSQVATLAVPEPRTITITPW
RRF_MOOTA       ----ILQEAEEKMKKAVEGLRRELASLRAGRANPALLEKVLVSYYGTPTPVNQLATVSSPEARLLVIQPW
RRF_GEOBB       MVKDVISSMNVHMDKSIESLRKEYQKVRTGRASTSLLDDIKVDSYGTLSPLNQVATLAIPEARTITISPW
RRF_ACHLI       -ADMILLEIEEKMEKSLEALGREYAAVRTGRANPNILDRIMVSYYGVDTPLKQVASISVPEAQQLYIKPF
RRF_HELMI       MINEIKKETEDKMKKTVEALRKEYQHIRAGRANPALLEKVTVEYYGAPTPVNQLANISAPEARLLVIQPW
RRF_THISH       MTDSIKKDAKARMGKSIESLRNELAKIRTGRAHTSLLDHVMVEYYGSDVPISQVANVNVEDARTLTVTPW
RRF_BREBN       MPQTVLNDMEDRMNKAINALKRDLSSLRAGRANPAMLDRVTVDYYGTPTPISQLANISVPEPRMLTIQPW
RRF_BACSU       MSKEVLTQTKEKMEKAIAAYQRELATVRAGRANPSLLDKVTVEYYGAQTPLNQLSSINVPEARMLVITPY
RRF_XANC5       MLTQIKQDAQTRMTKSIDALRHSLTTIRTGRASPALLDGIKVKAYGADTPLNQVASISVSEGRSLVISLF
RRF_XANAC       MLTQIKQDAQTRMTKSIDALRHSLTTIRTGRASPALLDGIKVKAYGADTPLNQVASISVSEGRSLVISLF
RRF_TRIEI       -----LKEAEEKMQKAIEATKNSFNTVRTGRANASLLDRVMVEYYGSPTQLKSMANIGIPDASTITIQPY
RRF_SYNP2       -----LSELRENMQKTIEATQRSFNTLRTGRASASLLDRITVEYYGAETPLKSLASISTPDSSTIMIQPF
RRF_NOSP7       ---MILADAKSKMQSSVESTQRAFNTIRTGRANASLLDKVLVDYYGSPTPLKSLANISTPDASTILIQPY
RRF_COLP3       MIDEIIEDAQDRMGKSIEALKTSLTKIRTGRAHASLLDNIVVEYYGMDTPLNQVGNVSVPDARNLSITVF
RRF_TREDE       MIEEVKKNCEEKMKKTVVALKEEFNMLRTGRASSALFDKIRVNCYGESTPLNQLANISIPEARLVVIQPW
RRF_XANOR       MLTQIKQDAQTRMTKSIDALRHSLTTVRTGRASPALLDGIKVKAYGTDTPLNQVASISVSEGRSLVISLF
RRF_XANOP       MLTQIKQDAQTRMTKSIDALRHSLTTVRTGRASPALLDGIKVKAYGTDTPLNQVASISVSEGRSLVISLF
RRF_XANOM       MLTQIKQDAQTRMTKSIDALRHSLTTVRTGRASPALLDGIKVKAYGTDTPLNQVASISVSEGRSLVISLF
RRF_EUBR3       ---------QDKMEKTLNNLEEEYAGIRAGRANPHILDKLRVDYYGTPSPIQSVANVSVPEPRMIQIQPW
RRF_DESAA       MLELVYEEAREKMDKAIAALEKGLLRVRTGRASLSMLDGVKLDYYGTPTPINQAATVAIPESRLITIQPW
RRF_CORGL       MIDEILFEAEERMTATVEHTREDLTTIRTGRANPAMFNGVMAEYYGVPTPITQMSGITVPEPRMLLIKPY
RRF_CORGB       MIDEILFEAEERMTATVEHTREDLTTIRTGRANPAMFNGVMAEYYGVPTPITQMSSISVPEPRMLLIKPY
RRF_CLOTE       -----------------------------GRANPAMLDKIEAEYYGTMTPLSQLANISVPEARILQIQPW
RRF_IDILO       MIKETIEDAKDRMEKSVESLRSQMSKVRTGRAHPSILDSVMVNYYGTDTPLKQLANITTEDSRTLALTVF
RRF_LISW6       MSKEVLTKSKEKMDKAEQALTRQLGTIRAGRANASLLDRLSVDYYGAPTPVNQMASISVPEARMLLITPY
RRF_LISMO       MSKEVLSKSKEKMEKAEQALTRQLGTIRAGRANASLLDRLSVDYYGAATPVNQMASISVPEARMLLITPY
RRF_LISMF       MSKEVLSKSKEKMEKAEQALTRQLGTIRAGRANASLLDRLSVDYYGAATPVNQMASISVPEARMLLITPY
RRF_LISMC       MSKEVLSKSKEKMEKAEQALTRQLGTIRAGRANASLLDRLSVDYYGAATPVNQMASISVPEARMLLITPY
RRF_DESPS       MSEVIVEMSG-RMAKSVEAFKNDLSRVRTGRASISILDDITVVAYGSTMPLNQVATLTIPESRMIALQPW
RRF_NITWN       ---------KRRMQGATQSLKHELGGLRTGRASSSMLDPVQVDAYGSHMPLNQVATISVPEPRLLSVQVW
RRF_FUSNN       ----LVKECEEKMVKTIEAVKEKFTAIRAGRANVSMLDGIKVENYGSEVPLNQIGTVSAPEARLLVIDPW
RRF_ACTSZ       MINEIKKDAQDRMEKSLEALKGHISKIRTGRAQPSLLDAIQVDYYGAATPLRQLANVVAEDARTLAVTVF
RRF_SYNAS       MKDMVFDELKQNMEKGLQALEKSFNKVRTGRASISLLDGIKADYYGTPTPLNQVATLSVPESRQILISPW
RRF_DEHSC       MINEILQKSEKKMSASLDVLLQELSGIRTGRSSPALVEHIRVEYAGVPTPINHLANISAPDPRYITIQPW
RRF_CORDI       MIDEILFEAEEHMNTSVERTRDELVNIRTGRANPAMFNGVIADYYGVPTPITQMATISVPEARMLLIKPY
RRF_CLOK5       MIKDILNKADEKMNKTVDVLVKELASMKAGRANPAILDKIEVEYYGAMTPISQLAGISIPEARILAIQPW
RRF_CLOK1       MIKDILNKADEKMNKTVDVLVKELASMKAGRANPAILDKIEVEYYGAMTPISQLAGISIPEARILAIQPW
RRF_SHESA       ----IKKDAQERMGKCVEATKNQMAKVRTGRAHPSLLDSIQVSYYGTMTPLNQVANVGIEDARTLSVTVF
RRF_DEHE1       MINEILQKSEKKMAASLDVLSQELSGIRTGRSSPALVEHIKVEYAGVPTPINHLASIAAPDPRYITIQPW
RRF_SHESW       MIENIKKDAQERMGKCVDATKNQMAKVRTGRAHPSLLDSIQVSYYGTMTPLNQVANVGVEDSRTLSVTVF
RRF_SHEPC       MIENIKKDAQERMGKCVDATKNQMAKVRTGRAHPSLLDSIQVSYYGTMTPLNQVANVGVEDSRTLSVTVF
RRF_HAES2       MINEIKKDTQQRMEKSLETLRTHIAKIRTGRAQPSLLDGIQVEYYGSPTPLRQLANVVAEDARTLAVTVF
RRF_HAES1       MINEIKKDTQQRMEKSLETLRTHIAKIRTGRAQPSLLDGIQVEYYGSPTPLRQLANVVAEDARTLAVTVF
RRF_HAEIN       MLNQIKKDAQDRMEKSLEALKGHISKIRTGRAQPSLLDAIQVEYYGAATPLRQLANVVAEDARTLAVTVF
RRF_HAEIG       MLNQIKKDAQDRMEKSLEALKGHISKIRTGRAQPSLLDAIQVEYYGAATPLRQLANVVAEDARTLAVTVF
RRF_GEOMG       MTKEVIADMKAHMEKSVDALRREYQKVRTGRATTGLLDDIKVEYYGNPSPLSQVATLSVPEPRTITIQPW
RRF_CLOTH       ---------EEKMKKTVSVLKDELNTVRAGRANAAILDRITVDYYGVPTPINQLGTISVPEPRVIVIQPW
RRF_ACIC1       -------EAEEKMEKATNVARENFAAIRTGRANPALFSKITVEYYGTPTPLNQLASFTVADARLIVIHPY
RRF_PROM1       ------QELKNTMSKSVEAAQRNFNTIRTGRANTSLLDRISVEYYGAETPLKSLATITTPDSQTIAIQPF
RRF_MYCS2       --------AEEKMEKAVSVARDELGSIRTGRANPGMFNRINIDYYGSMTPITQLASINVPEARLVVIKPY
RRF_HAEI8       MLNQIKKDAQDRMEKSLEALKGHISKIRTGRAQPSLLDAIQVEYYGAATPLRQLANVVAEDARTLAVTVF
RRF_VIBPA       MINEIKKDAQERMDKSVEALKNNLSKVRTGRAHPSLLSGISVEYYGAATPLNQVANVVAEDARTLAITVF
RRF_SHESR       ----IKKDAQERMGKCVEATKNQMAKVRTGRAHPSLLDSIQVSYYGTMTPLNQVANVGIEDARTLSVTVF
RRF_SHESM       ----IKKDAQERMGKCVEATKNQMAKVRTGRAHPSLLDSIQVSYYGTMTPLNQVANVGIEDARTLSVTVF
RRF_PROMT       ------QELKTTMSKSIEAAQRNFNTIRTGRANTSLLDRISVEYYGAETPLKSLATITTPDSQTIAIQPF
RRF_HAEPS       MINEIKKDTQERMEKSLEALKGHISKIRTGRAQPSLLDAIQVEYYGSATPLRQLANVVAEDARTLAVTVF
RRF_DESAH       MINELYKETRDRMVKSVKTLEKEMTRVRTGRASMTMLDGVKVDYYGTLTPLNQMASIAIPESRMITVQPW
RRF_SHEB5       MIENIKKDAQERMGKCVDATKNQMAKVRTGRAHPSLLDSIQVSYYGTMTPLNQVANVGVEDSRTLSVTVF
RRF_SHEB2       MIENIKKDAQERMGKCVDATKNQMAKVRTGRAHPSLLDSIQVSYYGTMTPLNQVANVGVEDSRTLSVTVF
RRF_PHEZH       ----VLSKYRDRMDKAVAALKEEFGSLRTGRASASLLDQIHVDAYGSSMPLTQVAAVSVPEPRMITVNVW
RRF_CORA7       MIDEIQLEAEEHMTASVEHTREQLLTIRTGRANPAMFNGLVAEYYGVPTPITQMATISVPEPRMLLIKPY
RRF_SHEDO       MIETILLDAQERMGKCVDATKNQMAKVRTGRAHPSLLDSIQVSYYGAMSPLKQVANVGIEDSRTLSVTVF
RRF_SHEB9       MIENIKKDAQERMGKCVDATKNQMAKVRTGRAHPSLLDSIQVSYYGTMTPLNQVANVGVEDSRTLSVTVF
RRF_SHEB8       MIENIKKDAQERMGKCVDATKNQMAKVRTGRAHPSLLDSIQVSYYGTMTPLNQVANVGVEDSRTLSVTVF
RRF_GLOVI       -----VSKTEQDMRKAIEATAGNFATIRTGRASTSLLDRINVEYYGQPTPLKTLATITTPDASTVLIQPY
RRF_CLOD6       ----IHKQLEEKMNGTIDALKFEFGTIRAGRANAQMLDKIRVDYYGTPTPINQIGAISVPEPRILMISPW
RRF_CLOBB       MIKDIIKNAEEKMQKTVTVLKSELGTMKAGRANPSMLDKIQIDYYGSMCPLSQAANISSPEPRVLMITPW
RRF_CLOBA       MIKDIIKNAEEKMQKTVTVLKSELGTMKAGRANPSMLDKIQIDYYGSMCPLSQAANISSPEPRVLMITPW
RRF_CAMLR       MLNEIYTKQKQQSDKSLEALKKDFTTIRTGKVNINILDHVHVDYYGSQTPLNQVATVLATDASTISITPW
RRF_VIBHB       MINEINKDAQERMDKSVEALKNNLSKVRTGRAHPSLLSGISVEYYGAPTPLNQVANVVAEDARTLAITVF
RRF_SHEON       ----IKKDAQERMGKCVDATKNQMAKVRTGRAHPSLLDSIQVSYYGTMTPLNQVANVGVEDARTLSVTVF
RRF_HAEDU       MINEIKKDTQQRMEKSLEALKSHISKIRTGRAQPSLLDGIQVEYYGSATPLRQVANVVAEDARTLAVNVF
RRF_VIBCM       MINEIKKDAQERMEKSVEALKNGLSKIRTGRAHPSLLTGISVDYYGAPTPLNQVANVIAEDARTLAITVF
RRF_VIBCH       MINEIKKDAQERMEKSVEALKNGLSKIRTGRAHPSLLTGISVDYYGAPTPLNQVANVIAEDARTLAITVF
RRF_VIBC3       MINEIKKDAQERMEKSVEALKNGLSKIRTGRAHPSLLTGISVDYYGAPTPLNQVANVIAEDARTLAITVF
RRF_SHEHH       MINEIKSDAQTRMDKCVESTKTQMAKVRTGRAHPSLLDTIQVPYYGSLTPLKQVASVSIGDARTLTVSVF
RRF_PROAC       ----IIKDAEKKMGSAVDHAREEFAAIRTGRANPAMFNKLMVEYYGTPTPLQQLASFQVPEARTVLIAPF
RRF_PELPD       MPKTVLSDMKTHMEKTVAVLKAEFQKVRTGRASTAILDSVKMDYYGNPTPISQIATLAIPEPRMITITPW
RRF_MANSM       MINEIKKDTQDRMEKSLEALKGHIAKIRTGRAQPSLLDAIQVDYYGSATPLRQLANVVAEDARTLAVTVF
RRF_MAGSM       MSIPLIKDLEQRMNKSLAALKDELATVRTGRASTSLLDAVMVNAYGSMMPLNQVASMTVPEARMINVQPW
RRF_HELHP       MLNEIFKNAKSHMDKSIESLRRDFSTLRSGKVSVNILDNVRVDYYGTPTPLNQVGSVIAQDATTIIITPW
RRF_ANASP       -----LAEAESKMQHTVEATQRAFNTIRTGRANASLLDKVLVDYYGSPTPLKSLANISTPDATTILIQPY
RRF_GLUDA       ----LLDDLTRRMDGALESLRRDFAGLRSGRASPALIEPVRVEAYGGEVPLTQVGSIAVPEARMLTVQVW
RRF_ACTPJ       MINEIKKDTQDRMEKSLEALKSHISKIRTGRAQPSLLDGIQVEYYGSATPLRQLANVVAEDARTLAVNVF
RRF_ACTP7       MINEIKKDTQDRMEKSLEALKSHISKIRTGRAQPSLLDGIQVEYYGSATPLRQLANVVAEDARTLAVNVF
RRF_ACTP2       MINEIKKDTQDRMEKSLEALKSHISKIRTGRAQPSLLDGIQVEYYGSATPLRQLANVVAEDARTLAVNVF
RRF_VIBVY       MINDIKKDAQERMEKSVEALKNSLSKVRTGRAHPSLLSGISVDYYGAATPLTQVANVIAEDARTLAITVF
RRF_SHEPA       MINEIKSDAQTRMDKCVESTKTQMAKVRTGRAHPSLLDTIQVPYYGSLTPLKQVASVSIGDARTLTVSVF
RRF_RHOOB       MIDEALFEAEEKMEKAVTVAKDDLGSIRTGRANPGMFNRIGIDYYGAFTPITQLASINVPEARLVVVKPY
RRF_MYCGI       --------AEEKMEKAVSVARDDLASIRTGRANPGMFNRIHIDYYGASTPITQLSSINVPEARMVVIKPY
RRF_CORK4       -------ESEERMTQSVEYAREDLTTIRTGRANPSMFNGVQAEYYGVMTPITQMATISVPEPRMLLIKPY
RRF_VIBF1       MINEIKKDAQERMEKSVEALKNNLLKIRTGRAHPSLLSGISVEYYGAQTPLNQVANVVAEDSRTLAITVF
RRF_MYCA9       MIDEVLLDAEEKMEKAVTVARDDFATIRTGRANPGMFQRVVIDYYGTPTPITQVAGINVPEARMVVIKPY
RRF_VIBFM       MINEIKKDAQERMEKSVEALKNNLLKVRTGRAHPSLLSGISVEYYGAKTPLNQVANVVAEDSRTLAITVF
RRF_THEP1       MVNPIIKEAKEKMKKTLERIEDELRKMRTGKPSPAILEEIKVDYYGVPTPVNQLATISVSEERTLVIKPW
RRF_SYNP6       ------------MQKSVEATLRSFNTIRTGRANASLLDKIVVDYYGSETPLKSLASISTPDASTLQIQPF
RRF_SYNE7       ------------MQKSVEATLRSFNTIRTGRANASLLDKIVVDYYGSETPLKSLASISTPDASTLQIQPF
RRF_RHOSR       MIDEALFEAEEKMEKAVTVAKDDLGSIRTGRANPGMFNRIGIDYYGAFTPITQLASINVPEARLVVVKPY
RRF_PARD8       ----LIKAGEEKMTFAIEYLDEQLSHIRAGKANPKILDCVKVMYYGAPVPLTNVATVTVPDARTIMITPW
RRF_MYCSS       --------AEEKMEKAVSVARDDLSSIRTGRANPGMFSRINVDYYGATTPITQLSSINVPEARMVVIKPY
RRF_MYCSK       --------AEEKMEKAVSVARDDLSSIRTGRANPGMFSRINVDYYGATTPITQLSSINVPEARMVVIKPY
RRF_MYCSJ       --------AEEKMEKAVSVARDDLSSIRTGRANPGMFSRINVDYYGATTPITQLSSINVPEARMVVIKPY
RRF_HALHL       MIEDIQEDADRRMAKAVESLKHDLARLRTGRAHTSLLDQVNVEYYGMEVPIKQAANVSVEDSRTLAVTPF
