[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for spne4:ACF55766.1

[Show Plain Result]


## Summary of Sequence Search
    1::532
  319::570     4e-29  33%  577 aa  YESM_BACSU RecName: Full=Sensor histidine kinase yesM;       
  277::511     7e-23  27%  518 aa  Y224_STAAM RecName: Full=Uncharacterized sensor-like histidine
  277::511     7e-23  27%  518 aa  Y218_STAA3 RecName: Full=Uncharacterized sensor-like histidine
  277::511     7e-23  27%  518 aa  Y216_STAAN RecName: Full=Uncharacterized sensor-like histidine
  277::511     7e-23  27%  518 aa  Y215_STAAR RecName: Full=Uncharacterized sensor-like histidine
  277::511     7e-23  27%  518 aa  Y202_STAAC RecName: Full=Uncharacterized sensor-like histidine
  277::511     7e-23  27%  518 aa  Y199_STAAW RecName: Full=Uncharacterized sensor-like histidine
  277::511     7e-23  27%  518 aa  Y199_STAAS RecName: Full=Uncharacterized sensor-like histidine
  277::511     7e-23  27%  518 aa  Y185_STAA8 RecName: Full=Uncharacterized sensor-like histidine
  277::511     7e-23  27%  518 aa  Y162_STAAB RecName: Full=Uncharacterized sensor-like histidine
  350::566     1e-22  32%  584 aa  LYTS_STAHJ RecName: Full=Sensor protein lytS;       
  380::571     1e-22  32%  585 aa  LYTS_OCEIH RecName: Full=Sensor protein lytS;         EC=2.7.13.3;
  277::502     3e-21  29%  512 aa  Y166_STAES RecName: Full=Uncharacterized sensor-like histidine
  362::575     4e-21  33%  591 aa  LYTS_STAS1 RecName: Full=Sensor protein lytS;       
  350::566     4e-21  31%  591 aa  LYTS_STAEQ RecName: Full=Sensor protein lytS;       
  362::579     4e-21  32%  593 aa  LYTS_BACSU RecName: Full=Sensor protein lytS;         EC=2.7.13.3;
  340::573     6e-21  29%  589 aa  LYTS_BACAN RecName: Full=Sensor protein lytS;         EC=2.7.13.3;
  340::573     8e-21  29%  589 aa  LYTS_BACCR RecName: Full=Sensor protein lytS;         EC=2.7.13.3;
  277::502     1e-20  28%  512 aa  Y2405_STAEQ RecName: Full=Uncharacterized sensor-like histidine
  350::566     1e-20  31%  591 aa  LYTS_STAES RecName: Full=Sensor protein lytS;       
  376::526     4e-19  32%  584 aa  LYTS_STAAR RecName: Full=Sensor protein lytS;       
  351::533     7e-19  32%  565 aa  YPDA_ECOLI RecName: Full=Inner membrane protein ypdA;
  351::533     7e-19  32%  565 aa  YPDA_ECO57 RecName: Full=Inner membrane protein ypdA;
  376::526     2e-18  32%  584 aa  LYTS_STAAW RecName: Full=Sensor protein lytS;       
  376::526     2e-18  32%  584 aa  LYTS_STAAS RecName: Full=Sensor protein lytS;       
  376::526     2e-18  32%  584 aa  LYTS_STAAN RecName: Full=Sensor protein lytS;       
  376::526     2e-18  32%  584 aa  LYTS_STAAM RecName: Full=Sensor protein lytS;       
  376::526     2e-18  32%  584 aa  LYTS_STAAC RecName: Full=Sensor protein lytS;       
  376::526     2e-18  32%  584 aa  LYTS_STAAB RecName: Full=Sensor protein lytS;       
  376::526     2e-18  32%  584 aa  LYTS_STAA8 RecName: Full=Sensor protein lytS;       
  376::526     2e-18  32%  584 aa  LYTS_STAA3 RecName: Full=Sensor protein lytS;       
  376::579     8e-18  27%  589 aa  LYTS_ENTFA RecName: Full=Sensor protein lytS;         EC=2.7.13.3;
  371::513     2e-16  36%  581 aa  LYTS_STRA5 RecName: Full=Sensor protein lytS;         EC=2.7.13.3;
  371::513     2e-16  36%  581 aa  LYTS_STRA3 RecName: Full=Sensor protein lytS;         EC=2.7.13.3;
  371::522     2e-15  33%  580 aa  LYTS_STRMU RecName: Full=Sensor protein lytS;         EC=2.7.13.3;
  370::507     4e-14  26%  561 aa  YEHU_SHIFL RecName: Full=Inner membrane protein yehU;Flags:
  370::507     4e-14  26%  561 aa  YEHU_ECOLI RecName: Full=Inner membrane protein yehU;Flags:
  370::507     4e-14  26%  561 aa  YEHU_ECOL6 RecName: Full=Inner membrane protein yehU;Flags:
   38::321     9e-06  23%  370 aa  GTCS_ANEMI RecName: Full=Sensor protein gtcS;         EC=2.7.13.3;
  340::453     1e-05  25%  460 aa  HSSS_STAS1 RecName: Full=Heme sensor protein hssS;       
  122::258     3e-05  34%  470 aa  ACDG2_METMA RecName: Full=Acetyl-CoA decarbonylase/synthase complex
  122::258     3e-05  34%  470 aa  ACDG1_METMA RecName: Full=Acetyl-CoA decarbonylase/synthase complex
   30::97      4e-04  32%  143 aa  SP2AB_CLOBB RecName: Full=Anti-sigma F factor;       
   30::97      5e-04  31%  143 aa  SP2AB_CLOBA RecName: Full=Anti-sigma F factor;       
  159::233     7e-04  23%  545 aa  HTR5_HALSA RecName: Full=Halobacterial transducer protein
  422::551     9e-04  24%  595 aa  KINB_PSEAE RecName: Full=Alginate biosynthesis sensor protein kinB;
