[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for spne4:ACF55904.1

[Show Plain Result]


## Summary of Sequence Search
    1::474
    4::475       0.0  69%  475 aa  GAPN_STRMU RecName: Full=NADP-dependent glyceraldehyde-3-phosphate
    4::474     e-173  67%  476 aa  GAPN_STREI RecName: Full=NADP-dependent glyceraldehyde-3-phosphate
   22::488     e-125  51%  496 aa  GAPN_NICPL RecName: Full=NADP-dependent glyceraldehyde-3-phosphate
   16::488     e-125  49%  496 aa  GAPN_WHEAT RecName: Full=NADP-dependent glyceraldehyde-3-phosphate
   21::488     e-124  49%  496 aa  GAPN_APIGR RecName: Full=NADP-dependent glyceraldehyde-3-phosphate
   18::490     e-123  48%  498 aa  GAPN_MAIZE RecName: Full=NADP-dependent glyceraldehyde-3-phosphate
   16::488     e-120  48%  496 aa  GAPN_PEA RecName: Full=NADP-dependent glyceraldehyde-3-phosphate
   16::488     e-114  47%  496 aa  GAPN_ARATH RecName: Full=NADP-dependent glyceraldehyde-3-phosphate
    3::465     5e-80  36%  465 aa  LADH_META3 RecName: Full=Lactaldehyde dehydrogenase;       
    1::233     4e-78  60%  233 aa  GAPN_SCEVA RecName: Full=NADP-dependent glyceraldehyde-3-phosphate
    3::460     8e-76  36%  463 aa  LADH_METJA RecName: Full=Lactaldehyde dehydrogenase;       
    3::461     7e-75  35%  465 aa  LADH_METVS RecName: Full=Lactaldehyde dehydrogenase;       
    3::461     1e-73  35%  465 aa  LADH_METM7 RecName: Full=Lactaldehyde dehydrogenase;       
    3::461     1e-72  35%  465 aa  LADH_METM5 RecName: Full=Lactaldehyde dehydrogenase;       
    3::461     3e-72  35%  465 aa  LADH_METMP RecName: Full=Lactaldehyde dehydrogenase;       
   10::476     1e-70  35%  482 aa  GABD_ECOLI RecName: Full=Succinate-semialdehyde dehydrogenase
   10::465     2e-68  34%  488 aa  ALDH1_BACSU RecName: Full=Probable aldehyde dehydrogenase ycbD;    
    1::474     9e-67  35%  485 aa  ALDH5_BACSU RecName: Full=Putative aldehyde dehydrogenase yfmT;    
   50::520     4e-66  33%  528 aa  SSDH_ARATH RecName: Full=Succinate-semialdehyde dehydrogenase,
   70::484     1e-64  35%  488 aa  ALDH_BACST RecName: Full=Aldehyde dehydrogenase, thermostable;     
   25::488     2e-64  35%  496 aa  YLX7_SCHPO RecName: Full=Putative aldehyde dehydrogenase-like
    5::474     1e-62  34%  485 aa  ALDY_BACSU RecName: Full=Uncharacterized aldehyde dehydrogenase
   94::503     1e-61  37%  512 aa  AL1A3_HUMAN RecName: Full=Aldehyde dehydrogenase family 1 member
   94::503     3e-61  36%  512 aa  AL1A3_RAT RecName: Full=Aldehyde dehydrogenase family 1 member A3; 
   58::507     9e-61  30%  512 aa  Y4UC_RHISN RecName: Full=Putative aldehyde-dehydrogenase-like
   42::513     1e-60  33%  518 aa  AL1A2_CHICK RecName: Full=Retinal dehydrogenase 2;       
    4::436     2e-60  34%  462 aa  GABD_BACSU RecName: Full=Succinate-semialdehyde dehydrogenase
   19::479     2e-60  32%  490 aa  BETB_PSEMY RecName: Full=Betaine aldehyde dehydrogenase;       
   82::488     2e-60  36%  497 aa  ALDH_ASPNG RecName: Full=Aldehyde dehydrogenase;       
   42::513     2e-60  33%  518 aa  AL1A2_HUMAN RecName: Full=Retinal dehydrogenase 2;       
   48::511     5e-60  34%  520 aa  ALDH5_YEAS7 RecName: Full=Aldehyde dehydrogenase 5, mitochondrial; 