RRF_THICR       MIDEIFDDANDRMTKSVENLESNFAKIRTGRAHPSILDAVKVDYYGSEVPVSQVANVNVEDARTLTVQPW
RRF_SHELP       MINEIKEDAKSRMAKCVEATKNQMAKVRTGRAHPSLLDSIKVPYYGTPTPLKQVGNVSIEDSRTLAITVF
RRF_METCA       MINDIQKRTAERMQKSIEALKHEFAKIRTGRAHPSLLEHIRVSYYGNEVPLTQVANVAVEDARSLAVTPW
RRF_THEAB       MKDPILKEAELRMKKSVEAIDEELKKLRTGRPSPALLEEIKIDYYGVPTPINQVATINVTEERSLIIKPW
RRF_SHEPW       MINEIKTDAQTRMDKCVESTKTQMAKVRTGRAHPSLLDTIQVPYYGSLTPLKQVASVSIGDARTLNVSVF
RRF_PASMU       MINEIKKDTQLRMEKSLETFKNHIAKVRTGRAQPSLLDGIQVEYYGSPTPLRQLANVVAEDARTLAVTVF
RRF_BRASO       --NFDLNELKRRMQGATQALKHELGGLRTGRASASMVEPVQVEAYGSHMPLNQLATVSVPEPRLLSVQVW
RRF_TOLAT       MINEIKTDAKDRMTKSVDSLKSHMSKIRTGRAQPALLDGIMVEYYGSATPLRQVANVVAEDSRTLAVSVF
RRF_COREF       MIDEILFDSEERMSNTVEHTREDLITIRTGRANPAMFNGVLAEYYGVPTPITQMSSISVPEPRMLIIKPY
RRF_ALTMD       --------AQERMEKSLVALKGQFSKIRTGRAHPSLLDGIMVPYYGVDTPLKQVANVVAEDSRTLALTVF
RRF_THENN       MVNPLIKEAKEKMKKTLEKIEDELKKMRTGKPSPAILEEIKVDYYGVPTPVNQLATISVSEERTLVIKPW
RRF_CAUSK       ----VLTRYKDRMDKAVLSLKEDFAGLRTGRASSGLLDQIMVNAYGSMVQLNTVASISVPEPRQINVNIW
RRF_PROMM       ------QELKDNMHKSVEATQRNFATIRTGRANPSLLDRINVEYYGTETPLKSLATISTPDSQTIAIQPF
RRF_MYCVP       ----------------------DLASIRTGRANPGMFNRIHVDYYGAVTPITQLSSINVPEARMVVIKPY
RRF_DESOH       MLELVYEEIEEKMGKTLEVFKNDLKKVRTGRASLALLDGIVVDYYGTPTPLNQLASLSVPESRLIVIQPW
RRF_THEM4       MKDPIVKKTEEKMKKSVNSIDEELKKLRTGRPSPALLEEIKVDYYGVPTPINQVATVNVTEERSLIIKPW
RRF_SHESH       MINEIKNDAKSRMEKCVESTKTQMAKVRTGRAHPSLLDTIKVSYYGSMTPLKQVGNVSIEDSRTLAVNVF
RRF_SHEFN       MIDTIMLDAQERMSKCVDATKNQMAKVRTGRAHPSLLDSIQVSCYGSMSPLKQVANVGVEDSRTLTVNVF
RRF_ALISL       MINEIKKDAQERMEKSVEALKNNLLKIRTGRAHPSLLSGLSVEYYGARTPINQVANIIAEDSRTLAITVF
RRF_ZYMMO       ---------ERRMKGAVESLKSDFSGLRTGRASTSLLDPVTVDVYGANMPLNQVATVSVPEPRMITVQVW
RRF_PHOLL       MINEIKKDAQDRMEKSVEALKNQISKVRTGRASPSLLDGIIVEYYGAPTPLRQLANVIAEDARTLAITVF
RRF_MYCMM       --------AEEKMEKAVSVAREDMATIRTGRANPGMFSRIVIDYYGTHTPITQLASINVPEARMVVIKPY
RRF_THESQ       MVNPFIKEAKEKMKRTLEKIEDELRKMRTGKPSPAILEEIKVDYYGVPTPVNQLATISISEERTLVIKPW
RRF_THEMA       MVNPFIKEAKEKMKRTLEKIEDELRKMRTGKPSPAILEEIKVDYYGVPTPVNQLATISISEERTLVIKPW
RRF_RHOPB       -----INELKRRMQGATQSLKHELGGLRTGRAAASMLEPVQVEAYGSHMPLNQLATVSVPEPRLLSVQVW
RRF_COXBN       MINDIINDSKSRMEKSLGSLKTELAKLRTGRAHPSLLEHIKVDYYNVETPLSQVASIAIENPRTLSITPW
RRF_COXB2       MINDIINDSKSRMEKSLGSLKTELAKLRTGRAHPSLLEHIKVDYYNVETPLSQVASIAIENPRTLSITPW
RRF_COXB1       MINDIINDSKSRMEKSLGSLKTELAKLRTGRAHPSLLEHIKVDYYNVETPLSQVASIAIENPRTLSITPW
RRF_SYNS3       ------------MRKSVEATQRNFNTIRTGRANPSLLDRINVEYYGADTPLKSLASLSTPDSQTIAVQPF
RRF_PORG3       ----LIAKATANMEKAVEYLDEQLSHVRAGKASPKLLDGIMVMYYGNATPLTQVASINTPDAKTIVVTPW
RRF_LEGPL       MINEIKQDSEKRMKKTIEALHTDMSKIRTGRANASLLDHVMVDYYGSPTPLSQVANITTSDSRTILVTPW
RRF_LEGPH       MINEIKQDSEKRMKKTIEALHTDMSKIRTGRANASLLDHVMVDYYGSPTPLSQVANITTSDSRTILVTPW
RRF_LEGPC       MINEIKQDSEKRMKKTIEALHTDMSKIRTGRANASLLDHVMVDYYGSPTPLSQVANITTSDSRTILVTPW
RRF_LEGPA       MINEIKQDSEKRMKKTIEALHSDMSKIRTGRANASLLDHVMVDYYGSPTPLSQVANITTSDSRTILVTPW
RRF_XANP2       ---------KRRMQGAVGVLRDELGGLRTGRASASLLDPITIEAYGARMPLNQVATVSVPEARLLSVQVW
RRF_NITSB       --NEIYEYARDHMQKSLDVLKKDFNTLRTGRVTTAVVENIKVDYYGAPTPLNQAASVVAADATTIVISPW
RRF_MYCUA       --------AEEKMEKAVSVAREDMATIRTGRANPGMFSRIVIDYYGTHTPITQLASINVPEARMVVIKPY
RRF_CHLSY       MLNDVISEYEAHLKKATEALRHHLASIRTGRASSALVEHLHVEAYGMTMPLNQLANISVPEPRLIVIQPY
RRF_CHLAA       MLNDVISEYEAHLKKATEALRHHLASIRTGRASSALVEHLHVEAYGMTMPLNQLANISVPEPRLIVIQPY
RRF_BORPE       ----IRKSAETRMAKSLETLKASLAKIRTGRAHTGILDHVQVEYYGSPVPISQVANVNLVDARTISVQPY
RRF_BORPA       ----IRKSAETRMAKSLETLKASLAKIRTGRAHTGILDHVQVEYYGSPVPISQVANVNLVDARTISVQPY
RRF_BORBZ       ----------EKMSKVLLSLDNEYKTLRTGRISSNIFDKIFIQYHGQRTPITQVSSIRIPEARLVVIQPW
RRF_BORBR       ----IRKSAETRMAKSLETLKASLAKIRTGRAHTGILDHVQVEYYGSPVPISQVANVNLVDARTISVQPY
RRF_BORAP       ----------EKMSKVLLSLDNEYKTLRTGRISSNIFDKIFIQYHGQRTPITQVSSIRIPEARLVVIQPW
RRF_RHOE4       MIDEALFEAEEKMEKAVTVAKDDLGSVRTGRANPGMFSRIVIDYYGSITPITQLASINVPEARMVIVKPY
RRF_RHOCS       MAEPDIKSFERRMDGAVETLRKEFGGLRTGRASTTLLDPVYVDAYGSSSPLNQVATVGVPEPRLITVQVW
RRF_ROSS1       MVNDVLREAESRMKKATEALRNHLATIRTGRASPALVEHLHVEAYGATLPLNQLATITVPEPRLLVIQPF
RRF_PORGI       ----LIAKATANMEKAVEYLDEQLSHVRAGKASPKLLDGIMVMYYGNATPLTQVASINTPDAKTIVVTPW
RRF_OENOB       -----LKEVKERMGKVSKAFQNELINIRAGRANPNILNKIQVEYYGAPTPLNQLASVQIPEARVLLITPY
RRF_CHLAD       MLNDVINEYEAHLKKATEALRHHLASIRTGRASAALVEHLHVEAYGTNMPLNQLANISVPEPRMIIIQPY
RRF_CAMJR       MLNEIFNKQKTQSEKSLEALKKDFTTLRTGKVNTHILDHITVDYYGTQTPLNQVATVLASDASTISITPW
RRF_CLOBM       MIKEILKKADEKMGKSIVALKRELASMKAGRANPAMLDRIDAEYYGSMTPLNQLANISVPEARVLLIQPW
RRF_CAUCR       ----VLSRYRDRMDKAVSALKEEFGSLRTGRASASLLDQVMVEAYGSTTPLNAVASVSVPEPRQINXXXX
RRF_CAUCN       ----VLSRYRDRMDKAVSALKEEFGSLRTGRASASLLDQVMVEAYGSTTPLNAVASVSVPEPRQINXXXX
RRF_BORGA       ----------EKMSKVLLSLDNEYKTLRTGRISSNVFDKIFIQYHGQKTPITQVSSIRIPEARLVVIQPW
RRF_SYNPW       ------------MRKSVEATQRNFNTIRTGRANSSLLDRISVEYYGAETPLKSLATLSTPDSQTIQIQPF
RRF_ROSCS       MVNDVLREAESRMKKATEALRNHLATIRTGRASPALVEHLHVEAYGATLPLNQLATITVPEPRMLVIQPF
RRF_PSEAE       MINEIKKEAQERMGKTLEALGHAFAKIRTGRAHPSILDSVMVSYYGADTPLRQVANVTVEDSRTLALAVF
RRF_PSEAB       MINEIKKEAQERMGKTLEALGHAFAKIRTGRAHPSILDSVMVSYYGADTPLRQVANVTVEDSRTLALAVF
RRF_PSEA8       MINEIKKEAQERMGKTLEALGHAFAKIRTGRAHPSILDSVMVSYYGADTPLRQVANVTVEDSRTLALAVF
RRF_BDEBA       ------KNAQAKMEKTLNSLSEELKKVRTGRAQVSMLDGIRVNYYGTPSPLSQVASISTPDAKSFLIAPW
RRF_SYNSC       ------------MRKSVEATQRNFNTIRTGRANSSLLDRISVEYYGAETPLKSLATLSTPDSQTIQIQPF
RRF_NOCFA       --------AEEKMEKAVSVAKDDLGTIRTGRANPGMFARVVVDYYGSPTPVTQMSSITVPEPRMVVIKPY
RRF_MYCTU       --------------------------IRTGRANPGMFSRITIDYYGAATPITQLASINVPEARLVVIKPY
RRF_MYCTA       --------------------------IRTGRANPGMFSRITIDYYGAATPITQLASINVPEARLVVIKPY
RRF_MYCBO       --------------------------IRTGRANPGMFSRITIDYYGAATPITQLASINVPEARLVVIKPY
RRF_TERTT       MINDIKKDAEARMKKTVEALGINFNKIRTGRAHPSILDGVSVSYYGSDTPLSQVANISVLDARTLSLSPW
RRF_PSEA7       MINEIKKEAQERMGKTLEALGHAFAKIRTGRAHPSILDSVMVSYYGADTPLRQVANVTVEDSRTLALAVF
RRF_PROMA       ---MLTQEVELNMQKSVEACQRNFNTIRTGRANTSLLDRLTVEYYGADTPLKSLATISTPDSQTLAIQPF
RRF_MESFL       --------AEQQMEDTVVAWQEHIKTIRTGRASATMLDKVMVNYYGTPTPVNQTAQISTPEPQLLVIKPW
RRF_COXBU       MINDIINDSKSRMEKSLGSLKTELAKLRTCRAHPSLLEHIKVDYYNVETPLSQVASIAIENPRTLSITPW
RRF_COXBR       MINDIINDSKSRMEKSLGSLKTELAKLRTCRAHPSLLEHIKVDYYNVETPLSQVASIAIENPRTLSITPW
RRF_CAMJ8       MLNEIFNKQKTQSEKSLEALKKDFTTLRTGKVNTHILDHITVDYYGTQTPLNQVATVLASDASTISITPW
RRF_CAMC1       MLNKIYDTQKEGCEKAIASLKRDFTTLRTGKVNINILDNVMVDYYGSPTPLNQVATVLTSDASTIAITPW
RRF_MYCLE       --------AEEKMEKAVSVAREDLSMIRTGRANPGMFSRLVIDYYGSATPITQLASINVPEARLVVIKPY
RRF_MYCLB       --------AEEKMEKAVSVAREDLSMIRTGRANPGMFSRLVIDYYGSATPITQLASINVPEARLVVIKPY
RRF_CAMJJ       MLNEIFNKQKTQSEKSLEALKKDFTTLRTGKVNIHILDHITVDYYGTQTPLNQVATVLASDASTISITPW
RRFC_DAUCA      ----LIEKSKERMEKTIENVKASFNSIRTXRSNPDMLDKIKVEYYGTPTSLKSIAQISTPDSSSLLVNPY
RRF_SYNS9       ------------MRKSLEATQRNFNTIRTGRANSSLLDRISVEYYGADTPLKSLATLSTPDSQTIQIQPF
RRF_SYNPX       ------------MRKSVEATQRNFNTIRTGRANSSLLDRISVEYYGAETPLKSLATLSTPDSQTIQIQPF
RRF_MAGSA       -----------RMDSAVEVLKKEFSGLRSGRASINLLDPVVVEAYGQTMPLSQCGTVGVPEPRMLTVQVW
RRF_LEPCP       ----IKKNAEAKMAKSVEAFKNELQKIRTGRAHPGILDQVHVDYYGSNLPLSQVANVTLIDARTISVQPW
RRF_EDWI9       MINEIRKDAETRMDKCVESFKGNISKIRTGRAHPNLLDGIQVEYYGTATPLRQLANIVAEDSRTLALTVF
RRF_SHEWM       MLNEIKKDAQDRMDKCVEATKTQMAKVRTGRAHPSLLDSIKVPYYGSLTPLKQVGNVSIEDSRTLAISVF
RRF_PROMH       MINEIKKDAQERMDKSVEALKSQINKVRTGRASPNLLDGIVVEYYGAPTPLNQVANVVAEDGRTLAITVF
RRF_ERWCT       MTNEIRKDAETRMDKCVEAFKNQINRIRTGRASPSILDGIHVEYYGSATPLRQLANVVVEDSRTLAISVF
RRF_DEIGD       --------ARERMGKAIEALENNLSVLRTGRANPGILKKVMVEYYGSSMPIDQVASITTPDARTLVITPW
RRF_CORJK       MIDDILLESEERMTSSVEHAREDLTTIRTGRANPSMFNGVVAEYYGVPTPITQMATISVPEPRMLLIKPY
RRF_CAMJE       MLNEIFNKQKTQSEKSLEALKKDFTTLRTGKVNIHILDHITVDYYGTQTPLNQVATVLASDASTISITPW
RRF_CAMC5       MLNDVYAAQKDGCEKAIASLKRDFTTLRTGKVNISILDHVMIDYYGSMTPLNQVATVLASDASTISITPW
RRF_ANAD2       IADDILDDLHGRILKTLDQLRTELAAVRTGRASLHLLDNVRVDYYGTPTPLNQVATLSVPEARLIVVKPW
RRF_MYCPA       --------------------------IRTGRANPGMFSRIVIDYYGAATPITQLASINVPEARLVVIKPY
RRF_MYCA1       --------------------------IRTGRANPGMFSRIVIDYYGAATPITQLASINVPEARLVVIKPY
RRF_BIFLO       ----LIDQAKEQMAKTVENTKENFSGIRTGRANPALLNGITVDYYGAPTPIKAVASIGVPEPRTLSVTPF
RRF_BIFLD       ----LIDQAKEQMAKTVENTKENFSGIRTGRANPALLNGITVDYYGAPTPIKAVASIGVPEPRTLSVTPF
RRF_AZOSB       MISDLKKTTEQKMQKSIDALKTDLAKIRTGRAHTGLLDHVMVEYYGSMVPINQVANITLIDARTIGVQTW
RRF_SALAI       MIDETLLEAEEKMERAIEHAKEEFGAIRTGRANAAMFSKIIIDYYGSPTPLPQMASIGVPEPRMVIIKPY
RRF_CORU7       MMDEILLECEERMTSSVEFAREDLTTIRTGRANPAMFNSVIAEYYGVPTPITQMATISVPEARMMLIKPY
RRF_BIFLI       ----LIDQAREQMAKTVENTKENFSGIRTGRANPALLNGITVDYYGAPTPIKAVASIGVPEPRTLSVTPF
RRF_CAMJD       MLNEIFNKQKTQSEKSLEALKKDFTTLRTGKINTHILDHITVDYYGNQTPLNQVATVLASDASTISITPW
RRF_THIDA       ----IKQSAEQKMGKTLEALKNDLAKVRTGRAHAGILDHVLVDYYGNPTPVPQVANVSLVDSRTLGVQPY
RRF_PSYWF       MINDIKKDGEDRMKKTLEVLENAFSKVRTGRAHPGMLSGVMVSYYGADTPLNQVASVNVEDSRTLLVQPF