    1::532

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YESM_BACSU      ----------------------------------------------------------------------
Y224_STAAM      ----------------------------------------------------------------------
Y218_STAA3      ----------------------------------------------------------------------
Y216_STAAN      ----------------------------------------------------------------------
Y215_STAAR      ----------------------------------------------------------------------
Y202_STAAC      ----------------------------------------------------------------------
Y199_STAAW      ----------------------------------------------------------------------
Y199_STAAS      ----------------------------------------------------------------------
Y185_STAA8      ----------------------------------------------------------------------
Y162_STAAB      ----------------------------------------------------------------------
LYTS_STAHJ      ----------------------------------------------------------------------
LYTS_OCEIH      ----------------------------------------------------------------------
Y166_STAES      ----------------------------------------------------------------------
LYTS_STAS1      ----------------------------------------------------------------------
LYTS_STAEQ      ----------------------------------------------------------------------
LYTS_BACSU      ----------------------------------------------------------------------
LYTS_BACAN      ----------------------------------------------------------------------
LYTS_BACCR      ----------------------------------------------------------------------
Y2405_STAEQ     ----------------------------------------------------------------------
LYTS_STAES      ----------------------------------------------------------------------
LYTS_STAAR      ----------------------------------------------------------------------
YPDA_ECOLI      ----------------------------------------------------------------------
YPDA_ECO57      ----------------------------------------------------------------------
LYTS_STAAW      ----------------------------------------------------------------------
LYTS_STAAS      ----------------------------------------------------------------------
LYTS_STAAN      ----------------------------------------------------------------------
LYTS_STAAM      ----------------------------------------------------------------------
LYTS_STAAC      ----------------------------------------------------------------------
LYTS_STAAB      ----------------------------------------------------------------------
LYTS_STAA8      ----------------------------------------------------------------------
LYTS_STAA3      ----------------------------------------------------------------------
LYTS_ENTFA      ----------------------------------------------------------------------
LYTS_STRA5      ----------------------------------------------------------------------
LYTS_STRA3      ----------------------------------------------------------------------
LYTS_STRMU      ----------------------------------------------------------------------
YEHU_SHIFL      ----------------------------------------------------------------------
YEHU_ECOLI      ----------------------------------------------------------------------
YEHU_ECOL6      ----------------------------------------------------------------------
GTCS_ANEMI      ----------------------------------------------------------------------
HSSS_STAS1      ----------------------------------------------------------------------
ACDG2_METMA     ----------------------------------------------------------------------
ACDG1_METMA     ----------------------------------------------------------------------
SP2AB_CLOBB     ----------------------------------------------------------------------
SP2AB_CLOBA     ----------------------------------------------------------------------
HTR5_HALSA      ----------------------------------------------------------------------
KINB_PSEAE      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDYKEVYVSTKDKRSGEKIRAEDFKPAG
YESM_BACSU      ----------------------------------------------------------------------
Y224_STAAM      ----------------------------------------------------------------------
Y218_STAA3      ----------------------------------------------------------------------
Y216_STAAN      ----------------------------------------------------------------------