RRF_METFK       --------AEQKMQKSIEALKADLSKVRTGRAHTGLLDHVQVEYYGSMVAINQVASVSLGDARTLNVQAY
RRF_ANASK       IADDILDDLHGRILKTLDQLRTELAAVRTGRASLHLLDNVRVDYYGTPTPLNQVATLSVPEARLIVVKPW
RRF_TREPS       ----IAECYEQKMKKSLSALQEGFNTLRTERATAHLLDQITVDYYQQPTALSQVATVSVPEARLIIIQPW
RRF_TREPA       ----IAECYEQKMKKSLSALQEGFNTLRTERATAHLLDQITVDYYQQPTALSQVATVSVPEARLIIIQPW
RRF_SINMW       ---VDLKELKRRMDGAISAFKHDIASLRTGRASANVLDPVTVEAYGSRMPLNQVANITVPEARMLSVSVW
RRF_MICLC       MIQETLQSAEEQMDRTIEATREDFVSVRTGRANPGLYSKVMVDYYGSFTPLQQLASFTTTDARTLLITPF
RRF_BIFAA       ----IVDQAKAQMAKSVESTKENFSGIRTGRANPALLNGITVDYYGAPTPLKAVATIGVPEPRTLAVTPF
RRF_SALTO       MIDETLLEAEEKMERAIEHAKEEFGAIRTGRANAAMFSKIVIDYYGSPTPLPQMASIGVPEPRMVIIKPY
RRF_RICBR       MDKVTLKKLQEKMDKALKVLDHELKGLRTGRASVNLLDSVTVEAYGDRMPLSQVASLTTPDARTINVQVW
RRF_RICB8       MDKVTLKKLQEKMDKALKVLDHELKGLRTGRASVNLLDSVTVEAYGDRMPLSQVASLTTPDARTINVQVW
RRF_MYCBT       --------------------------IRTGRANPGMFSRITIDYYGAATLITQLASINVPEARLVVIKPY
RRF_MYCBP       --------------------------IRTGRANPGMFSRITIDYYGAATLITQLASINVPEARLVVIKPY
RRF_MARMM       ---------KRRMDGAIESLRKEFAGLRTGRASAGLLEPIKVDAYGTPTPINQLGNISVPEPRMITLQVW
RRF_LEPBL       ----IISGMKTKMDKTIDLVKKDFGTVRTGRANPSLVEDIRVDYYGTLTPINQLGNISVPEPRMLVISPY
RRF_LEPBJ       ----IISGMKTKMDKTIDLVKKDFGTVRTGRANPSLVEDIRVDYYGTLTPINQLGNISVPEPRMLVISPY
RRF_BORBU       ----------EKMNKVLLSLDNEYKTLRTGRISSNIFDRICIQYHDRRTPITQVSSIRIPEARLVVIQPW
RRF_ANADE       IADDILGDLHGRILKTLDQLRTDLSAVRTGRASLHLLDNVRVDYYGTPTPLNQVATMSVPEARLIVVKPW
RRF_YERPY       MINEIRKDAEVRMEKCLEAFQNHISKIRTGRASPSILDGIQVEYYGTATPLRQLANIVVEDSRTLALTVF
RRF_YERPS       MINEIRKDAEVRMEKCLEAFQNHISKIRTGRASPSILDGIQVEYYGTATPLRQLANIVVEDSRTLALTVF
RRF_YERPP       MINEIRKDAEVRMEKCLEAFQNHISKIRTGRASPSILDGIQVEYYGTATPLRQLANIVVEDSRTLALTVF
RRF_YERPN       MINEIRKDAEVRMEKCLEAFQNHISKIRTGRASPSILDGIQVEYYGTATPLRQLANIVVEDSRTLALTVF
RRF_YERPG       MINEIRKDAEVRMEKCLEAFQNHISKIRTGRASPSILDGIQVEYYGTATPLRQLANIVVEDSRTLALTVF
RRF_YERPE       MINEIRKDAEVRMEKCLEAFQNHISKIRTGRASPSILDGIQVEYYGTATPLRQLANIVVEDSRTLALTVF
RRF_YERPB       MINEIRKDAEVRMEKCLEAFQNHISKIRTGRASPSILDGIQVEYYGTATPLRQLANIVVEDSRTLALTVF
RRF_YERPA       MINEIRKDAEVRMEKCLEAFQNHISKIRTGRASPSILDGIQVEYYGTATPLRQLANIVVEDSRTLALTVF
RRF_YERP3       MINEIRKDAEVRMEKCLEAFQNHISKIRTGRASPSILDGIQVEYYGTATPLRQLANIVVEDSRTLALTVF
RRF_THERP       MIDEILRDAEQRMKKSIELLRQELAGIRAGRAAPSLLEHLEVNYYGTPTPLNQLATISAPEARLLVVQVW
RRF_GRABC       --NTLKQDLTRRMDGALETLRREFAGLRAGRASPALLEPVRVDAYGSEVPLTQVGNIGVPESRMLTVQVW
RRF_RALPJ       ------KNAEQKMQKSIEALKTDLAKIRTGRAHTGLLDHVQVDYYGSMVPISQVANVTLVDARTIGVQPW
RRF_BURVG       ---------EQKMQRSIEAFKNDLAKIRTGRAHTGLLDHVQVDYYGSMVPISQVANLTLVDARTIGVQPW
RRF_BURTA       ---------EQKMQRSIEAFKNDLAKIRTGRAHTGLLDHVQVDYYGSMVPISQVANLTLVDARTIGVQPW
RRF_BURCH       ---------EQKMQRSIEAFKNDLAKIRTGRAHTGLLDHVQVDYYGSMVPISQVANLTLVDARTIGVQPW
RRF_BURCC       ---------EQKMQRSIEAFKNDLAKIRTGRAHTGLLDHVQVDYYGSMVPISQVANLTLVDARTIGVQPW
RRF_BURCA       ---------EQKMQRSIEAFKNDLAKIRTGRAHTGLLDHVQVDYYGSMVPISQVANLTLVDARTIGVQPW
RRF_BURPP       --------AEQKMQRSIDAFKNDLSKIRTGRAHTGLLDHIQCDYYGSPVPISQVANLTLIDARTIGVQPW
RRF_BURP8       --------AEQKMQRSLDAFKNDLSKIRTGRAHTGLLDHIQVDYYGSPVPISQVANLTLVDARTIGVQPW
RRF_BURCM       ---------EQKMQRSIEAFKNDLAKIRTGRAHTGLLDHVQVDYYGSMVPISQVANLTLVDARTIGVQPW
RRF_BURA4       ---------EQKMQRSIEAFKNDLAKIRTGRAHTGLLDHVQVDYYGSMVPISQVANLTLVDARTIGVQPW
RRF_RHOPT       -----VNELKRRMQGAAQSLKHELGGLRTGRASASMLEPVQVDAYGSHMPLNQVATVSVPEPRLISVQVW
RRF_RHOPA       -----VNELKRRMQGAAQSLKHELGGLRTGRASASMLEPVQVDAYGSHMPLNQVATVSVPEPRLISVQVW
RRF_RHIME       ---VDLKELKRRMDGAIAAFKHDIASLRTGRASANVLDPVTVEAYGSRMPLNQVANITVPESRMLSVSVW
RRF_NOCSJ       MINDILNEADGKMDKSVEATREEFAAIRAGRVNPSMFNKIVVDYYGSPTPLQQLASFTAPEARIILIAPY
RRF_HAHCH       ------------------ALGHAFAKIRTGRANPAILESVMVSYYGTDTPLTQIANVVVEDARTLSVTPW
RRF_DESVV       ----ILLDAEERMEKAIAALEREFSRLRTGRASASLVDGIKVDYYGTPTPISQVASVAVPDSRCITIQPW
RRF_DESVH       ----ILLDAEERMEKAIAALEREFSRLRTGRASASLVDGIKVDYYGTPTPISQVASVAVPDSRCITIQPW
RRF_BURCJ       ---------EQKMQRSIEAFKNDLAKIRTGRAHTGLLDHVQVDYYGSMVPISQVANLTLVDARTIGVQPW
RRF_ACIAD       MINDLKKDSEQRMQKTLESLEQGFAKVRTGRAHPSILNGVMVPYYGSDVPLNQVANVGIEDSRTLVVQPF
RRFC_SPIOL      --SLIETNTKQRMEKTIETIRSNFNSVRTNRASPTMLDRIEVEYYGTPVSLKSIAQISTPDASSLLISPY
RRF_CUPTR       ------KSAEQKMQKSIEAFKADLAKIRTGRAHTGLLDHVQVDYYGSMVPISQVAAIGLADARTITVQPW
RRF_BURPS       ----IKKSVEQKMQRSIEAFKNDLAKIRTGRAHTGLLDHVQVDYYGSMVPISQVANLTLVDARTIGVQPW
RRF_BURP6       ----IKKSVEQKMQRSIEAFKNDLAKIRTGRAHTGLLDHVQVDYYGSMVPISQVANLTLVDARTIGVQPW
RRF_BURP1       ----IKKSVEQKMQRSIEAFKNDLAKIRTGRAHTGLLDHVQVDYYGSMVPISQVANLTLVDARTIGVQPW
RRF_BURP0       ----IKKSVEQKMQRSIEAFKNDLAKIRTGRAHTGLLDHVQVDYYGSMVPISQVANLTLVDARTIGVQPW
RRF_BURMS       ----IKKSVEQKMQRSIEAFKNDLAKIRTGRAHTGLLDHVQVDYYGSMVPISQVANLTLVDARTIGVQPW
RRF_BURMA       ----IKKSVEQKMQRSIEAFKNDLAKIRTGRAHTGLLDHVQVDYYGSMVPISQVANLTLVDARTIGVQPW
RRF_BURM9       ----IKKSVEQKMQRSIEAFKNDLAKIRTGRAHTGLLDHVQVDYYGSMVPISQVANLTLVDARTIGVQPW
RRF_BURM7       ----IKKSVEQKMQRSIEAFKNDLAKIRTGRAHTGLLDHVQVDYYGSMVPISQVANLTLVDARTIGVQPW
RRF_AZOSE       ---------EQKMQKSIDVLKADLAKVRTGRAHTGLLDHVMVEYYGSMVPISQVSNVTLIDARTIGVQVW
RRF_PROMS       ------KEIQENMNKSIEATQRNFNTIRTGRANASLLDRVSVEYYGAETPIKSLATISTVDSQTISIQPF
RRF_BURXL       --------AEQKMQRSIDAFKNDLSKIRTGRAHTGLLDHIQCDYYGSPVPISQVANLTLIDARTIGVQPW
RRF_BORPD       ----IRKSAETRMAKSLDTLKVNLSKIRTGRAHTGILDHVQVEYYGSPVPVSQVANVNLVDARTISVQPY
RRF_BORA1       ----IRNSAESRMSKSLDTLKVNLSKIRTGRAHAGILDHVQVEYYGSPVPVGQVANLNLVDARTISVQPY
RRF_ACIBY       MINDLKKDSEQRMLKTLESLEQGFAKVRTGRAHPSILNGVMVPYYGSDVPLNQVANVGVEDSRTLIVQPF
RRF_ACIBT       MINDLKKDSEQRMLKTLESLEQGFAKVRTGRAHPSILNGVMVPYYGSDVPLNQVANVGVEDSRTLIVQPF
RRF_ACIB5       MINDLKKDSEQRMLKTLESLEQGFAKVRTGRAHPSILNGVMVPYYGSDVPLNQVANVGVEDSRTLIVQPF
RRF_ACIB3       MINDLKKDSEQRMLKTLESLEQGFAKVRTGRAHPSILNGVMVPYYGSDVPLNQVANVGVEDSRTLIVQPF
RRF_RICFE       ---------QEKMDKALKVLDHELKGLRTGRASVNLLDSVTVEAYGSKMPLSQVASLSTPDARTINVQVW
RRF_POLNA       ----IKQQATQKMQQSLESFQHNLTKIRTGRANPGLLDTVHVDYYGSMVPISQVANVALLDARTISVSPW
RRF_PARL1       -----IDDTERRMRGALQSLKQEFAGLRTGRATASLLEPIVVEAYGQSMPINQVGTIGVPEPRMLTVQVW
RRF_LEPIN       -SDAIISGMKTKMDKTIDLVKKDFGTIRTGRANPSLVEDIRVDYYGNQTPINQLGNISVPEPRMLVISPY
RRF_LEPIC       -SDAIISGMKTKMDKTIDLVKKDFGTIRTGRANPSLVEDIRVDYYGNQTPINQLGNISVPEPRMLVISPY
RRF_FLAJ1       ----ILESTEESMNGSIAHLEKEFLNIRAGKASPAMLGGVFVDYYGSATPLSQVSKISVPDARTITLQPF
RRF_DEIDV       --------ARERMGKAIEALESNLSVLRTGRANPGILKKVIVDYYGSTMPIDQVASITTPDARTLVITPW
RRF_BEUC1       MIDDILLEAEDKMDKAVEVARDELGAIRTGRANAALFQKILVDYYGAPTPLQQLAGITIPEARVILINPY
RRF_ACIBS       MINDLKKDSEQRMLKTLESLEQGFAKVRTGRAHPSILNGVMVPYYGSDVPLNQVANVGVEDSRTLIVQPF
RRFC_ORYSJ      --SVIEDQARERMEKAIETVQNNFNTVRTGRANPAMLDRIEVEYYGTPVNLKSIAQINTPDATSLLIQPY
RRFC_ORYSI      --SVIEDQARERMEKAIETVQNNFNTVRTGRANPAMLDRIEVEYYGTPVNLKSIAQINTPDATSLLIQPY
RRF_SYNFM       MLNDVFADARDRMSKALDNLETDYKRLRTGRASVSLVDGIRAEYYGTPTALNQLATITIPEPRTIMIQPW
RRF_NITMU       ----IKKSAEQKMQKSLEALKLDLGKIRTGRAHTGLLDHVTVDYYGNPTAINQVANISLADARTITVAPW
RRF_CHRVO       MINEIKKSAEQKMQKTLEAFKNDLAKVRTGRAHTGILDHVMVDYYGSDVPVNQVANVTLIDARTIGVQPW
RRF_BEII9       -----ISDLKRRMQGAIATLKHELGGLRTGRATASLLEPVHVDAYGQSLPLNQVATISVAEARMLSVQVW
RRF_UNCTG       --------AEEVMKRTIDRLKCELSSIRTGRVNSAAIETIKVESYGSIMPINQIASISVSDARTIEIRPW
RRF_FLAPJ       ----ILDSTKESMEGSIAHLEKEFLNIRAGKASPAMLGSVFVDYYGSATPLSQVAKISVPDARTITLQPF
RRF_DELAS       -----IKKTTEKMGQSIEALKNNLARVRTGRANPSLLDSIHVDYYGSMVPLSQVANVNLLDARTISVQPW
RRF_CARHZ       MIQDILKEAQDHMQKAIEVLKKEFATMRVGRATPALLEKVVVEYYGTQMPVNQLATISAPEPRLLVIQPW
RRF_BACTN       -----LDNAQEKMDMAVMYLEEALAHIRAGKASTRLLDGIRVDSYGSMVPISNVAALSTPDARSITIKPW
RRF_AERS4       MINEIKNDAKDRMAKSVESLKTQMSKIRTGRAHPSLLDGIQVEYYGAATPLKQLANVVAEDARTLSISIF
RRF_YERE8       MINEIRKDTEVRMEKCLEVFQNHISKIRTGRASPSILDGIQVEYYGTATPLRQLANIVVEDSRTLALTVF
RRF_RUTMC       MLNEIQQDAQSRMNKSVASLKNAFSKIRANRAHSSLLEQIHVDYYGSMVPLSQVANISVEDSRTFKVSPW
RRF_RALSO       ----IKKSAEQKMQKSIDAFKADLAKVRTGRAHTGLLDHVQVDYYGSMVPISQVANLGLADARTISVQPW
RRF_PSYA2       MIKEIKQDGEARMQKTLEALESTFSKVRTGRAHPGMLSGVMVSYYGSDTPLNQVASVNVEDSRTLLVQPF
RRF_MICAN       -----LAEVQDQMQKTVESTQRAFNTIRTGRANASLLDRIVVEYYGMETPLKSLATISTPDATTIAIQPF
RRF_KINRD       -------EAEEKMEKAIEVAKGDFGAIRTGRANAAMFHKIMVDYYGAPTPLQQLASFQIPEARSVLITPF
RRF_DICNV       MTQEILKDTQSRMKKSVQTLEADLTKIRTGRANVSLLDHIEVEYYGAMVPLSQAANVNVTDHRTLSIQIW
RRF_BIFA0       MANVV-DQSKEQMKKSVESTKENFAGIRTGRANPALLNGIVVEYYGAPTPLKHVATIGVPEPRTLSVTPF
RRF_BACV8       -AKTCINDAQEKMDMAVMYLEEALAHIRAGKASTRLLDGIRVDSYGSMVPISNVAAVTTPDARSIAIKPW
RRF_RHOBA       ----ILMDAEERMDKAVSVLQNNLSGIRTGRANPGLVDSIKVEVYGSLTPLKQLASIGTPEPQQILIRPY
RRF_PROM9       ------QEIQENMNKSIEATQRNFNTIRTGRANASLLDRISVEYYGAETPIKSLATISTVDSQTISIQPF
RRF_BURS3       ---------EQKMQRSIDAFKSDLAKIRTGRAHTGMLDHVQVDYYGSMVPISQVANMTLVDARTIGVQPW
RRF_RHOS5       -----LDAIQRRMDGAMHALRTEFGSLRTGRASASILEPIHVDAYGQQTPLNQLGTINVPEPRMVVINVW
RRF_RHOPS       -----INEVKRRMHGASQALQHELGGLRTGRASASMLEPVQVDAYGTHMPLNQVATVSVPEPRLLSVQVW
RRF_PSEFS       MINEIKKDAQARMQKSLESLSHAFGQIRTGKAHPSILGSVMVPYYGSDTPISSVANITVKDSRTLQVVAF
RRF_PROM5       ------QEIQSSMNKSVEATQRNFNTIRTGRANASLLDRISVEYYGAETPIKSLASIATVDSQTISIQPF
RRF_PHOPR       MINEIQNDAQERMGKSVDALKNQLVKIRTGRAHPSLLDTIYVEYYGANTPLKQLANVVAEDSRTLAITVF
RRF_MYXXD       MSGDVVAELKGRIDKSLEGLRTDLTRVRTGRASIAILEGVRVDYYGTPTPLSGVASVNAPEPRLITIKPW
RRF_DEIRA       ---------REKMNKAIEAFENNLSVLRTGRANPGILKKIVVDYYGSQMPIDQVASITTPDPRTLVITPW
RRF_CAMFF       MLDEIYKNQKAFSDKALEVLKRDFTTLRTGKVNINIVDHINVDYYGSPTALNQVATVLATDASTISISPW
RRF_BURM1       ---------EQKMQRSIEAFKNDLAKIRTGRAHTGLLDHVQVDYYGSMVPISQVANLTLVDARTIGVQPW
RRF_BRUSU       -----INDLKRRMEGAVNALKHDLGGLRTGRASASLLEPITIEAYGSTMPINQVANISVPESRMLSVSVW
RRF_BRUSI       -----INDLKRRMEGAVNALKHDLGGLRTGRASASLLEPITIEAYGSTMPINQVANISVPESRMLSVSVW
RRF_BRUO2       -----INDLKRRMEGAVNALKHDLGGLRTGRASASLLEPITIEAYGSTMPINQVANISVPESRMLSVSVW
RRF_BRUC2       -----INDLKRRMEGAVNALKHDLGGLRTGRASASLLEPITIEAYGSTMPINQVANISVPESRMLSVSVW
RRF_BRUAB       -----INDLKRRMEGAVNALKHDLGGLRTGRASASLLEPITIEAYGSTMPINQVANISVPESRMLSVSVW
RRF_BRUA2       -----INDLKRRMEGAVNALKHDLGGLRTGRASASLLEPITIEAYGSTMPINQVANISVPESRMLSVSVW
RRF_BRUA1       -----INDLKRRMEGAVNALKHDLGGLRTGRASASLLEPITIEAYGSTMPINQVANISVPESRMLSVSVW
RRF_RICPU       ---------QEKMEKALKVLDHELKGLRTGRASVNLLDSVTVEAYGSKMPLSQVASLSTPDARTINVQVW
RRF_PSEA6       MIDEINVDARQRMEKSVLALRGQFTKIRTGRAHPSLLDSIMVPYYGAPTPLKQLANVIAEDSRTLALTVF
RRF_BRUME       -----INDLKRRMEGAVNALKHDLGGLRTGRASASLLEPITIEAYGSTMPINQVANISVPESRMLSVSVW
RRF_BRUMB       -----INDLKRRMEGAVNALKHDLGGLRTGRASASLLEPITIEAYGSTMPINQVANISVPESRMLSVSVW
RRF_SORC5       MLEDVIKELREGIEKAIEALRRDLAKVRTGRANAAMLDGIRVDYYGVPTPIVQMATVSVPEPRLISVKPW
RRF_SODGM       MINEIRKDAEIRMEKCVDAFKSHISKVRTGRASPSLLDGIQIDYYGLLTPLRQLANIIAEDSRTLAITVF
RRF_RHOSK       -----LDAIQRRMDGAMHALRTEFGSLRTGRASASILEPIHVDAYGQQTPLNQLGTINVPEPRMVVINVW
RRF_RHOS1       -----LDAIQRRMDGAMHALRTEFGSLRTGRASASILEPIHVDAYGQQTPLNQLGTINVPEPRMVVINVW
RRF_RALME       ------KSVEQKMQKSIEAFKADLAKVRTGRAHTGLLDHVQVDYYGSMVPISQVAAVSLADARTISVQPW
RRF_RALEH       ------KSVEQKMQKSIEAFKADLAKIRTGRAHTGLLDHVQVDYYGSMVPISQVAAVGLADARTITVQPW
RRF_KOSOT       MKNMLLKDAEERMKKSTEKISEEFSHMRTGRPSPAILEEIKVDYYGVPTPINQLATINVSEDRSLIIRPW
RRF_BACFR       ----IIEESQEKMDMAVMYLEEALAHIRAGKASTRLLDGIRVDSYGSMVPISNVAAVTTPDARSITIKPW
RRF_BACFN       ----IIEESQEKMDMAVMYLEEALAHIRAGKASTRLLDGIRVDSYGSMVPISNVAAVTTPDARSITIKPW
RRF_RHOS4       -----LDAIQRRMDGAMHALRTEFGSLRTGRASASILEPIHVDAYGQQTPLNQLGTINVPEPRMVVINVW
RRF_RHOP2       -----INDLKRRMQGASQALQHELGGLRTGRAAASMLEPVQVDAYGTHMPLNQLATVTVPEPRLLSVQVW
RRF_BORT9       ----------EKMSKVLLSLESEYKSLRTGRINSSLFDKVLVDYYGEKTPLTRVANVSIPEARLIVIQPW
RRF_ARTCA       -------EAEEKMDKAVEVAKEDFASIRTGRANPGLYNRVLVDYYGSPTPLQQLASFAIPDARTILITPF
RRF_AGRT5       MSGIDLNDIKRRMDGAINAFKSDIASLRTGRASANILDPVTIDAYGSRVPLNQVANITVPEPRMLGVNIW
RRF_AGRRK       -----LKELKRRMDGAIAAFKSDIASLRTGRASANILDPVTIEAYGSRMPLNQVANITVPEPRMLSVSVW
RRF_RICM5       -----------KMEKALKVLDHELKGLRTGRASINLLDSVTVEAYGSKMPLSQVASLSTPDARTINVQVW
RRF_PSYCK       MIQEIKQDGEARMQKTLEALESTFSKVRTGRAHPGMLTGVMVSYYGSPTPLNQVASVNVEDSRTLLVQPF
RRF_RICCN       ---------QEKMEKALKVLDHELKGLRTGRASVNLLDSVTVEAYGSKMPLSQVASLSTPDARTINVQVW
RRF_RICCK       ---------QEKMEKALKVLDHELKGLRTGRASVNLLDSVIVEAYGSKIPLSQVASISTPDARTINVQVW
RRF_RHOFD       -----------KMDQSIEAFKHNLTKIRTGRANPALLDTVHVDYYGAMLPISQVANVSLLDARTISVQPW
RRF_RALEJ       ------KSVEQKMQKSIEAFKADLAKVRTGRAHVGLLDHVQVDYYGSMVPISQVANIGLGDARTITVQPW
RRF_METSB       ---------KRRMQGAIATLKHELGGLRTGRASASLIEPVNVEAYGQTMPLNQVATISVPEPRMLSVQVW
RRF_METPP       ---------EQKSARSIESFKSELQKIRTGRAHPGILDQVHVEYYGSMVSISQVANVSLLDARTISVQPW
RRF_GEOSF       MTKDVISGMSSHMDKTIDSLRKEYQKVRTGRASTSLLDEIKVDFYGTLSPLNQVATLAVPEPRTITLQPW
RRF_DESMR       ----VLKDAEDRMKKALAALDKEFSRLRTGRATTSLLDGVRVDYYGTATQLDQLASVATPDSRTITIQPW
RRF_RICAE       ---------QEKMEKALKVLDHELKGLRTGRASVNLLDSVTVEAYGSKMPLSQVASLSTPDARTINVQVW
RRF_POLNS       --------ANQKMEKSLEALKTNLVKVRSGRANPGILEHIHVDYYGNPTPLSQVASLGLADARTINVQPF
RRF_AGRVS       -AGIDLNDIKRRMDGAINAFKSDLASLRTGRASANILDPVMVEAYGSRVALNTVANITVPEPRMLGVSIW
RRFC_ARATH      ---------KSKMEKTIETLRTSFNSIRTGRSNAAMLDKIEVEYYGSPVSLKSIAQISTPDGSSLLLQPY
RRF_WOLSU       --NEVYQYTKEHMEKTIDAMKRDFATLRTGKVSTAIVEPIRVDYYGTPTPLSQVGSVIASDATTLVISPW
RRF_RICRS       ---------QEKMEKALKVLDHELKGLRTSRASVNLLDSVTVEAYGSKMPLSQVASLSTPDARTINVQVW
RRF_RICRO       ---------QEKMEKALKVLDHELKGLRTSRASVNLLDSVTVEAYGSKMPLSQVASLSTPDARTINVQVW
RRF_FRATW       MINDILKDAENRMKKSLEVLADDLAKIRTGRAHPDLLAHVTIDYYGVETPITQAANITVLDARTLGITPW
RRF_FRATO       MINDILKDAENRMKKSLEVLADDLAKIRTGRAHPDLLAHVTIDYYGVETPITQAANITVLDARTLGITPW
RRF_FRATN       MINDILKDAENRMKKSLEVLADDLAKIRTGRAHPDLLAHVTIDYYGVETPITQAANITVLDARTLGITPW
RRF_FRATM       MINDILKDAENRMKKSLEVLADDLAKIRTGRAHPDLLAHVTIDYYGVETPITQAANITVLDARTLGITPW
RRF_FRATH       MINDILKDAENRMKKSLEVLADDLAKIRTGRAHPDLLAHVTIDYYGVETPITQAANITVLDARTLGITPW
RRF_FRATF       MINDILKDAENRMKKSLEVLADDLAKIRTGRAHPDLLAHVTIDYYGVETPITQAANITVLDARTLGITPW
RRF_CLAMS       ----VLADARDRMGKAVEAVKEDFGSVRTGRANPALFQKVMVEYYGSPTPLGQLASMNNPEARTLIVTPY
RRF_CLAM3       ----VLADARDRMGKAVEAVKEDFGSVRTGRANPALFQKVMVEYYGSPTPLGQLASMNNPEARTLIVTPY
RRF_RICAH       ---------QEKMDKALKVLDHELKGLRTGRASVNLLDSVTVEAYGSKMLLSQVASLSTPDARTINVQVW
RRF_GEOSL       MTKDVINDMKSHMEKSVESLRREYQKVRTGRANTGLLDEIRVDFYGNPSPLNQVATLAVPEPRTITIQPW
RRF_FRATT       MINDILKDAENRMKKSLEVLADDLAKIRTGRAQPDLLAHVTIDYYGVETPITQAANITVLDARTLGITPW
RRF_FRAT1       MINDILKDAENRMKKSLEVLADDLAKIRTGRAQPDLLAHVTIDYYGVETPITQAANITVLDARTLGITPW
RRF_ERYLH       ---------ERRMAGAVESLKSDLSGLRTGRANTSLLDPVVVEVYGAMMPLNQVATVNAPEPRMLAVQVW
RRF_DIAST       -----IKKTTEKMDQSIAAFKNNLAKIRTGRANPQLLDTIHVEYYGSMVPLSQVANVALLDARTISVQPW
RRF_BARQU       ----IMDDLKRRMDGAISAFQHELGGLRTGRASASLLEPLTVEAYGSVVHINQVANISVPEPRMLSVSVW
RRF_ACISJ       -----IKKTTEKMDQSIAAFKNNLAKIRTGRANPQLLDTIHVEYYGSMVPLSQVANVALLDARTISVQPW
RRF_ACIAC       ----IKKNTEAKMDQSIVAFKNNLAKIRTGRANPALLDSVQVEYYGSMVPLSQVANVSLIDARTISVQPW
RRF_RICPR       ---------QEKMEKAIKVLGNELKGLRTGRASINFLDSVTVEAYGSKIPLSQVASLSTPDARTINVQVW
RRF_AMOA5       -----LDKSDQLMQKACTHTQIEFSKIRAGRAMPDMLDGISILYYNAMTPLNQVAAITTPDARTLVIKPW
RRF_ALCBS       MIDDIRSDAQSRMKKSLEALDTAMKRVRTGRAHPSLLDNITIEYYGAETPLNQMGNISVEEGRTLTISPF
RRF_STRM5       MLNDIKNNAQTRMAKSIDALKHTLTSIRTGRATPALLDRVTVNAYGASTPLNQVASISNADAHSLLVTPF
RRF_OCHA4       -----INDLKRRMEGAINSLKHDLNGLRTGRASASLLEPIVIEAYGSTMPINQVANITVPESRMLSVSVW
RRF_BAUCH       MINNIRQDAEVRMEKCLETFKNNISKLRTGRANPNLLDNIKVDYYGSIMPLRQLANIIVEDTRTLVITLF
RRF_RHIEC       -----IKELKRRMDGAVSAFKSDIASLRTGRASANILDPVTIEAYGSRVPLNQVANITVPEPRMLTVSVW
RRF_RHIE6       -----IKELKRRMDGAVSAFKSDIASLRTGRASANILDPVTIEAYGSRVPLNQVANITVPEPRMLTVSVW
RRF_BART1       ----IMDDLKRRMDGAIVAFKHELGGLRTGRASASLLEPLTVESYGSVVHINQVANISVPEPRMLFVSVW
RRF_RENSM       -------EAEEKMDKAVEVAKEDFSAVRTGRANPGLFAKVMVDYYGAPTPLQQLASFAVPEARTLLITPF
RRF_POLSJ       ------QNAEQKMQQSVDSFKNSLTKIRTGRANPGLLDTVHVDYYGSMVPISQVANVSLLDARTISVSPW
RRF_NOVAD       ---------ERRMKGAVESLRGDLSGLRTGRANTALLDPIVVEVYGSHMPLAQVATVSAPEPRLLSVQVW
RRF_FRAAA       --------AEEKMEKAVSVAKEDFANIRTGRITPAVFSKIVVDYYGAPTPVQQLASFHIPEPRMVIITPY
RRF_BORHD       ----------EKMDRVLLSLDSEYKSLRTGRISSALFDKVLVDYYGEKTPLTRVANISIPEARLIVIQPW
RRF_ROSDO       ---------ERRMDGAISSLKTEFASLRTGRASASMLEPVMVDAYGQRTPINQVGTVNVPEPRMVTINVW
RRF_PSEPG       MINDIKKDAQERMTKSLEALGRNLAAIRTGRAHPSILDTVKVTAWGSEMPLNQVAAITVEDARTLKIVAH
RRF_PROM4       ---MITKELEQNMRKSVEAAQRNFNTIRTGRANTSLLDRLTVEYYGADTPLKSLATISTPDSQTISIQPF
RRF_DINSH       ---------KRRMDGALASLRTEFASLRTGRASASMLEPVMVDAYGQKTPINQVGTVNVPEPRMVTINVW
RRF_GRAFK       ----ILEEAKEGMEKAITHLKKQLSNIRAGKASPSMLGSVMVEYYGSQTPLQQVANVNTPDARTLSIQPF
RRF_BORRA       ----------EKMGRVVLSLESEYKSLRTGRVNSALFDKVFVDYYGEKTPLTRVANISVPEARLIVIQPW
RRF_BORDL       ----------EKMGRVVLSLESEYKSLRTGRVNSALFDKVFVDYYGEKTPLTRVANISVPEARLIVIQPW
RRF_BARHE       ----IMDDLKRRMHGAISAFKHELGGLRTGRASASLLEPLTVEAYGSVVHINQVANISVPEPRMLSVSVW
RRF_ARTS2       -------EAGDKMDKAVEVAKEDFASIRTGRATPGLYNRVLVDYYGSPTPLQQLASFAVPDARTILITPF
RRF_RHILW       -----IKELKRRMDGAVSAFKSDIASLRTGRASANILDPVTIEAYGSRMPLNQVANITVPEPRMLSVSVW
RRF_NITEC       -----IKKATEKMQKSLDALKVDFSKVRSGRPHTGLLDHITVDYYGTPTPIRQLANVTLADARTIGVIPW
RRF_BRASB       --NFDLNELKRRMQGATQALKHELGGLRTGRASASMVEPVQVEAYGSHMPLNQLATVSVPEPRLLSVQVW
RRF_THELT       MRHPLVKNAEDRMNKAVEKISEELRKMRTGRPSPAILEEIKVDYYGAQTPISQLATVNITEDRALIIKPW
RRF_SULNB       MVNEIFEHTKENMDKSLEALKRDFASLRTGKVTTNIVDNIKVDYYGTPTPLNQVGSVIATDATTISITPW
RRF_SHEAM       MIEDIKKDAQDRMGKCVEATKAQMAKVRTGRAHPSLLDTIQVNYYGSMTPLKQVGNVTIEDSRTLAVNVF
RRF_SALRD       ----ILDEADEEMEESVSYMRSELRTIRAGRASPAMLENVTVEYYGSQTPLEQVASVSAPQPDLIVVQPF
RRF_RICTY       ---------QEKMEKAIKVLGNELKGLRTGRASVNFLDSVTVEAYGSKVPLAQVASLSTPDARTINVQVW
RRF_RHISN       ---VELKELKRRMDGAIAAFKHDIASLRTGRASANVLDPVTVEAYGSRMPLNQVANIMVPEPRMLSVSVW
RRF_SACEN       MIDETLLEGEEKMQKAVEVAKDELATVRTGRANPAMFSGIVVDYYGSPTPLNQLASISVPEARLVVIKPY
RRF_RHIL3       -----IKELKRRMDGAISVFKGDIASLRTGRASANILDPVTVEAYGSRMPLNQVANITVPEPRMLSVSVW
RRF_STRCO       ----------------------DFAAIRTGRAHPAMFNKIVAEYYGAPTPINQLASFSVPEPRMAVVTPF
RRF_PSEE4       MINDIKKDAQERMGKSIEALGRNLASIRTGRAHPSILDSVKVPAWGSDMPLNQVAAITVEDARTLKIVAH
RRF_PROM2       ------KEIQENMNKSIEATQRNFNTIRTGRANASLLDRVSVDYYGAETPIKSLAXXXXXXXXXXXXXPF