Y215_STAAR      ----------------------------------------------------------------------
Y202_STAAC      ----------------------------------------------------------------------
Y199_STAAW      ----------------------------------------------------------------------
Y199_STAAS      ----------------------------------------------------------------------
Y185_STAA8      ----------------------------------------------------------------------
Y162_STAAB      ----------------------------------------------------------------------
LYTS_STAHJ      ----------------------------------------------------------------------
LYTS_OCEIH      ----------------------------------------------------------------------
Y166_STAES      ----------------------------------------------------------------------
LYTS_STAS1      ----------------------------------------------------------------------
LYTS_STAEQ      ----------------------------------------------------------------------
LYTS_BACSU      ----------------------------------------------------------------------
LYTS_BACAN      ----------------------------------------------------------------------
LYTS_BACCR      ----------------------------------------------------------------------
Y2405_STAEQ     ----------------------------------------------------------------------
LYTS_STAES      ----------------------------------------------------------------------
LYTS_STAAR      ----------------------------------------------------------------------
YPDA_ECOLI      ----------------------------------------------------------------------
YPDA_ECO57      ----------------------------------------------------------------------
LYTS_STAAW      ----------------------------------------------------------------------
LYTS_STAAS      ----------------------------------------------------------------------
LYTS_STAAN      ----------------------------------------------------------------------
LYTS_STAAM      ----------------------------------------------------------------------
LYTS_STAAC      ----------------------------------------------------------------------
LYTS_STAAB      ----------------------------------------------------------------------
LYTS_STAA8      ----------------------------------------------------------------------
LYTS_STAA3      ----------------------------------------------------------------------
LYTS_ENTFA      ----------------------------------------------------------------------
LYTS_STRA5      ----------------------------------------------------------------------
LYTS_STRA3      ----------------------------------------------------------------------
LYTS_STRMU      ----------------------------------------------------------------------
YEHU_SHIFL      ----------------------------------------------------------------------
YEHU_ECOLI      ----------------------------------------------------------------------
YEHU_ECOL6      ----------------------------------------------------------------------
GTCS_ANEMI      ----------------------------------------------------------------------
HSSS_STAS1      ----------------------------------------------------------------------
ACDG2_METMA     -------------------------------------------DYKKFYVGRNLLLDGVAIRAASNDPA-
ACDG1_METMA     -------------------------------------------DYKKFYVGRNLLLDGVAIRAASNDPA-
SP2AB_CLOBB     ----------------------------------------------------------------------
SP2AB_CLOBA     ----------------------------------------------------------------------
HTR5_HALSA      ----------------------------------------------------------------------
KINB_PSEAE      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           NSFAIPVSDPVSDQDLGVIYISLDPAVLYHAIDNTRGHTPMAVTVTSPFDTEIFHIGETVDKESENWLVG
YESM_BACSU      ----------------------------------------------------------------------
Y224_STAAM      ----------------------------------------------------------------------
Y218_STAA3      ----------------------------------------------------------------------
Y216_STAAN      ----------------------------------------------------------------------
Y215_STAAR      ----------------------------------------------------------------------
Y202_STAAC      ----------------------------------------------------------------------
Y199_STAAW      ----------------------------------------------------------------------
Y199_STAAS      ----------------------------------------------------------------------
Y185_STAA8      ----------------------------------------------------------------------