RRF_PSEPK       MINDIKKDAQERMGKSIEALSRNLAAIRTGRAHPSILDSVKVTAWGSEMPLNQVAAITVEDARTLKIVAH
RRF_PSEP1       MINDIKKDAQERMGKSIEALSRNLAAIRTGRAHPSILDSVKVTAWGSEMPLNQVAAITVEDARTLKIVAH
RRF_PROMP       ------QEIQSSMNKSVEATQRNFNTIRTGRANASLLDRISVEYYGAETPIKSLAXXXXXXXXXXXXXPF
RRF_PECCP       MTNEIRKDAETRMDKCVEAFKNQISKIRTGRASPSILDGIQVEYYGSATPLRQVANVVVEDSRTLAITVF
RRF_HELAH       MLQTIYNETKDLMQKSIQALNREFSTLRSAKVSVNILDHIKVDYYGTPTALNQVGSVMSLDATTLQISPW
RRF_GLUOX       ----------------------------------NLLEPVRVEAYGSEVPLSQVGSIAVPEARMLTVSVW
RRF_THET8       -------ETRSHMQKSLEVLEHNLAGLRTGRANPALLLHLKVEYYGAHVPLNQIATVTAPDPRTLVVQSW
RRF_THET2       -------ETRSHMQKSLEVLEHNLAGLRTGRANPALLLHLKVEYYGAHVPLNQIATVTAPDPRTLVVQSW
RRF_NEIG1       MINDIQKTAEGKMQRSVEVLKENLAKVRTGRAHTGLLDQVEVEYWGSMVPVSQVANVTLLDARTIGVKPF
RRF_CHLTE       ----VIQKIEPRMKKTIEAFQHELASIRTGKATTALLDRVKVEAYGSQMPLKQVGNVGVLDAHTLTVQVW
RRF_ARCB4       MLQEVYAQTKEHMEKSIEALKKDYKSLRTGKVNTNILDGIKVDYYGTMTDLSQVGSVLATDATTITINPW
RRF_STRMK       MLNDIKNNAQTRMAKSIDALKHTLTSIRTGRATPALLDRVTVNAYGASTPLNQVASISNADAHSLLVTPF
RRF_SPHAL       ---------ERRMHGAVESLKHDLAGLRTGRANAALLDPVTVEVYGSQMPLNQIASISVPEPRMLSVQVW
RRF_SILPO       ---------KRRMDGAMANLKTEFASLRTGRASGSMLEPIQVEAYGQMTPINQIGTVNVPEPRMVTINVW
RRF_RHOP5       -----ISELKRRMQGATHALQHELGGLRTGRASSSMLEPVQVDAYGTHMPLIQVATISVPEPRLLSVQVW
RRF_POLSQ       --------------------------IRSGRANPGILEHIHVDYYGNPTPLSQVASLGLADARTINVQPF
RRF_HELPY       MLQAIYNETKDLMQKSIQALNRDFSTLRSAKVSVNILDHIKVDYYGTPTALNQVGSVMSLDATTLQISPW
RRF_HELP2       MLQAIYNETKDLMQKSIQALNRDFSTLRSAKVSVNILDHIKVDYYGTPTALNQVGSVMSLDATTLQISPW
RRF_AZOVD       MINEIKKDAQARMKKSLESLEHAFAKIRTGRAHPSILDGVMVSYYGADTPLRQVANVVAEDARTLALTVF
RRF_VEREI       ----IRKHAATRMDQSIAAFRNNLQKIRTGRANPALLDAVQVDYYGALVPLSQVANVALIDARTISVQPW
RRF_UREU1       -------KIREEFELVLKWMHNEFIKLRTGRATPAILDGILVDYYGSMTPINQLANISVPEPRVLAIKPY
RRF_PSEPW       MINDIKKDAQDRMGKSIEALGRNLASIRTGRAHPSILDSVKVPAWGSEMPLNQVAAVSVEDARTLKIVAH
RRF_NEIMF       MINDIQKTAEGKMQRSVEVLKENLAKVRTGRAHTGLLDQVEVEYWGSMVPVSQVANVTLLDARTIGVKPF
RRF_NEIMB       MINDIQKTAEGKMQRSVEVLKENLAKVRTGRAHTGLLDQVEVEYWGSMVPVSQVANVTLLDARTIGVKPF
RRF_NEIMA       MINDIQKTAEGKMQRSVEVLKENLAKVRTGRAHTGLLDQVEVEYWGSMVPVSQVANVTLLDARTIGVKPF
RRF_LEPBP       MVDEIIKSMQSKMDKTVDALKKDFGTIRTGKANPMMVEDVRVDYYGTLTPLNQLGKIACPEPRVILITPF
RRF_LEPBA       MVDEIIKSMQSKMDKTVDALKKDFGTIRTGKANPMMVEDVRVDYYGTLTPLNQLGKIACPEPRVILITPF
RRF_HELPH       MLQAIYNETKDLMQKSVQALNRDFSTLRSAKVSVNILDHIKVDYYGTPTALNQVGSVMSLDATTLQISPW
RRF_BRAJA       --NFDLNEVKRRMQGAVQSLKHELGGLRTGRASASMLDPVQVEAYGSHMPLNQLATVSVPEPRLISVQVW
RRF_PELPB       ----VYQKIEPRMKKTIEAFQHEIASIRTGKATTALLDRVKVEAYGQQMPLKQVGNISVLDVHTLIVQIW
RRF_NITEU       ------KSAEQKMQKSLDALKVDFSKVRSGRPHTGLLDHIMVDYYGTPTPIKQLANVTLADARTIGIIPW
RRF_NEIM0       MINDIQKTAEGKMQRSVEVLKENLAKVRTGRAHTGLLDQVEVEYWGSMVPVSQVANVTLLDARTIGVKPF
RRF_CAMHC       MLNSVYDAQKSDCNKALNALKRDFSTLRTGKVSVKILENIFVDYYDNQTPLNQVATVLATDATTISVTPW
RRF_HELPG       MLQAIYNETKDLMQKSIQALSRDFSTLRSAKVSVNILDHIKVDYYGTPTALNQVGSVMSLDATTLQISPW
RRF_SYNWW       MIKDILSDTEERMKKTIEHLRKDLASLRAGRANPAMLEKIMVDYYGQPTPINQLANITVPEARLLVIQPW
RRF_ALHEH       MIDEIRKDAETRMKKSIEAFRAELRKIRTGRAHTNLLDHISVTYYGTEVPLNQAASVKVEDARTLSVIPF
RRF_SPHWW       ---------ERRMHGAVEALKSDLTGLRTGRASVNLLDPVTVEIYGAHMPLNQAATVTAPEPRMLSVQVW
RRF_PSEMY       MINDIKKDAQERMGKSLEALDRNLASIRTGRAHPSILDSVKVPAWGSDMPLNQVAAITVEDARTLKIVAH
RRF_HELPS       MLQAIYNETKDLMQKSIQALNRDFSTLRSAKVSVNILDHIKVDYYGTPTTLNQVGSVMSLDATTLQISPW
RRF_HELPJ       MLQAIYNETKDLMQKSIQALNRDFSTLRSAKVSVNILDHIKVDYYGTPTALNQVGSVMSLDATTLQISPW
RRF_CHRSD       MINDIKKDADARMKKSVEALNANFHKIRTGRAHPSLLDAVTVEYYGSEMPLNQVASVNVEDARTLAVVPW
RRF_ERWT9       MINDIKKDAETRMEKCVEAFRNHISKIRTGRASPSILDGIMVDYYGSATPLRQLASVTVEDSRTLKINVF
RRF_PARZE       -----------RMKGAMDSLRAEFASLRTGRASASMVEPVQVEAYGQMTPINQVGTVNVPEPRMVTINVW
RRF_JANMA       --------ADQKMQKSIETLKADLAKVRTGRAHTGILDHVMVEYYGNPTNLSQVANVTLIDARTIGVQPF
RRF_SILST       ---------KRRMDGAMANLKTEFASLRTGRASASMLEPVMVDAYGSMTPINQVGTVNVPEPRMVTINVW
RRF_SERP5       MINEIRKDADSRMEKSVEAFKNQISKIRTGRASPSILDGIMVEYYGASTPLRQLASVTVEDSRTLKINVF
RRF_RHILO       ---------KRRMDGAIAAFKHDLASLRTGRASSNLLDAIQVQAYGTTMPINQVANVTVPEPRMISVSIW
RRF_PSEPF       MINEIKKDAKERMTKSVESLAHNFGRIRTGQAHPSILEGVMVPYYGADTPIKQVANITVKDARTLQVVAF
RRF_MARMS       MINEILKDAEDRMSKAVASVESAFKKIRTGRAHPSILDSVKVNYYGSETPLSQVANITVEDARTLGVSPW
RRF_EHRCJ       MINEMKQDAKNRMEKTLSVYLSDIDGIRTGRARTSVLDGIVVETYGGRVKLNTISSISVSDNKTLMIKVW
RRF_SACD2       MIDDIKSDSEERMSRAIEALGTHFNKIRTGRAHPSILDGVMVSYYGSATPLSQVANVTVLDARTLSISPW
RRF_CHLPB       ----ITQKAEAKMKKSVESFQHEIAAIRTGKATTALLDHVKVDAYGQTMPLKQIGNVGVQDAHTLMVQVW
RRF_EHRRG       MINTIKQDAKNRMEKTLSVYLSDVDGIRTGRARASVLDGIVVETYGGRVKLNTISSISVSDNKTLLVKVW
RRF_CHLP8       ----VIQKIEPRMKKTIEAFQHEIASIRTGKATTALLDRVKVEAYGSQMPLKQVGNVGVLDVHTLSVQVW
RRF_UREPA       -------KIREEFELVLKWMHNEFIKLRTGRATPAILDGILVNYYGSMMPINQLANISVPEPRVLAIKPY
RRF_UREP2       -------KIREEFELVLKWMHNEFIKLRTGRATPAILDGILVNYYGSMMPINQLANISVPEPRVLAIKPY
RRF_CHLPD       ----VAQRTEPKMKKTIEAFQHEIASIRTGKATTALLDRVKVEAYGQQMPLKQVGNVGVMDVHTLMVQVW
RRF_AERHH       MINEIKNDAKDRMAKSVESLKTQMSKIRTGRAHPSLLDGIQVEYYGAATPLKQLANVVAEDARTLSISIF
RRF_WOLTR       MLKEIKTKTKERMLKTIQSFYNDIKGIRTGRASASLLDGIVVNIYGGHQKLNQVAGVSVTDNKTLLIKVW
RRF_METPB       ---------KRRMQGAVSSLSKDLGSLRTGRATPSLLDPIQVEAYGASMPMAQVATVSVPEPRLLSISVW
RRF_STRAW       ----------------------DFAAIRTGRAHPAMFNKIVADYYGALTPINQLASFSVPEPRMAVVTPF
RRF_EHRRW       MINTIKQDAKNRMEKTLSVYLSDVDGIRTGRARASVLDGIVVETYGGRVKLNTISSISVSDNKTLLVKVW
RRF_AZOC5       -----IADIKRRMAGAVTSLKQELGGLRTGRASASLLEPITVDAYGANMPLAQVATVSVPEPRLLSVQVW
RRF_PROA2       -ARDVISKGEAKMKKSIESFQHEIASVRTGKATTALLDRVKVDAYGQQMPLKQVGNVGVQDAHTLMVQVW
RRF_PELLD       ----VSQKSEQKMKKAIEAFQHEIASIRTGKATTALLDRVKVEAYGQTMPLRQVGNVGVSDIHTLLVQVW
RRF_NEOSM       MLEDVIKETNDKLRSSYEVFLSDLKGIRSGSLSVSILDGVIVSTHMGKLRLNQVASLSVVNNKMLSVQVW
RRF_METEP       ---------KRRMQGAVSSLSKDLGSLRTGRATPSLLDPIQVEAYGSSMPMAQVATVSVPEPRLLSISVW
RRF_METC4       ---------KRRMQGAVSSLSKDLGSLRTGRATPSLLDPIQVEAYGSSMPMAQVATVSVPEPRLLSISVW
RRF_KOCRD       MISDVLSDATTRMGKAVDAAKTDFSTVRTGRANPALFSSLLVAYYGTPTPLQQLASFQTPEARTLLITPY
RRF_SULDN       MLNELFNECETKMKSSVNHMLRDFKTLRTGKVTTSVLDNVKIDYYGTLTALDQVGSILVADATTIIINPW
RRF_HYDS0       MIEDILEEAEESMKKSINHFKSELAGFRTGRASTSLVEDIKIEYYGSRVPIKQVGNVSVPEPNQILIQVW
RRF_EHRCR       MISEVKQDAKSRMEKSLSVYLSDIDGIRTGRARTSVLNGIVVETYGGRVKLNTISSVSVSDNKTLMIKVW
RRF_ANADF       VADDILNDLHGGIANTLDDLRRELASVRTGRASLHLLDGVRVDYYGTSTPLNQVATLSVPEARLIMVKPW
RRF_PROVI       ----VIQKNEAKLKKSIEAFQHEIASIRTGKATTALLDRVKVEAYGQLMPLKQVGNIGVADVHTLMVQVW
RRF_ONYPE       LAKDILASLETKMTQAQEVMLKNFCDIRTGTANPNILDKITVNYYGAPTFLKTLASISVSEGNQLNIKPY
RRF_ARTAT       -------EAGEKMDKAVEVAKDDFASIRTGRANPALYNKVIVEYYGTPTPLQQLASFGVPDARTILITPY
RRF_CHLL2       ----VAQKIEPKMKKTIEAFQHEIASIRTGKATTTLLDRVKVEAYGQLMPLKQVGNIGVMDVHTLIVQVW
RRF_THEFY       ----------------------DFASIRTGRPSPATFSRITVEYYGAMTPVNQLASFQVPEPRMVIISPY
RRF_LARHH       MINDIKKTAESKMQKTIEAFKHTLAKVRTGRAHAGLLDHITVDYYGSDTPINQVANVTLIDARTIGVQVW
RRF_HALOH       MIKQVEKNAKQKMEKVLEATKHDLNTVRTGRARPSLVENIMVDYYGTQTPIQQMAKVVAPEARQLVIEPW
RRF_PSEU2       MINEIKKDAQTRMQKSLESLTHAFTRIRTGKAHPSILGGVMVPYYGADTPLSQVANVTVKDSRTLQVVAF
RRF_PSE14       MINEIKKDAQTRMQKSLESLTHAFTRIRTGKAHPSILGGVMVPYYGADTPLSQVANVTVKDSRTLQVVAF
RRF_LEIXX       ----VISDASQRMSKTLEAAKEDFGTVSAGRANPALFQKVLVDYYGSPTPLAQLAGLQNPEARVLIVTPY
RRF_AYWBP       -AKDILASLEIKMTQAQELMLKNFCDIRTGTANPNILDKITVNYYGATTFLKTLASISVSEGNQINIKPY
RRF_HERAR       --------ADQKMQKSIETLKADLAKVRTGRAHTGILDHVMVEYYGNPTNLTQVANVTLIDARTIGVQPF
RRF_PSESM       MINEIKKDAQTRMQKSLESLTHAFTRIRTGKAHPSILGGVMVPYYGADTPLSQVANVTVKDSRTLQVVAF
RRF_KLEP3       MISDIRKDAEIRMEKCVEAFKNQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVF
RRF_NATTJ       ---------------------------RAGRANPSILEGINVDYYGMATPLNQLANISAPEPRLLVVQPY
RRF_FRAP2       MINDILKDAENRMSKTLEVLADDLAKIRTGRAHPDILAHVTIDYYGSATPITQVANVTVLDARTLGITPW
RRF_CYTH3       --NLYLDDAKDSMQKAIKHTELELSKIRAGKASPNMFDGIMVDYYGSSTPLAQVATVSVPEPRSITIKAY
RRF_PSEF5       MINEIKKDAQERMKKSLESLAHAFGQIRTGKAHPSILGSVMVPYYGTDTPLSGVANVTVKDSQTLQVVPF
RRF_SHISS       MISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVF
RRF_SHIFL       MISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVF
RRF_SHIF8       MISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVF
RRF_SHIDS       MISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVF
RRF_SHIBS       MISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVF
RRF_SHIB3       MISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVF
RRF_RUBXD       MSDVILSDAERRMKGALEAVRHQFATIRTGRANPALLDRIEVEAYGTRMPIKSVASIGAPEPRLLTITPY
RRF_ESCF3       MISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVF
RRF_ECOUT       MISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVF
RRF_ECOSM       MISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVF
RRF_ECOSE       MISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVF
RRF_ECOLU       MISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVF
RRF_ECOLI       MISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVF
RRF_ECOLC       MISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVF
RRF_ECOL6       MISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVF
RRF_ECOL5       MISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVF
RRF_ECOHS       MISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVF
RRF_ECODH       MISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVF
RRF_ECOBW       MISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVF
RRF_ECO8A       MISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVF
RRF_ECO81       MISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVF
RRF_ECO7I       MISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVF
RRF_ECO5E       MISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVF
RRF_ECO57       MISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVF
RRF_ECO55       MISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVF
RRF_ECO45       MISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVF
RRF_ECO27       MISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVF
RRF_ECO24       MISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVF
RRF_HYPNA       ---------ERRMEGALASLASEFAGLRTGRASVNLLDSIQVPAYGGVTPLSQVASVTVSDTRMLSVNVW
RRF_BLOPB       ------------MKKCIKNFKTNINNIHIGRISPNILNNIRVDYYGISTPLSQVANAIVEDSRTLAITVF
RRF_NITOC       MIDEIQEDAAQRMDKSLNALKQAFARLRANRAHTSLLDHITVSYYGNNVPLNQVANVSVEDARTLTVTPW
RRF_LEUMM       -----LTNAKERMKGAQEALQRELANIRTGRANPNILNRVEVEYYGAMTPLNQVASISVPEARILLITPF
RRF_FRASN       -------EAEEKMDKAVSVAKDDFANIRTGRITPAVFGKVLVDYYGAPTPVQQLASFHIPEPRMVIITPY
RRF_FRASC       -------EAEEKMEKAVSVAREDFANIRTGRITPAVFSKILVDYYGAPTPVQQLASFHIPEPRMVIITPY
RRF_BUCCC       MINVLQEKTYIKMNKCVLNFKNDLNKIRANRATPELLDNIFIDYYGTHTALSKLSNIIIENNSTLKISLF
RRF_CLOPH       --NEKIKPFEGKMQKSLDSLKEEYVGIRAGRANPHLLDKLRVDYYGTPSAIQAVANVSVPEARVIQIQPW
RRF_VESOH       MLNEIQQNSQNKMNKSINSLKNAFSKIRASRAHPSLLEQIHINYYGSMVPLSQVANISTEDSRTLKASPW
RRF_SALTY       MISDIRKDAEVRMEKCVEAFKTQISKVRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVF
RRF_SALTI       MISDIRKDAEVRMEKCVEAFKTQISKVRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVF
RRF_SALSV       MISDIRKDAEVRMEKCVEAFKTQISKVRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVF
RRF_SALPC       MISDIRKDAEVRMEKCVEAFKTQISKVRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVF
RRF_SALPB       MISDIRKDAEVRMEKCVEAFKTQISKVRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVF
RRF_SALNS       MISDIRKDAEVRMEKCVEAFKTQISKVRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVF
RRF_SALHS       MISDIRKDAEVRMEKCVEAFKTQISKVRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVF
RRF_SALG2       MISDIRKDAEVRMEKCVEAFKTQISKVRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVF
RRF_SALEP       MISDIRKDAEVRMEKCVEAFKTQISKVRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVF
RRF_SALDC       MISDIRKDAEVRMEKCVEAFKTQISKVRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVF
RRF_SALCH       MISDIRKDAEVRMEKCVEAFKTQISKVRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVF
RRF_SALAR       MISDIRKDAEVRMEKCVEAFKTQISKVRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVF
RRF_SALA4       MISDIRKDAEVRMEKCVEAFKTQISKVRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVF
RRF_PARUW       ----IVDQTKTKMITAIEHLKNDLKNIRTGRANPGMVEHVMIEVYGSPMRLKDVASISAPEARQLLITPF
RRF_PHYAS       ---LLIEK---KMSQAQEVMLKNFLEIRTGYANPNILNKVNINYYGSQTPLKTLSSISVSEGTQLQIKPY
RRF_CHLCH       ----VAQKIEPKMKKCLEAFQHEIXXXXXXXXXXXLLDRVKVEAYGQQMPLKQVGNVSVQDAHTLMVQVW
RRF_BUCAP       MINDIYIKSNEKMKVCINNFQIQVNNVRTGRASPELLNSIYVEYFGSKVPLRQISNVVVENYHTLKINIF
RRF_WOLPP       MLNEIKAKTKERMLKTIQSFHDDMKGVRTGRANASLLDGIVVNIYGGHQKLNQVAGVSAIDNKTLSVKVW
RRF_PSYIN       MINEVKSDAQSRMDKSVEAFRSQLSKIRTGRAHPSLLDGIMVPYYGSNTPLRQVGNVSTEDARTLTVTVF
RRF_BARBK       ----IMDDLKRRMDGAISAFKHELSGLRTGRASASLLEPLTVEAYGSVVPIKQVANISVLEPRMLSVSVW
RRF_PETMO       ------KEAEEKMKKTLEHFEDELKKVRTGRPTTAIFEDIKVDYYGMPTPINQVATLSVGEERTVVITPW
RRF_CHLAB       ----ILADTEKKMAAALEFFTKEVRSFRTGKANPALVETVTVDVYGTTMRLSDLASISVADTRQLVISPY
RRF_OLICO       -----INDLKRRMDGAKESLRYELGGLRTGRAAISMLEPVQVEAYGSHMPLNQVATVSVPEPRLLSVQVW
RRF_METRJ       ---------KRRMQGAVASLSKDLGSLRTGRATPSLLDPIQVDAYGSMMPMAQVATVSVPEPRLLSISVW
RRF_BUCAT       MINQIDIKTRERMEACIQTFHNNINNIKTGRASPTLLHNIYIEYFGSKTPLRQVSNIIVEDSHTLKINVF
RRF_BUCA5       MINQIDIKTRERMEACIQTFHNNISNIKTGRASPTLLHNIYIEYFGSKTPLRQVSNIIVEDSHTLKINVF
RRF_SALPK       MISDIRKDAEVRMEKCVEAFKTQISKVRTGRASPSLLDGIVVEYYGTLTPLRQLASVTVEDSRTLKINVF
RRF_SALPA       MISDIRKDAEVRMEKCVEAFKTQISKVRTGRASPSLLDGIVVEYYGTLTPLRQLASVTVEDSRTLKINVF
RRF_AKKM8       ---------------------QEFSGVRTGKASPGLVENVHVSSYGSVMKLKGLAVISTPEPRLILIQPF
RRF_BUCAI       MINQIDIKTRERMEACIQTFHNNITNIKTGRASPTLLHNIYIEYFGSKTPLRQVSNIIVEDSHTLKINVF
RRF_CHLFF       ----ILADTEKKMATALEFFQKEIRAFRTGKAHPALVETVTVDVYGTTMRLSDLASISVADTRQLVISPY
RRF_CHLCV       ---------EKKMAAALEFFHKEVRSFRTGKANPALVETVTVDVYGTTMRLSDLASISVADTRQLVISPY
RRF_FERNB       MVNSFIKTTEEKMKKSVEKIAEELKHLRTGRATPAVLEEIKIDYYGVPTPVLQVAQVTTEE-RQLVIKPW
RRF_JANSC       ---------ERRMEGAIASLRTEFASLRTGRASASMLEPVMVDAYGAMTPINQVGTVNVPEPRMVTVNVW
RRF_MESSB       ----------------------DIASLRTGRASANLLDPIHVDAYGASMPVNQVATVSVPEPRMISVSVW
RRF_ACICJ       ---------QRRMDGAMETLKREFSGLRTGRANPALLDPVKVEAYGTLMPLNQVATVAVPESRMLTVQVW
RRF_MYCPE       -------------------LDSEFNKIKSGRPNPKILDHVMVEAYGDKSKLFEIANMQVVEGKQIVVKPY
RRF_MYCMO       --NFYTNKVKLEMEKAVQTYSNQIAKISAGKANPKLISGIKFIYYDEPMSIEEMAAISVPEAQQILIKPY
RRF_MYCMS       MTDLILKNAELQMKETIDAYVIHLRQIRTGKASGAILDKVMVNYYGSLMPLNQISQITTPEPNLIIIKPY
RRF_PARDP       ---------ERRMKGAMESLRHEFASLRTGRASASMVEPIMVDAYGSPTPINQIGTVNVPEPRMVTINIW
RRF_METI4       ---------------------QELASLRSGKAHPEILSNVSVEAYETHMKLKDLAAITAPDANLLIVQPW
RRF_MYCCT       MTDLILKNAELQMKETIDAYVIHLRQIRTGKASGAILDKVMVNYYGSLMPLNQISQITTPEPNLIIIKPY
RRF_TROWT       ----------ERMNKTIELLKEQFLSIHSGRVNSGQFEKVMVDCEGASVPLVSLASIRVLNANTIVVTPY
RRF_TROW8       ----------ERMNKTIELLKEQFLSIHSGRVNSGQFEKVMVDCEGASVPLVSLASIRVLNANTIVVTPY
RRF_CHLPN       ----VLQDTEKKMAAALDFFHKEVKSFRTGKAHPALVETVVVDVYGTTMRLSDIASISVADLRQLVISPY
RRF_ENT38       MISDIRKDAEVRMEKCVEAFKNQISKVRTGRASPSLLDGIIVEYYGTPTPLRQLASVTVEDTRTLKINVF
RRF_CHLTA       -----LASAEKEMAGVLTFFQKETRGFKTGKAHPALVETVTIEVYGTTMRLSDIASISVSDMRQLLISPY
RRF_CHLMU       -----LTSAEKEMSGVLTFFQKEIRGFRTGKAHPALXXXXXXXXXXXXMRLSDIASISVSDTRQLLISPY
RRF_WIGBR       MINEIYENSNSRMKKSIDFFKKNISKIRTNRVSPSLIENIYINCYGTSVPLSKLSNILSEKSNILKINVF
RRF_METS4       ---------KRRMQGAVNSLKHDLGSLRTGRASPTLLDPIQVEAYGAAMPMAQVATISVPEPRLLSVAVW
RRF_METNO       ---------KRRMQGAVNALKHDLGSLRTGRASPTLLDPIQIEAYGAVMPMAQVATISVPEPRLLSVAVW
RRF_BLOFL       --------------------------IHVGRISPDILSFIKIEYYGVITPLCQLTNTVVEQPRTLIITVF
RRF_COPPD       ----ITRQAREHFQKTINTMSDQLSTVRASRVSPAILEPVTVEYEGAKYKLSELAMVVAQDARTLIIEPW
RRF_ORITI       ----LINSLTKKMNGALQVLDADLKGLRVGQASAYFLDPVQVEAYNSKVPILQVATISVSDTKTILVQVW
RRF_ORITB       ----LINSLTKKMNGALQVLDADLKGLRVGQASAYFLDPVQVEAYNSRVPILQVATISVSDTKTILVQVW
RRF_MYCPU       --NEVFSTLEEKSMNVVSNFEFNLSKISTGRANPQLIKNIKVSYYEELIPLEQISNISVPEPQQLLIKPF
RRF_MYCGA       ----------------------ELAKVRSGRANLKILDNVRAEYYGEQTPLIEMASLSIPEPREILIKPY
RRF_HAMD5       MISKIETETQSRMEKCTESFESQIKKIRTGRASPSILDSIQVEYYGASTPLRQLANIVAEDSSHLAVTVF
RRF_CHLTB       -----LASAEKEMAGVLTFFQKETRGFRTGKAHPALXXXXXXXXXXXXMRLSDIASISVSDMRQLLISPY
RRF_CHLT2       -----LASAEKEMAGVLTFFQKETRGFRTGKAHPALXXXXXXXXXXXXMRLSDIASISVSDMRQLLISPY
RRF_CHLTR       -----LASAEKEMVGVLTFFQKETRGFRTGKAHPALXXXXXXXXXXXXMRLSDIASISVSDMRQLLLSPY
RRF_WOLPM       MLNEIKAKTKERMLKTIQSFHDDIKGVRTGRASASLLDGIVVNIYGGHQKLNQVAGVSVIDNKTLSIKVW
RRF_MYCGE       -----IDFFKQAADKKIQWLKEELTKIRTGRPNPKIFDNLLIESYGQKMPLISLAQVTINPPREIIIKPF
RRF_BUCBP       -----------KMDHCVHMFVNQLNTLRSSRASPSILDTILIDYLGQKIQLKKLSNIIVENVNTLRITLF
RRF_WOLWR       MLNEIKAKTKERMLKTIQSFHDDIKGVRTGRASASLLDGIVVNIYGGHQKLNQVAGVSVIDNKTLSIKIW
RRF_MYCPN       ---------KETADKKFQWLKEELSKIRTGRPNPKLFDNLLVESYGDRMPMVALAQIAVNPPREIVIKPF
RRFM_BOVIN      -----LEEVDEEMKSVIEALKDNFNKTVNIRTSPGALDNITVVTADGKLPLNQISQISMKSPQLILVNSF
RRFM_HUMAN      -----LEEVNEEMKSVIEALKDNFNKTLNIRTSPGSLDKIAVVTADGKLALNQISQISMKSPQLILVNSF
RRFM_MOUSE      ---ISLEEVDEDMKSVVEALKDNFNKTLNIRTAPGSLDHITVVTADGKVALNQIGQISMKSPQVILVNSF
RRF_AQUAE       ----IFKEAEKDMKKAVEYYKNEIAGLRTSRASTALVEEIKVEYYGSKVPIKQLGTISVPEHNQIVIQVW
RRFM_RAT        ---ISLEEVDEDMKSVMEALKDNFNKTLNIRTAPGSLDHITVVTADGKLALNQIGQISMKSPQLILVNSF
RRF1_CANGA      --SIYVDELVSKFDKSLELYSKELTDKRKGSVNANIFDNLSLKNGAL---FKEMASTTLKGKGSLLVTVF
RRF1_KLULA      -------KQFEKTLELHK---RKLAEQKVGTASPTIFNDLRVGKEGQK--FTELAATSLKGRNALIVTVF
RRF1_YEAST      --NELLKKAETQFKKTLEIQKQKMNEIKQGNFNPKVFNSL---VFKNNRKFTDIATTSLKGKNALLITVF
RRF1_DEBHA      -----------------ERFSKQANEAKLGKTSPNIFDKLIVETANGEVGFTSVAQTTV-KGRNFMITVF
RRF1_ASHGO      -----VKKATERFQHTVELHKKRLGQMKAGKPDATMFDGLAVG--NEKQKFTELAATSVKGKNMLIVTVF
RRF1_YARLI      -----------------------------GNNSPDLINNIEVKISKDEVQIKDIASVALKGGRTLSISVY
RRFM_CAEEL      ---------------------------------------------GKDKPLSMIARVTLKSPLMIMINFQ
HSLU_MARAV      ----------------------------------------------------------------------
TRI29_MOUSE     ----------------------------------------------------------------------
VATE_METAC      ----------------------------------------------------------------------
GLYA_STRU0      MANVFAEDNRFRLTDNHVFLVEVTGVIESGKAAQNLLDEVNITLNKNSIPFETL-------------SPF
ODPA1_ARATH     ----------------------------------------------------------------------
ATPX_RHDSA      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DKSSLKDIERALNASDLGITPANDGSVIRLVIPALTEETRRDLAKEVKKVGENAKVAVRNIRRDAMDEAK
RRF_STRZT       DKSSLKDIERALNASDLGITPANDGSVIRLVIPALTEETRRDLAKEVKKVGENAKVAVRNIRRDAMDEAK
RRF_STRZJ       DKSSLKDIERALNASDLGITPANDGSVIRLVIPALTEETRRDLAKEVKKVGENAKVAVRNIRRDAMDEAK
RRF_STRPJ       DKSSLKDIERALNASDLGITPANDGSVIRLVIPALTEETRRDLAKEVKKVGENAKVAVRNIRRDAMDEAK
RRF_STRPI       DKSSLKDIERALNASDLGITPANDGSVIRLVIPALTEETRRDLAKEVKKVGENAKVAVRNIRRDAMDEAK
RRF_STRP4       DKSSLKDIERALNASDLGITPANDGSVIRLVIPALTEETRRDLAKEVKKVGENAKVAVRNIRRDAMDEAK
RRF_STRR6       DKSSLKDIDRALNASDLGITPANDGSVIRLVIPALTEETRRDLAKEVKKVGENAKVAVRNIRRDAMDEAK
RRF_STRP2       DKSSLKDIDRALNASDLGITPANDGSVIRLVIPALTEETRRDLAKEVKKVGENAKVAVRNIRRDAMDEAK
RRF_STRP7       DKSSLKDIERALNASDLGITPANDGSVIRLVIPALTEETRRDLAKEVKKVGENAKVAVRNIRRDAMDEAK
RRF_STRPS       DKSSLKDIERALNASDIGITPANDGSVIRLVIPALTEETRRDLAKEVKKVGENAKVAVRNIRRDAMDEAK
RRF_STRPN       DKSSLKDIERALNASDIGITPANDGSVIRLVIPALTEETRRDLAKEVKKVGENAKVAVRNIRRDAMDEAK
RRF_STRZP       DKSSLKDIERALNASDLGNTPANDGSVIRLVVPALTEETRRDLAKEVKKVGENAKVAVRNIRRDAMDEAK
RRF_STRSV       DKSSIKDIERALNASDLGITPASDGSVIRLVIPALTEETRRDLAKEVKKVGENAKVAIRNIRRDAMDEAK
RRF_STRGC       DKSSLKDIERAINASDLGITPASDGSVIRLVIPALTEETRRDLAKEVKKIGENAKIAIRNIRRDAMDEAK
RRF_STRMU       DKSSLKDIEHAINASDIGINPANDGSVIRLVIPALTEETRKELAKEVKKVGENAKVAIRNIRRDAMDEAK
RRF_STRPM       DKSSIKDIERALNASDLGITPANDGSVIRLVIPALTEETRKELAKEVKKVGENAKIAIRNIRRDAMDDAK
RRF_STRA5       DKSSIKDIERAINESDLGINPANDGSVIRLVIPALTEETRRDLAKEVKKVGENAKIAIRNIRRDAMDEAK
RRF_STRA3       DKSSIKDIERAINESDLGINPANDGSVIRLVIPALTEETRRDLAKEVKKVGENAKIAIRNIRRDAMDEAK
RRF_STRA1       DKSSIKDIERAINESDLGINPANDGSVIRLVIPALTEETRRDLAKEVKKVGENAKIAIRNIRRDAMDEAK
RRF_STRPZ       DKSSIKDIERALNASDLGITPANDGSVIRLVIPALTEETRKELAKEVKKVGENAKIAIRNIRRDAMDDAK
RRF_STRPG       DKSSIKDIERALNASDLGITPANDGSVIRLVIPALTEETRKELAKEVKKVGENAKIAIRNIRRDAMDDAK
RRF_STRPF       DKSSIKDIERALNASDLGITPANDGSVIRLVIPALTEETRKELAKEVKKVGENAKIAIRNIRRDAMDDAK
RRF_STRPD       DKSSIKDIERALNASDLGITPANDGSVIRLVIPALTEETRKELAKEVKKVGENAKIAIRNIRRDAMDDAK
RRF_STRPC       DKSSIKDIERALNASDLGITPANDGSVIRLVIPALTEETRKELAKEVKKVGENAKIAIRNIRRDAMDDAK
RRF_STRPB       DKSSIKDIERALNASDLGITPANDGSVIRLVIPALTEETRKELAKEVKKVGENAKIAIRNIRRDAMDDAK
RRF_STRP6       DKSSIKDIERALNASDLGITPANDGSVIRLVIPALTEETRKELAKEVKKVGENAKIAIRNIRRDAMDDAK
RRF_STRP3       DKSSIKDIERALNASDLGITPANDGSVIRLVIPALTEETRKELAKEVKKVGENAKIAIRNIRRDAMDDAK
RRF_STRP1       DKSSIKDIERALNASDLGITPANDGSVIRLVIPALTEETRKELAKEVKKVGENAKIAIRNIRRDAMDDAK
RRF_STRP8       DKSSIKDIERALNASDLGITPANDGSVIRLVIPALTEETRKELAKEVKKVGENAKIAIRNIRRDAMDDAK
RRF_STRS7       DKSSIKDIERALNASDLGITPANDGSVIRLVIPALTEETRKELAKEVKKVGETAKVSIRNIRRDAMDEAK
RRF_STREM       DKSSIKDIERALNASDLGITPANDGSVIRLVIPALTEETRKELAKEVKKVGETAKVSIRNIRRDAMDEAK
RRF_STRE4       DKSSIKDIERALNASDLGITPANDGSVIRLVIPALTEETRKELAKEVKKVGETAKVSIRNIRRDAMDEAK
RRF_STRU0       DKSSIKDIERAINASDLGITPANDGSVIRLVIPALTEETRKELAKEVKKVGENQKIAIRNIRRDAMDEAK
RRF_STRTD       DKGSIADIERAINESDLGINPANDGSVIRLVIPALTEETRKELAKEVKKVGENAKIAIRNIRRDAMDEAK
RRF_STRT2       DKGSIADIERAINESDLGINPANDGSVIRLVIPALTEETRKELAKEVKKVGENAKIAIRNIRRDAMDEAK
RRF_STRT1       DKGSIADIERAINESDLGINPANDGSVIRLVIPALTEETRKELAKEVKKVGENAKIAIRNIRRDAMDEAK
RRF_STRSY       DKSILKDIERALNASDLGLTPQSDGTVIRLVIPALTEETRKNLAKDVKKVGENSKVAIRNIRRDAMDXXX
RRF_STRS2       DKSILKDIERALNASDLGLTPQSDGTVIRLVIPALTEETRKNLAKDVKKVGENSKVAIRNIRRDAMDXXX
RRF_LACLA       DKSILKDIEKALYESDLGITPANDGSVIRLVIPMLTEERRRELVKEMGKYIESAKVAIRNIRRDAMDTAK
RRF_LACLM       DKSILKDIEKALYESDLGITPANDGSVIRLVIPMLTEERRRELVKEMGKYIESAKVAIRNIRRDAMDTAK
RRF_LACLS       DKSILKDIEKSLYESDLGITPANDGSVIRLVIPMLTEERRRELVKEMGKYIESAKVAIRNIRRDAMDTAK
RRF_ENTFA       DKNSIADIEKAIQMSDIGISPTNDGNVIRLVIPQLTEERRKELAKDVKKEAENSKVAVRNVRRDAMDELK
RRF_LACS1       DKTSLKNIEHAIMASDLGIAPMNDGTAIRLVIPQLTEERRKELAKQVKAVSETGKVAVRNIRRDMMDALK
RRF_PEDPA       DKSVLNDIEQAILMSDLGINPANDGSAIRLVVPQLTEETRKDLAKNVKAEGEKAKVAVRNIRRDAMDTLK
RRF_GEOKA       DKSAIKEMEKAILASDLGLTPSNDGSVIRLVIPPLTEERRRELAKLVKKYSEDAKVAVRNIRRDANDELK
RRF_LACSS       DKGALEDIEKALYTADIGISPANDGSVIRLVIPQLTGERRKEIAKEVGKEAELAKVVVRNARRDAMDNLK
RRF_LACGA       DKSSLDDIEHAILASDLGITPANDGTVIRIVIPQLTGERRQEIAKQVGKLAEKGKIAVRNVRRDAMDTLK
RRF_LACJO       DKSTLDDIEHAILASDLGITPANDGTVIRIVIPQLTGERRQEIAKQVGKLAEKGKIAVRNVRRDAMDTLK
RRF_GEOTN       DKSVIKEMEKAILASDLGVTPSNDGSVIRLVIPPLTEERRRELAKLVKKYSEEAKVAVRNIRRDANDELK
RRF_LACPL       DKSALKEIEKAILASDLGISPANDGSAIRLVIPQLTEERRKELAKDVKAEGERAKVAVRNVRRDAMEALK
RRF_BACP2       DKTAIGDIEKSIQKSDLGITPTSDGNVIRIAIPALTEERRKELVKVVRKYSEEAKVAVRNVRRDANDELK
RRF_BACHD       DKSSISDIERAIQKSDLGLTPSNDGTVIRITIPPLTEERRRDLTKLVKKSAEEAKVAVRNIRRDANDDLK
RRF_LACCB       DKSSLKNIETALNASDLGINPANDGDVIRLVIPQLTGERRKEIAKEVGKYSESAKIAIRNIRREGLDKLK
RRF_LACC3       DKSSLKNIETALNASDLGINPANDGDVIRLVIPQLTGERRKEIAKEVGKYSESAKIAIRNIRREGLDKLK
RRF_GEOSW       DKSVIKDIEKAILSSDLGLTPSNDGSVIRITIPPLTEERRRELVKLVKKYSEDAKVAVRNIRRDANDELK
RRF_LACDB       DKSSLNDIEHAILASDLGLTPANDGNVIRLIIPQLTGERRQEIAKEVGKLAEEAKIAVRNVRQEAMKALK
RRF_LACDA       DKTSLNDIEHAILASDLGLTPANDGNVIRLIIPQLTGERRQEIAKEVGKLAEEAKIAVRNVRQEAMKALK
RRF_LACH4       DQNSLDDIEHALLASNLGLTPANDGKVIRLVIPQLTGERREEIAKEVGKYAEDAKIAVRNVRREAMDALK
RRF_CLOAB       DKSAMKSIEKAILISDLGLNPSNDGTTMRLVIPELTEETRKNIVKNVKKAGEDGKVALRAIRRDANDKVK
RRF_STAHJ       DKSSVADIEKAIYAANLGVNPTSDGEVIRITVPALTEERRKELVKNVKKIGEDAKVSIRNIRRDINDQLK
RRF_BACLD       DKTALGDIEKAIQKADLGVTPSNDGNIIRITIPPLTEERRKELAKLVKKYSEDAKVAVRNIRRDANDDLK
RRF_BACCN       DKTSIGDIEKAILKADLGLNPSNDGSVIRIAFPALTEERRRELVKVVKKYAEDAKVAIRNVRRDGNDELK
RRF_ANATD       EARMLKEIEKAIQKSDLGVNPTNDGKVIRLIFPELTEERRKELVKQVKKMAEDAKVAIRNIRREALDEYK
RRF_CALS8       EARMLKEIEKAIQKADLGVNPANDGKVIRLIFPELTEERRKELVKQVKKMAEDAKVAIRNIRREAIDEYK
RRF_CLOPS       EKPMLKEIEKAILKSDLGINPNNDGTIIRLLVPELTEETRKNLVKNVKKVGEQAKVAIRSIRKDANDKVK
RRF_CLOPE       EKPMLKEIEKAILKSDLGINPNNDGTIIRLLVPELTEETRKNLVKNVKKVGEQAKVAIRSIRKDANDKVK
RRF_CLOP1       EKPMLKEIEKAILKSDLGINPNNDGTIIRLLVPELTEETRKNLVKNVKKVGEQAKVAIRSIRKDANDKVK
RRF_LACRJ       DESVLEEIEKAIYASNLGLTPQNDGSSIRLIIPQLTEDRRKELVKDVKAELEKAKVAVRNVRREAMDDLK
RRF_LACRD       DESVLEEIEKAIYASNLGLTPQNDGSSIRLIIPQLTEDRRKELVKDVKAELEKAKVAVRNVRREAMDDLK
RRF_STAS1       DKSSVGNIEKAINAANLGVNPSSDGEVIRISVPALTEERRKELVKDVKKIGEDAKVAVRNVRRDSNDELK
RRF_DESHD       DKSSLPMIEKAILKSDLGLNPSSDGTVIRLLIPQLTAERRTEIVKTVKKKAEDSRVAVRNIRRDSNDELK
RRF_EXIS2       DKSMVTEIEKAIQRADLGLAPSSDGTVIRLAIPPLTEDRRKELVKLVKKYTEEGKVALRNIRRDTNEQLK
RRF_DESHY       DKSSLPMIEKAILKSDLGLNPSSDGTVIRLLIPQLTAERRTEIVKTVKKKAEDSRVAVRNIRRDSNDELK
RRF_CYAA5       DKGSMGQIEKAIQMSDVGLTPNNDGQVIRLNIPPLTEERRKDLVKLASKMAEEGKVAIRNIRRDAIDDVR
RRF_CLONN       DKNSLKDIEKAILQSDLGLNPSNDGSVIRLIIPELTEETRKDIVKKVKKIGEESKIAIRSIRREGXXXXX
RRF_STACT       DKTSLSDIERAINAANLGVNPSSDGEVIRIMVPALTEERRKELVKDVKKMGENAKVSIRNIRRDSNDDLK
RRF_OCEIH       DKSAIGDIEKAIQKADLGLSPSSDGNIIRINIPALTQERRKDLVKVVGKYSEEAKVQIRNIRRDTNDQLK
RRF_BACSK       DKTAVASIEKAILKSDLGLTPSNDGQVIRIAIPPLTEERRKDLVRLVSKTAEESKVAVRNIRRDANDELK
RRF_PELCD       EKKLLADIERAIFKADLGLNPTSDGNLIRLVIPPMTEERRKEMGKVVRKMGEDAKVGVRSARRDANDGMK
RRF_THEPX       DVSKISDIEKAIQKSDLGINPVSDGKVLRLVFPELTEERRKELVKLVHKKAEEAKVAVRQIRRDANDAVK
RRF_THEP3       DVSKISDIEKAIQKSDLGINPVSDGKVLRLVFPELTEERRKELVKLVHKKAEEAKVAVRQIRRDANDAVK
RRF_CLOB8       EKPLLKEIEKAILKSDLGLNPSSDGSIIRLVIPELTEETRKTLVKNVKKTGEEAKVAIRSIRKTANDKIK
RRF_MACCJ       DKTSIDDILKAINMANLGVNPTSDGNVIRITVPALTXXXXXXXXXXXXXXXXNSKIAIRNIRRDANDALK
RRF_LEUCK       DKTALEEIIRAINMSDLGLNPSSDGNIVRLMIPQMTEEGRKDLXXXXXXXXXXXXXSVRNVRRDAMDSVK
RRF_ALKOO       DGSALSSIEKAILQSDLGVNPSNDGKLIRIIVPQLTEERRKELTKVAKKTSEDAKVVLRNERRNANDRLK
RRF_SYNY3       DMGSIGTIEKAISLSDLGLTPNNDGKVIRLNIPPLTAERRKELVKVAGKLAEEGKVAIRNIRRDAVDEVR
RRF_PELTS       DKTVLPEIERAILKSDLGITPASDGNVIRLAIPQLTQERRAELMKVIKKKAEEGRVAIRNIRRDTNEQLK
RRF_FINM2       DKSIMKEIEKQIQASNLGITPSNDGTIIRLPFPQLTEDRRKELTKVVKEYGEKSKVTIRSIRRDFVDDAK
RRF_THETN       DVSQIGEIEKAIQKSDLGINPVSDGKVLRLVLPELTEERRKELVKLVHKKAEEARIAVRQIRRDANDLVK
RRF_SYMTH       DRSLIKAIERAINASDLGLNPTNDGQVIRLSIPPMTEERRRELVKVVAKRTEEQRVAIRNIRRDANEQIK
RRF_STAAW       DKTSVADIEKAIIAANLGVNPTSDGEVIRIAVPALTXXXXXXXXXXXXXIGEEAKVSVRNIRRDMNDQLK
RRF_STAAU       DKTSVADIEKAIIAANLGVNPTSDGEVIRIAVPALTXXXXXXXXXXXXXIGEEAKVSVRNIRRDMNDQLK
RRF_STAAS       DKTSVADIEKAIIAANLGVNPTSDGEVIRIAVPALTXXXXXXXXXXXXXIGEEAKVSVRNIRRDMNDQLK
RRF_STAAR       DKTSVADIEKAIIAANLGVNPTSDGEVIRIAVPALTXXXXXXXXXXXXXIGEEAKVSVRNIRRDMNDQLK
RRF_STAAN       DKTSVADIEKAIIAANLGVNPTSDGEVIRIAVPALTXXXXXXXXXXXXXIGEEAKVSVRNIRRDMNDQLK
RRF_STAAM       DKTSVADIEKAIIAANLGVNPTSDGEVIRIAVPALTXXXXXXXXXXXXXIGEEAKVSVRNIRRDMNDQLK
RRF_STAAE       DKTSVADIEKAIIAANLGVNPTSDGEVIRIAVPALTXXXXXXXXXXXXXIGEEAKVSVRNIRRDMNDQLK