Y162_STAAB      ----------------------------------------------------------------------
LYTS_STAHJ      ----------------------------------------------------------------------
LYTS_OCEIH      ----------------------------------------------------------------------
Y166_STAES      ----------------------------------------------------------------------
LYTS_STAS1      ----------------------------------------------------------------------
LYTS_STAEQ      ----------------------------------------------------------------------
LYTS_BACSU      ----------------------------------------------------------------------
LYTS_BACAN      ----------------------------------------------------------------------
LYTS_BACCR      ----------------------------------------------------------------------
Y2405_STAEQ     ----------------------------------------------------------------------
LYTS_STAES      ----------------------------------------------------------------------
LYTS_STAAR      ----------------------------------------------------------------------
YPDA_ECOLI      ----------------------------------------------------------------------
YPDA_ECO57      ----------------------------------------------------------------------
LYTS_STAAW      ----------------------------------------------------------------------
LYTS_STAAS      ----------------------------------------------------------------------
LYTS_STAAN      ----------------------------------------------------------------------
LYTS_STAAM      ----------------------------------------------------------------------
LYTS_STAAC      ----------------------------------------------------------------------
LYTS_STAAB      ----------------------------------------------------------------------
LYTS_STAA8      ----------------------------------------------------------------------
LYTS_STAA3      ----------------------------------------------------------------------
LYTS_ENTFA      ----------------------------------------------------------------------
LYTS_STRA5      ----------------------------------------------------------------------
LYTS_STRA3      ----------------------------------------------------------------------
LYTS_STRMU      ----------------------------------------------------------------------
YEHU_SHIFL      ----------------------------------------------------------------------
YEHU_ECOLI      ----------------------------------------------------------------------
YEHU_ECOL6      ----------------------------------------------------------------------
GTCS_ANEMI      ----------------------------------------------------------------------
HSSS_STAS1      ----------------------------------------------------------------------
ACDG2_METMA     -KFATAVKKVIENTELPVILCSFNPAVLKAGLEVAKGKNPLLYAA-----------------NKDNWKVG
ACDG1_METMA     -KFATAVKKVIENTELPVILCSFNPAVLKAGLEVAKGKNPLLYAA-----------------NKDNWKVG
SP2AB_CLOBB     ----------------------------------------------------------------------
SP2AB_CLOBA     ----------------------------------------------------------------------
HTR5_HALSA      ----------------------------------------------------------------------
KINB_PSEAE      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           LTSHGYQVQVAVPKNFVLQGTVTSSALIVGLSLLFIVILYLTLRQTFANYQKQVVDLVESIQVIAQGEXG
YESM_BACSU      ---------------------------------------------------EQLVTAMKSVQHSGI-EAG
Y224_STAAM      ----------------------------------------------------------------------
Y218_STAA3      ----------------------------------------------------------------------
Y216_STAAN      ----------------------------------------------------------------------
Y215_STAAR      ----------------------------------------------------------------------
Y202_STAAC      ----------------------------------------------------------------------
Y199_STAAW      ----------------------------------------------------------------------
Y199_STAAS      ----------------------------------------------------------------------
Y185_STAA8      ----------------------------------------------------------------------
Y162_STAAB      ----------------------------------------------------------------------
LYTS_STAHJ      ----------------------------------------------------------------------
LYTS_OCEIH      ----------------------------------------------------------------------
Y166_STAES      ----------------------------------------------------------------------
LYTS_STAS1      ----------------------------------------------------------------------