RRF_STAAC       DKTSVADIEKAIIAANLGVNPTSDGEVIRIAVPALTXXXXXXXXXXXXXIGEEAKVSVRNIRRDMNDQLK
RRF_STAAB       DKTSVADIEKAIIAANLGVNPTSDGEVIRIAVPALTXXXXXXXXXXXXXIGEEAKVSVRNIRRDMNDQLK
RRF_STAA9       DKTSVADIEKAIIAANLGVNPTSDGEVIRIAVPALTXXXXXXXXXXXXXIGEEAKVSVRNIRRDMNDQLK
RRF_STAA8       DKTSVADIEKAIIAANLGVNPTSDGEVIRIAVPALTXXXXXXXXXXXXXIGEEAKVSVRNIRRDMNDQLK
RRF_STAA3       DKTSVADIEKAIIAANLGVNPTSDGEVIRIAVPALTXXXXXXXXXXXXXIGEEAKVSVRNIRRDMNDQLK
RRF_STAA2       DKTSVADIEKAIIAANLGVNPTSDGEVIRIAVPALTXXXXXXXXXXXXXIGEEAKVSVRNIRRDMNDQLK
RRF_STAA1       DKTSVADIEKAIIAANLGVNPTSDGEVIRIAVPALTXXXXXXXXXXXXXIGEEAKVSVRNIRRDMNDQLK
RRF_LISMH       DKTILGEIEKAILKSDLGLTPNNDGSVLRLSIPQLTXXXXXXXXXXXXXXXXXXXXXXXNIRREANEELK
RRF_THEEB       DRSTLASIEKAIQLSDLGLTPNNDGSSVRLNIPPLTTERRKELVKTAAKIAEGGKVAIRNIRRDAIDHIK
RRF_LACRE       DESSLDNIEKAIYAANLGLTPQNDGSAIRILIPQLTEERRKELVKDVKAELEKAKVAVRNVRREAMXXXX
RRF_XYLFA       DKNMSKDVEKAIYASDLGLTPTVVGTLIRLNLPPLTEERRKELTKVVHSEGEDTKVAIRNIRRDANQQIK
RRF_XYLFT       DKNMSKDVEKAIYASDLGLTPTVVGTLIRLNLPPLTEERRKELTKVVHSEGEDTKVAIRNIRRDANQQIK
RRF_GEOUR       DAKMIPVIEKAIMNANLGLTPANDGKVIRLNIPPLTEERRKDIVKQLKKLAEDAKVAVRNIRRDAIDELK
RRF_BACC7       DKTSIGDIEKAILKADLGLNPSNDGTVIRIAFPALTEERRRDLXXXXXXXXXXXXXXXRNVRRDGNDDLK
RRF_BACC1       DKTSIGDIEKAILKADLGLNPSNDGTVIRIAFPALTEERRRDLXXXXXXXXXXXXXXXRNVRRDGNDDLK
RRF_ALKMQ       DPSVINGIEKALMMSDLGLNPSNDGKIIRLNIPQLTEERRKELTKVVKRVAEEGRVALRNGRRDANEQLK
RRF_LISIN       DKTILGEIEKAILKSDLGLTPNNDGSVLRLSIPQLTXXXXXXXXXXXXXXXXXXXXXXXNIRREANEDLK
RRF_BACCR       DKTSIGDIEKAILKADLGLNPSNDGTVIRIAFPALTEERRRDLXXXXXXXXXXXXXXXRNVRRDGNDDLK
RRF_BACC4       DKTSIGDIEKAILKADLGLNPSNDGTVIRIAFPALTEERRRDLXXXXXXXXXXXXXXXRNVRRDGNDDLK
RRF_BACA2       DKTAIGDIEKAILKADLGVTPTSDGTIIRIAIPALTXXXXXXXXXXXXXXXXXXXXXXRNVRRDSNDDLK
RRF_STAES       DKSSVADIEKAIIAANLGVNPTSDGEVIRISVPALTXXXXXXXXXXXXXIGEDAKVSIRNIRRDINDQLK
RRF_STAEQ       DKSSVADIEKAIIAANLGVNPTSDGEVIRISVPALTXXXXXXXXXXXXXIGEDAKVSIRNIRRDINDQLK
RRF_DESRM       DKSVIPEVEKAILKSDVGITPSSDGTVIRLIIPQLTQERRTELVKVIKKKAEEGRVAVRNIRRDTNDSIK
RRF_CLOBL       DKSALSAIEKAILKSDLGLNPSNDGTVIRLVIPELTEETRKNIVKTVKKTGEEAKVAIRSIRR-XXXXXX
RRF_GEOSM       DSKMIAPIEKAIMNSNLGLNPANDGKMIRLVLPPLTEERRKDIVKQLKRDAEEAKVALRNIRRDAIDQLK
RRF_DESDG       DRGAFALVEKAIMQSDLGLTPINDGKIIRISMPPLTEERRKELVKVAKKYTEDAKVAVRNIRRDANEQIK
RRF_CLOBK       DKSALSAIEKAILKSDLGLNPSNDGTVIRLVIPELTEETRKNIVKTVKKTGEEAKVAIRSIRR-XXXXXX
RRF_CLOBJ       DKSALSAIEKAILKSDLGLNPSNDGTVIRLVIPELTEETRKNIVKTVKKTGEEAKVAIRSIRR-XXXXXX
RRF_CLOB6       DKSALSAIEKAILKSDLGLNPSNDGTVIRLVIPELTEETRKNIVKTVKKTGEEAKVAIRSIRR-XXXXXX
RRF_BACHK       DKTSIGDIEKAILKADLGLNPSNDGTVIRIAFPALTEERRRDLXXXXXXXXXXXXXXXRNVRRDGNDDLK
RRF_BACCZ       DKTSIGDIEKAILKADLGLNPSNDGTVIRIAFPALTEERRRDLXXXXXXXXXXXXXXXRNVRRDGNDDLK
RRF_BACC3       DKTSIGDIEKAILKADLGLNPSNDGTVIRIAFPALTEERRRDLXXXXXXXXXXXXXXXRNVRRDGNDDLK
RRF_BACC0       DKTSIGDIEKAILKADLGLNPSNDGTVIRIAFPALTEERRRDLXXXXXXXXXXXXXXXRNVRRDGNDDLK
RRF_BACAH       DKTSIGDIEKAILKADLGLNPSNDGTVIRIAFPALTEERRRDLXXXXXXXXXXXXXXXRNVRRDGNDDLK
RRF_BACAC       DKTSIGDIEKAILKADLGLNPSNDGTVIRIAFPALTEERRRDLXXXXXXXXXXXXXXXRNVRRDGNDDLK
RRF_DESVM       DRSAFQLVEKAIMKSDLGLNPVNDGKIIRISIPPLTEERRKDLVKVARKYTEEAKVAVRNVRRDANDALK
RRF_XANCP       DKGMIKDVEKAIYASDLGLTPTVVGTVIRLNLPPLTEERRKELSKSVHGEGEDAKVAIRNIRRDANQQVK
RRF_XANCB       DKGMIKDVEKAIYASDLGLTPTVVGTVIRLNLPPLTEERRKELSKSVHGEGEDAKVAIRNIRRDANQQVK
RRF_XANC8       DKGMIKDVEKAIYASDLGLTPTVVGTVIRLNLPPLTEERRKELSKSVHGEGEDAKVAIRNIRRDANQQVK
RRF_BACC2       DKTSIGDIEKAILKADLGLNPSNDGTVIRIAFPALTEERRRDLXXXXXXXXXXXXXXXRNVRRDGNDDLK
RRF_BACAN       DKTSIGDIEKAILKADLGLNPSNDGTVIRIAFPALTEERRRDLXXXXXXXXXXXXXXXRNVRRDGNDDLK
RRF_BACAA       DKTSIGDIEKAILKADLGLNPSNDGTVIRIAFPALTEERRRDLXXXXXXXXXXXXXXXRNVRRDGNDDLK
RRF_CYAP4       DRNSLNLIEKAISMSDLGLTPNNDGTVIRLNIPPLTSDRRKELVKTASKLAEEGKVSIRNVRRDAVDSVK
RRF_BACWK       DKTSIGDIEKAILKADLGLNPSNDGTVIRIAFPALTEERRRDLXXXXXXXXXXXXXXXRNVRRDSNDDLK
RRF_LAWIP       DKTAFNPIEKAILKSELGLTPINDGKIIRITLPPLTEDRRKDLVKLARKYGEDTKIAIRNIRRDANEQLK
RRF_CYAP7       DRGSMGQIEKAIQLSDIGLTPNNDGQMIRLNIPPLTTERRKELVKLAGKLAEEGKVAIRNIRRDAIDSVR
RRF_SYNJB       DPSTLAAIERAIVASDLGLTPSNDGKVVRLTIPPLTEERRKELSKQVAKLAEEGRVSIRNIRRDGIDSVR
RRF_CLOBH       DKGALSAIEKAILKSDLGLNPSNDGTVIRLVIPELTEETRKNIVKTVKKTGEEAKVAIRSIRR-XXXXXX
RRF_CLOB1       DKGALSAIEKAILKSDLGLNPSNDGTVIRLVIPELTEETRKNIVKTVKKTGEEAKVAIRSIRR-XXXXXX
RRF_GEOLS       ESKMIGPIEKAILNANLGLTPGNDGKLIRLNLPPLTEERRKEIVKGMKKMDEDHKVAVRNIRRKAIDDLK
RRF_MOOTA       DRNILPEIEKAILKSDLGLTPSSDGTVIRITIPQLTEERRSELVKVARKKAEEFRVMVRNARREANDKLK
RRF_GEOBB       DSKMIAPIEKAIMNSNLGLNPANDGKMIRLTLPPLTEERRKDIVKQLKRDAEDAKVALRNIRRDAIDQLK
RRF_ACHLI       DKSILKDIETAINTSSLELPPRNDGTGIRLTLPALTGERRRSLVKDVEKMAEAGKVAIRHIRRDGNEHLK
RRF_HELMI       DKSVLPALEKAILKSDLGLTPTSDGAVIRLVIPQLTQERRSELVKTVKKRAEEHRVILRNLRRDANEDVK
RRF_THISH       EKTMVSKVEKAIMTSDLGLNPSSMGTVIRVPMPALTEERRRDLVKVVRGEAENARVAIRNIRRDANNALK
RRF_BREBN       DKTALKEIDRALQQSDLGISPSNDGVIIRLIIPPLTEERRKELVKLAGKGGEEAKVAIRNIRRDANDEIK
RRF_BACSU       DKTAIGDIEKAILKADLGLTPTSDGNMIRIAIPALTXXXXXXXXXXXXXXXXXXXXXXRNVRRDANDDLK
RRF_XANC5       DKGMIKDVEKAIYASDLGLTPTVVGTVIRLNLPPLTEERRKELSKSVHGEGEDSKVAIRNIRRDANQQVK
RRF_XANAC       DKGMIKDVEKAIYASDLGLTPTVVGTVIRLNLPPLTEERRKELSKSVHGEGEDSKVAIRNIRRDANQQVK
RRF_TRIEI       DKTSLGLIEKAINMSDVGLTPNNDGSIIRLNIPALTAERRQEMVKKTAKLAEEGKVSIRNIRRDAVDSIR
RRF_SYNP2       DRGSLSDVERAISMSDLGLTPNNDGTNIRLNIPPLTKERRQELVKTAGKLAEEGKVALRNIRRDAIDDVR
RRF_NOSP7       ERNTLNIIEKAISLSDVGLTPSNDGSVIRLNIPPLTSDRRKEFVKMATKYAEEGRVAIRNIRRDAIDSIR
RRF_COLP3       DKSMISAVEKAIMKSDLGLNPQSNGTLIRIPLPPLTEERRKDLVKVVRGEAEGGKVAIRNIRRDANSDFK
RRF_TREDE       DKGLLVEIEKAVLQADLSVNPTNDGKVIRIAIPPLTEDRRKDLAKKAKTIAENSRVSVRNIRRDGIDEAK
RRF_XANOR       DKGMIKDVEKAIYASDLGLTPTVVGTVIRLNLPPLTEERRKELSKSVHGEGEDSKVAIRNIRRDANQQVK
RRF_XANOP       DKGMIKDVEKAIYASDLGLTPTVVGTVIRLNLPPLTEERRKELSKSVHGEGEDSKVAIRNIRRDANQQVK
RRF_XANOM       DKGMIKDVEKAIYASDLGLTPTVVGTVIRLNLPPLTEERRKELSKSVHGEGEDSKVAIRNIRRDANQQVK
RRF_EUBR3       EASMVKEIEKAINCSDIGINPTNDGKLIRLVFPELTEERRKDLAKDIKKKGEEAKVAVRNIRRDAIDSIK
RRF_DESAA       DASVIKDIEKAILKSDLGLNPSNDGKIIRIAIPPLTEDRRKEMVKLVNKMSEEGKISVRNIRRDANETIK
RRF_CORGL       EMSSMQVIENAIRNSDLGVNPTNDGQVLRVTIPQLTEERRKDMVKLAKGKGEDGKIAIRNIRRKGMDQLK
RRF_CORGB       EMSSMQVIENAIRNSDLGVNPTNDGQVLRVTIPQLTEERRKDMVKLAKGKGEDGKIAIRNIRRKGMDQLK
RRF_CLOTE       DKSSLKAIEKAILVSDLGLNPNNDGTIIRLIIPELTEETRRNIVKTVKKYGEDTKIAIRSVRRDGNDKIK
RRF_IDILO       DKSASAAVEKAIINSDLGLNPASAGAVIRIPLPPLTEERRRDLVKIVRAEAENGRIAVRNIRRDANGDIK
RRF_LISW6       DKTVLGEIEKAILKSDLGLTPNNDGSVLRLSIPQLTXXXXXXXXXXXXXXXXXXXXXXXNIRREAXXXXX
RRF_LISMO       DKTILGEIEKAILKSDLGLTPNNDGSVLRLSIPQLTXXXXXXXXXXXXXXXXXXXXXXXNIRREAXXXXX
RRF_LISMF       DKTILGEIEKAILKSDLGLTPNNDGSVLRLSIPQLTXXXXXXXXXXXXXXXXXXXXXXXNIRREAXXXXX
RRF_LISMC       DKTILGEIEKAILKSDLGLTPNNDGSVLRLSIPQLTXXXXXXXXXXXXXXXXXXXXXXXNIRREAXXXXX
RRF_DESPS       DPQMIPPIEKAILKSGLGLNPVNDGKVVRLNIPQLTEDRRKDLVKQVKKIAEEFRVAIRNVRRDAIDTLK
RRF_NITWN       DKSMVKAVEKAIVDSNLGLSPATEGQVLRLRIPELNEERRKELVKVAHKYAEAAKVAVRHVRRDGLDTLK
RRF_FUSNN       DKTLISKIEKAILAANIGMTPNNDGRVIRLVLPELTADRRKEYVKLAKNEAENGKIAIRNIRKDINNHLK
RRF_ACTSZ       DRSLIQAVEKAILTSDLGLNPSSAGTTIRVPLPPLTEERRRDLTKLVKAEGEQGKVAVRNVRRDANEKIK
RRF_SYNAS       DTSALNAIEKAIQKSDLGLVPNNDGKVIRISIPPLTEARRKELVKVVRKMAEECKVKLRNARRDANEEFK
RRF_DEHSC       DRSCLSAIEKAIMKSDLGLMPNNDGNIIRLNIPPLSEERRQEMIKIVNKRLEEDKIAMRNVRRDAMDEMK
RRF_CORDI       EMSMMNEIENAIRNSDLGVNPTNDGQVLRVTIPQLTEERRRDMAKLAKSKGEDGKIAIRNVRRKGMDQLK
RRF_CLOK5       DKSALKSIEKAILKSDLGINPSNDGEIIRLIIPELTEETRKNIVKNIKKTGEDSKVAIRGIRRECNDKFK
RRF_CLOK1       DKSALKSIEKAILKSDLGINPSNDGEIIRLIIPELTEETRKNIVKNIKKTGEDSKVAIRGIRRECNDKFK
RRF_SHESA       DRSAIQAVEKAIMSSDLGLNPMSAGATLRIPLPALTEERRKDFIKVVRAEAEGGRVAIRNVRRDAISEVK
RRF_DEHE1       DRSCLSAIEKAIMKSDLGLMPNNDGNIIRLNIPPLSEERRQEMIKMVSKRLEEDKIAMRNVRRDAMDEMK
RRF_SHESW       DRSAIQAVEKAIMSSDLGLNPMSAGATLRIPLPALTEERRKDFIKVVRAEAEGGRVAIRNVRRDAISEVK
RRF_SHEPC       DRSAIQAVEKAIMSSDLGLNPMSAGATLRIPLPALTEERRKDFIKVVRAEAEGGRVAIRNVRRDAISEVK
RRF_HAES2       DRSLISAVEKAILTSDLGLNPSSAGTTIRVPLPPLTEERRRDLIKIVKGEGEQGKIAIRNVRRDANDQIK
RRF_HAES1       DRSLISAVEKAILTSDLGLNPSSAGTTIRVPLPPLTEERRRDLIKIVKGEGEQGKIAIRNVRRDANDQIK
RRF_HAEIN       DRSLISAVEKAILTSDLGLNPSSAGTTIRVPLPPLTEERRRDLIKIVKGEGEQGKVAVRNVRRDANDKIK
RRF_HAEIG       DRSLISAVEKAILTSDLGLNPSSAGTTIRVPLPPLTEERRRDLIKIVKGEGEQGKVAVRNVRRDANDKIK
RRF_GEOMG       EAKLIPVIEKAIMNANLGFTPANDGKTIRISLPPLTEERRKEIVKTLKKMAEDTKVAVRNIRRDGIDSLK
RRF_CLOTH       DAQILKEIEKEIQKSDIGINPNNDGKVIRLVFPPLTEERRKELTKLAKKYGEDAKVAIRSIRRDGIEKKK
RRF_ACIC1       DKGSLRAIEKAIRDSDLGVNPTDDGSVIRVAIPPLTEERRRDYIKMARHEAEEARVAIRNIRRHAKDALD
RRF_PROM1       DLGSLASIEKAIATSDLGFTPNNDGKIIRINVPPLTEERRKEFCKLASKYAEEGKVALRNIRREAIDRVK
RRF_MYCS2       EASQLRAIEDAIRNSDLGVNPSNDGNIIRVAIPQLTEERRRELVKQAKSKGEDAKVSVRNIRRKAMEELS
RRF_HAEI8       DRSLISAVEKAILTSDLGLNPSSAGTTIRVPLPPLTEERRRDLIKIVKGEGEQGKVAIRNVRRDANDKIK
RRF_VIBPA       DKELTQKVEKAIMMSDLGLNPMSAGTIIRVPLPPLTEERRKDLVKIVRGEAEGGRVAVRNIRRDANNDLK
RRF_SHESR       DRSAIQAVEKAIMSSDLGLNPMSAGATLRIPLPALTEERRKDFIKVVRAEAEGGRVAIRNVRRDAISDVK
RRF_SHESM       DRSAIQAVEKA