LYTS_STAEQ      ----------------------------------------------------------------------
LYTS_BACSU      ----------------------------------------------------------------------
LYTS_BACAN      ----------------------------------------------------------------------
LYTS_BACCR      ----------------------------------------------------------------------
Y2405_STAEQ     ----------------------------------------------------------------------
LYTS_STAES      ----------------------------------------------------------------------
LYTS_STAAR      ----------------------------------------------------------------------
YPDA_ECOLI      ----------------------------------------------------------------------
YPDA_ECO57      ----------------------------------------------------------------------
LYTS_STAAW      ----------------------------------------------------------------------
LYTS_STAAS      ----------------------------------------------------------------------
LYTS_STAAN      ----------------------------------------------------------------------
LYTS_STAAM      ----------------------------------------------------------------------
LYTS_STAAC      ----------------------------------------------------------------------
LYTS_STAAB      ----------------------------------------------------------------------
LYTS_STAA8      ----------------------------------------------------------------------
LYTS_STAA3      ----------------------------------------------------------------------
LYTS_ENTFA      ----------------------------------------------------------------------
LYTS_STRA5      ----------------------------------------------------------------------
LYTS_STRA3      ----------------------------------------------------------------------
LYTS_STRMU      ----------------------------------------------------------------------
YEHU_SHIFL      ----------------------------------------------------------------------
YEHU_ECOLI      ----------------------------------------------------------------------
YEHU_ECOL6      ----------------------------------------------------------------------
GTCS_ANEMI      -----------------------SSAWIVAWRLMEMVIVYLYSRWTSKRITGPLEKITDAIQKMREGEFA
HSSS_STAS1      ----------------------------------------------------------------------
ACDG2_METMA     ELALEYNVPVVVSAFNDLDGLKTLAKTFAEAGIKDIVLTYPTLKDTFTNFLK------------------
ACDG1_METMA     ELALEYNVPVVVSAFNDLDGLKTLAKTFAEAGIKDIVLTYPTLKDTFTNFLK------------------
SP2AB_CLOBB     ----------------------------------------------------------------------
SP2AB_CLOBA     ----------------------------------------------------------------------
HTR5_HALSA      ------------------------------------------IEQLAADLESQATEVGATLEAASDGDLT
KINB_PSEAE      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           RRIDISEKDQELLLIAETTNDMLDRLEKNIHDIYQLELSQKDANMRALQAQINPHFMYNTLEFLRMYAVM
YESM_BACSU      VSLSLPEHTQEAGMLNRHFTVMMKRINELMEENVEKQLIIKETELKALQAQINPHFLYNTLESINWLAKA
Y224_STAAM      ------KNNSELEEINNYIYDLFESNEQLIHSIEHTERRLRDIQLKEIERQFQPHFLFNTMQTIQ-YLIT
Y218_STAA3      ------KNNSELEEINNYIYDLFESNEQLIHSIEHTERRLRDIQLKEIERQFQPHFLFNTMQTIQ-YLIT
Y216_STAAN      ------KNNSELEEINNYIYDLFESNEQLIHSIEHTERRLRDIQLKEIERQFQPHFLFNTMQTIQ-YLIT
Y215_STAAR      ------KNNSELEEINNYIYDLFESNEQLIHSIEHTERRLRDIQLKEIERQFQPHFLFNTMQTIQ-YLIT
Y202_STAAC      ------KNNSELEEINNYIYDLFESNEQLIHSIEHTERRLRDIQLKEIERQFQPHFLFNTMQTIQ-YLIT
Y199_STAAW      ------KNNSELEEINNYIYDLFESNEQLIHSIEHTERRLRDIQLKEIERQFQPHFLFNTMQTIQ-YLIT
Y199_STAAS      ------KNNSELEEINNYIYDLFESNEQLIHSIEHTERRLRDIQLKEIERQFQPHFLFNTMQTIQ-YLIT
Y185_STAA8      ------KNNSELEEINNYIYDLFESNEQLIHSIEHTERRLRDIQLKEIERQFQPHFLFNTMQTIQ-YLIT
Y162_STAAB      ------KNNSELEEINNYIYDLFESNEQLIHSIEHTERRLRDIQLKEIERQFQPHFLFNTMQTIQ-YLIT
LYTS_STAHJ      ------------------------QLARGLADIFQLELGQKDAEIKSLQAQVNPHFFFNSINTISALVRI
LYTS_OCEIH      ---------------------------------------------RNLQAQINPHFLFNTFHLIHSLLRV
Y166_STAES      ------KKHSELEEINNYIYDLFESNEQLIQSIEQTERRLRDIQLKEIERQFQPHFLFNTMQTIQ-YLIP
LYTS_STAS1      ----------------------------------QLELGQRDAEIKSLQAQVNPHFFFNAINTISALIRI
LYTS_STAEQ      ------------------------QLAKGLANIFQLELGQKDAEIKSLQAQVNPHFFFNAINTISALVRI
LYTS_BACSU      ----------------------------------QLELGEKDAEIKALQAQVNPHFLFNAINTISALC-R
LYTS_BACAN      ----------QLSRVEEELAEGLAKIFSTQLELGEAELQSKDAEIKALQAQINPHFLFNAINTVS--ALC
LYTS_BACCR      ----------QLSRVEEELAEGLAKIFSTQLELGEAELQSKDAEIKALQAQINPHFLFNAINTVS--ALC
Y2405_STAEQ     ------KKHSELEEINNYIYDLFESNEQLIQSIEQTERRLRDIQLKEIERQFQPHFLFNTMQTIQ-YLIP
LYTS_STAES      ------------------------QLAKGLANIFQLELGQKDAEIKSLQAQVNPHFFFNAINTISALVRI
LYTS_STAAR      ----------------------------------------KDAEIKSLQAQVSPHFFFNSINTISALVRI
YPDA_ECOLI      ----------------------------------QLREMANKAELRALQSKINPHFLFNALNAISS-SIR
YPDA_ECO57      ----------------------------------QLREMANKAELRALQSKINPHFLFNALNAISS-SIR
LYTS_STAAW      ----------------------------------------KDAEIKSLQAQVSPHFFFNSINTISALVRI
LYTS_STAAS      ----------------------------------------KDAEIKSLQAQVSPHFFFNSINTISALVRI
LYTS_STAAN      ----------------------------------------KDAEIKSLQAQVSPHFFFNSINTISALVRI
LYTS_STAAM      ----------------------------------------KDAEIKSLQAQVSPHFFFNSINTISALVRI
LYTS_STAAC      ----------------------------------------KDAEIKSLQAQVSPHFFFNSINTISALVRI
LYTS_STAAB      ----------------------------------------KDAEIKSLQAQVSPHFFFNSINTISALVRI
LYTS_STAA8      ----------------------------------------KDAEIKSLQAQVSPHFFFNSINTISALVRI
LYTS_STAA3      ----------------------------------------KDAEIKSLQAQVSPHFFFNSINTISALVRI
LYTS_ENTFA      ----------------------------------------KEAEIKSLQAQVNPHFFFNAINTIS--ALM
LYTS_STRA5      ------------------------------------------AEIKALQAQINPHFFFNAINTISALIRI
LYTS_STRA3      ------------------------------------------AEIKALQAQINPHFFFNAINTISALIRI
LYTS_STRMU      ------------------------------------------AEIKALQSQINPHFFFNAINTISALIRL
YEHU_SHIFL      ------------------------------------------SEIKLLHAQVNPHFLFNALNTIKA-VIR
YEHU_ECOLI      ------------------------------------------SEIKLLHAQVNPHFLFNALNTIKA-VIR
YEHU_ECOL6      ------------------------------------------SEIKLLHAQVNPHFLFNALNTIKA-VIR
GTCS_ANEMI      QRLCF-KADYELTLIQEHFNEMVAHLEKTEAEKNKLEQSKQRMLLDLSHDFKTPITTIQGYAMALQMGVV
HSSS_STAS1      ----------------------------------------------------------------------
ACDG2_METMA     ----------------------------------------------------------------------
ACDG1_METMA     ----------------------------------------------------------------------
SP2AB_CLOBB     ----------------------------------------------------------------------
SP2AB_CLOBA     ----------------------------------------------------------------------
HTR5_HALSA      ARVDATTDNAEIAEVATVVNDMLTTMERTIDEIQGFSTNVTTASREA-----------------------
KINB_PSEAE      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           QSQDELADIIYEFSSLLRNNISDERETLLKQELEFCRKYSYLCMVRYPKSIAYGFKIDPELENMKIPKFT
YESM_BACSU      NQQKQISKMVESLGFLLRNSIHMKKDIVIQEEADIVRHYMTIQRFRFEERLKFTLDIDDEVKHCLIPKLT
Y224_STAAM      LSPKLAQTVVQQLSQMLRYSLRTNSHTVLNEELNYIEQYVAIQNIRFDDMIKLHIESSEEARHQTIGKMM
Y218_STAA3      LSPKLAQTVVQQLSQMLRYSLRTNSHTVLNEELNYIEQYVAIQNIRFDDMIKLHIESSEEARHQTIGKMM
Y216_STAAN      LSPKLAQTVVQQLSQMLRYSLRTNSHTVLNEELNYIEQYVAIQNIRFDDMIKLHIESSEEARHQTIGKMM
Y215_STAAR      LSPKLAQTVVQQLSQMLRYSLRTNSHTVLNEELNYIEQYVAIQNIRFDDMIKLHIESSEEARHQTIGKMM
Y202_STAAC      LSPKLAQTVVQQLSQMLRYSLRTNSHTVLNEELNYIEQYVAIQNIRFDDMIKLHIESSEEARHQTIGKMM
Y199_STAAW      LSPKLAQTVVQQLSQMLRYSLRTNSHTVLNEELNYIEQYVAIQNIRFDDMIKLHIESSEEARHQTIGKMM
Y199_STAAS      LSPKLAQTVVQQLSQMLRYSLRTNSHTVLNEELNYIEQYVAIQNIRFDDMIKLHIESSEEARHQTIGKMM
Y185_STAA8      LSPKLAQTVVQQLSQMLRYSLRTNSHTVLNEELNYIEQYVAIQNIRFDDMIKLHIESSEEARHQTIGKMM
Y162_STAAB      LSPKLAQTVVQQLSQMLRYSLRTNSHTVLNEELNYIEQYVAIQNIRFDDMIKLHIESSEEARHQTIGKMM
LYTS_STAHJ      DSE-KARKLLLQLSQFFRSNLQGARNNTLGKELQQVEAYLALEQARFPDRFTIQYHIDSSCKHVLIPPFV
LYTS_OCEIH      DAE-KARHILVQLSQFMRANLKIASESLLHKELEHLQAYLEIVQARFPDQISTSIHVDDYLLDIEIPPAT
Y166_STAES      LSPKVAQTVIQQLSQMLRYSLRTASHTVLAEELSYIEQYVAIQNIRFDDMIQLYIDATEGVQHQTIGKMM
LYTS_STAS1      DSE-KARELLLQLSQFFRSNLQGARNNTISLEKELQQVESYLSLARYPDRFNVSFDIDRTCYGALVPPFA
LYTS_STAEQ      DSE-KARRLLIQLSQFFRSNLNGARNNTLQKELQQVAAYLSLEQARYPNRFNIHYRIDDQCQDALIPPFI
LYTS_BACSU      TDVEKTRKLLLQLSVYFRSNLQGARQLLLSKELNHLNAYLSLEQARFPGKYKIELNIDSRLEQIEIPPFV
LYTS_BACAN      RTDVEKAKLLLQLSVYFRCNLQGARQLLLEQELNHVQAYLSLEQARFPNKYEVKMYIEDELKTTLVPPFV
LYTS_BACCR      RTDVEKAKLLLQLSVYFRCNLQGARQLLLEQELNHVQAYLSLEQARFPNKYEVKMYIEDELKTTLVPPFV
Y2405_STAEQ     LSPKVAQTVIQQLSQMLRYSLRTASHTVLAEELSYIQQYVAIQNIRFDDMIQLYIDAPEDVQHQTIGKMM
LYTS_STAES      DSE-KARRLLIQLSQFFRSNLNGARNNTLQKELQQVAAYLSLEQARYPNRFNIHYRIDDQCQDALIPPFI
LYTS_STAAR      NSE-KARELLLELSYFFRANLSKQHTITLDKELSQVRAYLSLEQARYPGRFNININVEDKYRNVLVPPFL
YPDA_ECOLI      LNPDTARQLIFNLSRYLRYNIEDDEQIDIKKELYQIKDYIAIEQARFGDKLTVIYDIDEEV-NCCIPSLL
YPDA_ECO57      LNPDTARQLIFNLSRYLRYNIEDDEQIDIKKELYQIKDYIAIEQARFGDKLTVIYDIDEEV-NCCIPSLL
LYTS_STAAW      NSE-KARELLLELSYFFRANLSKQHTITLDKELSQVRAYLSLEQARYPGRFNININVEDKYRDVLVPPFL
LYTS_STAAS      NSE-KARELLLELSYFFRANLSKQHTITLDKELSQVRAYLSLEQARYPGRFNININVEDKYRDVLVPPFL
LYTS_STAAN      NSE-KARELLLELSYFFRANLSKQHTITLDKELSQVRAYLSLEQARYPGRFNININVEDKYRDVLVPPFL
LYTS_STAAM      NSE-KARELLLELSYFFRANLSKQHTITLDKELSQVRAYLSLEQARYPGRFNININVEDKYRDVLVPPFL
LYTS_STAAC      NSE-KARELLLELSYFFRANLSKQHTITLDKELSQVRAYLSLEQARYPGRFNININVEDKYRDVLVPPFL
LYTS_STAAB      NSE-KARELLLELSYFFRANLSKQHTITLDKELSQVRAYLSLEQARYPGRFNININVEDKYRDVLVPPFL
LYTS_STAA8      NSE-KARELLLELSYFFRANLSKQHTITLDKELSQVRAYLSLEQARYPGRFNININVEDKYRDVLVPPFL
LYTS_STAA3      NSE-KARELLLELSYFFRANLSKQHTITLDKELSQVRAYLSLEQARYPGRFNININVEDKYRDVLVPPFL
LYTS_ENTFA      RKDSEKAKLLLQLSKYFRGNLQGAVQTTISQELEQVKAYLSLEQARFPNRYQVTFDVEEAVASEKVPPYA
LYTS_STRA5      DS-DKARYALMQLSTFFRTSLQQDREVTLEQEKSHVDAYMNVEKLRFPDKYQLSYDISAP-EKMKLPPFG
LYTS_STRA3      DS-DKARYALMQLSTFFRTSLQQDREVTLEQEKSHVDAYMNVEKLRFPDKYQLSYDISAP-EKMKLPPFG
LYTS_STRMU      DA-NKARYALMQLSTFFRTSLQQDREISLEQEKAHVDAYMNLEKLRFPDKYQLDYHITVSTK-MTLPPFG
YEHU_SHIFL      RDSEQASQLVQYLSTFFRKNLKRPSEVTLADEIEHVNAYLQIEKARFQSRLQVNIAIPQELSQQQLPAFT
YEHU_ECOLI      RDSEQASQLVQYLSTFFRKNLKRPSEVTLADEIEHVNAYLQIEKARFQSRLQVNIAIPQELSQQQLPAFT
YEHU_ECOL6      RDSEQASQLVQYLSTFFRKNLKRPSEVTLADEIEHVNAYLQIEKARFQSRLQVNIAIPQELSQQQLPAFT
GTCS_ANEMI      DSQRRYLEMIYNKSIIVTALVEDQLATLDSPDLPSAEEHGRFGRTGSEIAIAYDLKIPTQRVMIRMNRNL
HSSS_STAS1      ---------------------------------------------------------DLETISMNGNERL
ACDG2_METMA     ----------------------------------------------------------------------
ACDG1_METMA     ----------------------------------------------------------------------
SP2AB_CLOBB     -------------------------------------------------------QLDPTIDEISDVKTA
SP2AB_CLOBA     -------------------------------------------------------QLDPTIDEISDVKTA
HTR5_HALSA      ----------------------------------------------------------------------
KINB_PSEAE      ---EEMSRLVLLINDLL--NFSRYQTGMQKLELASCDLVDLLTQAQQPKGVSLQLELGDELPRLQLDRLQ


                         .         .         +         .         .         .         .:490
query           LQPLVENYFAHGVDHRRTDNVISIKALKQDGFVEILVVDNGRGMSAEKLANIREKLSQRYFEHQASYSDQ
YESM_BACSU      LQPLAENAIQYALEPFTRPCAIRIQAKKAKGCVCITVEDNGPGMDGRILE-----------------STG
Y224_STAAM      LQPLIENAIKHGRDTESLDITIRLTLARQN--LHVLVCDNGIGMSSSRLQYVRQSLNNDVFD--------
Y218_STAA3      LQPLIENAIKHGRDTESLDITIRLTLARQN--LHVLVCDNGIGMSSSRLQYVRQSLNNDVFD--------
Y216_STAAN      LQPLIENAIKHGRDTESLDITIRLTLARQN--LHVLVCDNGIGMSSSRLQYVRQSLNNDVFD--------
Y215_STAAR      LQPLIENAIKHGRDTESLDITIRLTLARQN--LHVLVCDNGIGMSSSRLQYVRQSLNNDVFD--------
Y202_STAAC      LQPLIENAIKHGRDTESLDITIRLTLARQN--LHVLVCDNGIGMSSSRLQYVRQSLNNDVFD--------
Y199_STAAW      LQPLIENAIKHGRDTESLDITIRLTLARQN--LHVLVCDNGIGMSSSRLQYVRQSLNNDVFD--------
Y199_STAAS      LQPLIENAIKHGRDTESLDITIRLTLARQN--LHVLVCDNGIGMSSSRLQYVRQSLNNDVFD--------
Y185_STAA8      LQPLIENAIKHGRDTESLDITIRLTLARQN--LHVLVCDNGIGMSSSRLQYVRQSLNNDVFD--------
Y162_STAAB      LQPLIENAIKHGRDTESLDITIRLTLARQN--LHVLVCDNGIGMSSSRLQYVRQSLNNDVFD--------
LYTS_STAHJ      IQILVENAIKHAFKHRRKDNIIDVVAHHDNEELTLTVRDNGSGIDDDKLPLIGQ---------MSVDSET
LYTS_OCEIH      LQPLVENSIQHGLSLSTSKGILTINITKTDNNVSIVLLDNGQGFE-EKLLPILGKKPLHQNENKGN----
Y166_STAES      LQPLVENAIKHGRDSEPLKITIRIRLTKRK--LHILVHDNGIGMSPSHLEHVRQSLHHDVFD--------
LYTS_STAS1      IQILVENAIKHAFKNRKYNNEIIVKAHKAQTGLVISVSDNGHGIPYEKLDKIGK---------TSVHSES
LYTS_STAEQ      IQILVENSIKHAFKNRKKNNHIDVDVSMKQDYLSISVQDNGQGIPADQLDXXXXXXXXXXXXXXNA----
LYTS_BACSU      LQVLVENALRHAFPKKQDICKVTVCVLSDDASVYMKVADNGRGIPPDVLPELGKK---------PFPSKE
LYTS_BACAN      LQLLVENALRHAFPKKQPVCEVEVHVFEKEGMVHFEVKDNGQGIEEERLEQLGKMVVS---------SKK
LYTS_BACCR      LQLLVENALRHAFPKKQPVCEVEVHVFEKEGMVHFEVKDNGQGIEEERLEQLGKMVVS---------SKK
Y2405_STAEQ     LQPLVENAIKHGRGSEPLKITIRIRLTKRK--LHILVHDNGIGMSPSHLERVRQSLHHDVFD--------
LYTS_STAES      IQILVENSIKHAFKNRKKNNHIDVDVSMKQDCLSISVQDNGQGIPADQLDXXXXXXXXXXXXXXNA----
LYTS_STAAR      IQILVENAIKHAFTNRKQGNDIDVSVIKETAHVRIIVQDNGQGISKDKM---------------------
YPDA_ECOLI      IQPLVENAIVHGIQPCKGKGVVTISVAECGNRVRIAVRDTGHG------------IDPKVIERVEANEMP
YPDA_ECO57      IQPLVENAIVHGIQPCKGKGVVTISVAECGNRVRIAVRDTGHG------------IDPKVIERVEANEMP
LYTS_STAAW      IQILVENAIKHAFTNRKQGNDIDVSVIKETAHVRIIVQDNGQGISKDKM---------------------
LYTS_STAAS      IQILVENAIKHAFTNRKQGNDIDVSVIKETAHVRIIVQDNGQGISKDKM---------------------
LYTS_STAAN      IQILVENAIKHAFTNRKQGNDIDVSVIKETAHVRIIVQDNGQGISKDKM---------------------
LYTS_STAAM      IQILVENAIKHAFTNRKQGNDIDVSVIKETAHVRIIVQDNGQGISKDKM---------------------
LYTS_STAAC      IQILVENAIKHAFTNRKQGNDIDVSVIKETAHVRIIVQDNGQGISKDKM---------------------
LYTS_STAAB      IQILVENAIKHAFTNRKQGNDIDVSVIKETAHVRIIVQDNGQGISKDKM---------------------
LYTS_STAA8      IQILVENAIKHAFTNRKQGNDIDVSVIKETAHVRIIVQDNGQGISKDKM---------------------
LYTS_STAA3      IQILVENAIKHAFTNRKQGNDIDVSVIKETAHVRIIVQDNGQGISKDKM---------------------
LYTS_ENTFA      IQVLVENTIKHAFGSRKENNQVRVVVKAKQHKLHVDVYDNGQGIPEER---------RLLLGKTTVTSEK
LYTS_STRA5      LQVLVENAVRHAFKERKTDNHILVQ-IKPDGYYCVSVSDNGQGIS-------------------------
LYTS_STRA3      LQVLVENAVRHAFKERKTDNHILVQ-IKPDGYYCVSVSDNGQGIS-------------------------
LYTS_STRMU      LQVLVENAVRHAFKERKKDNHICISITDQGEFYKVAVSDNGQGIS----PNMIDKLGQ------------
YEHU_SHIFL      LQPIVENAIKHGTSQLLDTGRVAISARREGQHLMLEIEDN------------------------------
YEHU_ECOLI      LQPIVENAIKHGTSQLLDTGRVAISARREGQHLMLEIEDN------------------------------
YEHU_ECOL6      LQPIVENAIKHGTSQLLDTGRVAISARREGQHLMLEIEDN------------------------------
GTCS_ANEMI      LYRALSNLLSNTLKHNPKGTKVALSLTDTHEAILLEVMDNGIGIAEE----LKESIFQPFVRGDKARTGE
HSSS_STAS1      LHQAFQNLITNAIKYSTTGGMVDVTLSQNLETITCTITDDGQGMSAETQARIFERF------YKSSNHDN
ACDG2_METMA     ----------------------------------------------------------------------
ACDG1_METMA     ----------------------------------------------------------------------
SP2AB_CLOBB     VSEAVTNSIIHGYENKE-DGVIKIEVEICDGEVTIEITDNGKGI--EDIPKVMEPL--------------
SP2AB_CLOBA     VSEAVTNSIIHGYENKE-DGIIKIEVEICDGEVTIEITDNGKGI--EDIPKVMEPL--------------
HTR5_HALSA      ----------------------------------------------------------------------
KINB_PSEAE      IERVIDNLLENALRHSSEGGQIHLQARRQGDRVLIAVEDNGEGIPFSQQGRIFEPFVQ------------


                         *         .         .         .         .         +         .:560
query           RQSIGIVNVHERFVLYFGDRYAITIESAEQAGVQYRITIQDE
YESM_BACSU      GRGIGLWNIRERISLTFGEPYGLRIHSEHEKGTRIVITI---
Y224_STAAM      TKHLGLNHLHNKAMIQYGSHARLHIFSKRNQGICYKIPL---
Y218_STAA3      TKHLGLNHLHNKAMIQYGSHARLHIFSKRNQGICYKIPL---
Y216_STAAN      TKHLGLNHLHNKAMIQYGSHARLHIFSKRNQGICYKIPL---
Y215_STAAR      TKHLGLNHLHNKAMIQYGSHARLHIFSKRNQGICYKIPL---
Y202_STAAC      TKHLGLNHLHNKAMIQYGSHARLHIFSKRNQGICYKIPL---
Y199_STAAW      TKHLGLNHLHNKAMIQYGSHARLHIFSKRNQGICYKIPL---
Y199_STAAS      TKHLGLNHLHNKAMIQYGSHARLHIFSKRNQGICYKIPL---
Y185_STAA8      TKHLGLNHLHNKAMIQYGSHARLHIFSKRNQGICYKIPL---
Y162_STAAB      TKHLGLNHLHNKAMIQYGSHARLHIFSKRNLGICYKIPL---
LYTS_STAHJ      GTGSALENLNRRLIGLYGTKAALHFESTE-------------
LYTS_OCEIH      --GIALYNINQRLISLLGEDSQLHIQNTDKGSM---------
Y166_STAES      TTHLGLNHLHNRAMIQYGTYARLHIFSRSQQG----------
LYTS_STAS1      GTGSALENLNRRLDGLFGYEASLQIHSDHQ-GTQVSCTI---
LYTS_STAEQ      -----LVNLNKRLTGLFGTTSALNIQSSQ-------------
LYTS_BACSU      GTGTALYNLNQRLIGLFGQQAALHISSEVHKGVSFQVPMQ--
LYTS_BACAN      GTGTALYNINERLIGLFGKETMLHIESEVNEGTEITFVI---
LYTS_BACCR      GTGTALYNINERLIGLFGKETMLHIESELNEGTEITFVI---
Y2405_STAEQ     TTHLGLNHLHNRAIIQYGTYARLHIFSRSHQG----------
LYTS_STAES      -----LVNLNKRLTGLFGTTSALNIQSSQ-------------
LYTS_STAAR      ------------------------------------------
YPDA_ECOLI      GNKIGLLNVHHRVKLLYGE-----------------------
YPDA_ECO57      GNKIGLLNVHHRVKLLYGE-----------------------
LYTS_STAAW      ------------------------------------------
LYTS_STAAS      ------------------------------------------
LYTS_STAAN      ------------------------------------------
LYTS_STAAM      ------------------------------------------
LYTS_STAAC      ------------------------------------------
LYTS_STAAB      ------------------------------------------
LYTS_STAA8      ------------------------------------------
LYTS_STAA3      ------------------------------------------
LYTS_ENTFA      GTGTALENLSRRMANLYGSEGCFLIENLETGGSHVHLEIPME
LYTS_STRA5      ------------------------------------------
LYTS_STRA3      ------------------------------------------
LYTS_STRMU      ------------------------------------------
YEHU_SHIFL      ------------------------------------------
YEHU_ECOLI      ------------------------------------------
YEHU_ECOL6      ------------------------------------------
GTCS_ANEMI      GTGLGLPSPKKR------------------------------
HSSS_STAS1      SNGLGLAIAKAIFELHHG---TITVDSEKNAGTTFTITFK--
ACDG2_METMA     ------------------------------------------
ACDG1_METMA     ------------------------------------------
SP2AB_CLOBB     ------------------------------------------
SP2AB_CLOBA     ------------------------------------------
HTR5_HALSA      ------------------------------------------
KINB_PSEAE      ------------------------------------------