   95::511     5e-60  34%  518 aa  A9A1B_DANRE RecName: Full=Aldehyde dehydrogenase family 9 member
   48::511     1e-59  34%  520 aa  ALDH5_YEAST RecName: Full=Aldehyde dehydrogenase 5, mitochondrial; 
  120::489     1e-59  37%  495 aa  PUUC_ECOLI RecName: Full=Gamma-glutamyl-gamma-aminobutyraldehyde
   20::479     1e-59  32%  490 aa  BETB_PSEFS RecName: Full=Betaine aldehyde dehydrogenase;       
   71::487     3e-59  34%  494 aa  AL9A1_MOUSE RecName: Full=4-trimethylaminobutyraldehyde
  101::513     3e-59  36%  518 aa  AL1A2_RAT RecName: Full=Retinal dehydrogenase 2;       
  101::513     4e-59  36%  518 aa  AL1A2_MOUSE RecName: Full=Retinal dehydrogenase 2;       
   66::478     5e-59  34%  489 aa  BETB_BURPP RecName: Full=Betaine aldehyde dehydrogenase;       
   80::487     9e-59  35%  497 aa  ALDH_EMENI RecName: Full=Aldehyde dehydrogenase;       
   82::478     1e-58  35%  499 aa  FEAB_ECOLI RecName: Full=Phenylacetaldehyde dehydrogenase;       
   84::492     1e-58  35%  500 aa  ALDH_AGABI RecName: Full=Aldehyde dehydrogenase;       
  106::506     2e-58  33%  519 aa  ALDH4_YEAST RecName: Full=Potassium-activated aldehyde
   84::496     2e-58  35%  501 aa  AL1A1_MACFA RecName: Full=Retinal dehydrogenase 1;       
   66::478     3e-58  34%  489 aa  BETB_BURXL RecName: Full=Betaine aldehyde dehydrogenase;       
   94::508     3e-58  35%  512 aa  AL1A3_MOUSE RecName: Full=Aldehyde dehydrogenase family 1 member
   42::512     3e-58  33%  517 aa  AL1A2_TAEGU RecName: Full=Retinal dehydrogenase 2;       
   71::487     4e-58  33%  494 aa  AL9A1_RAT RecName: Full=4-trimethylaminobutyraldehyde
   84::496     4e-58  36%  501 aa  AL1A1_SHEEP RecName: Full=Retinal dehydrogenase 1;       
   28::479     7e-58  31%  490 aa  BETB_ACIAD RecName: Full=Betaine aldehyde dehydrogenase;       
   79::491     7e-58  35%  496 aa  AL1A1_RABIT RecName: Full=Retinal dehydrogenase 1;       
   25::496     9e-58  32%  501 aa  AL1A1_HUMAN RecName: Full=Retinal dehydrogenase 1;       
   84::496     9e-58  36%  501 aa  AL1A1_BOVIN RecName: Full=Retinal dehydrogenase 1;       
  484::881     2e-57  38%  902 aa  FTHFD_XENTR RecName: Full=10-formyltetrahydrofolate dehydrogenase; 
   17::475     2e-57  31%  486 aa  BETB_VIBPA RecName: Full=Betaine aldehyde dehydrogenase;       
   84::496     2e-57  34%  501 aa  AL1A7_MOUSE RecName: Full=Aldehyde dehydrogenase, cytosolic 1;     
   66::478     2e-57  34%  489 aa  BETB_BURCM RecName: Full=Betaine aldehyde dehydrogenase;       
   80::486     2e-57  34%  496 aa  ALDH_CLAHE RecName: Full=Aldehyde dehydrogenase;       
   66::478     3e-57  34%  489 aa  BETB_BURA4 RecName: Full=Betaine aldehyde dehydrogenase;       
   70::475     3e-57  34%  481 aa  BETB2_RHIME RecName: Full=Betaine aldehyde dehydrogenase 2;        
   19::479     4e-57  31%  490 aa  BETB_PSEAE RecName: Full=Betaine aldehyde dehydrogenase;       
   19::479     4e-57  31%  490 aa  BETB_PSEA8 RecName: Full=Betaine aldehyde dehydrogenase;       
   19::479     4e-57  31%  490 aa  BETB_PSEA7 RecName: Full=Betaine aldehyde dehydrogenase;       
    6::470     4e-57  32%  475 aa  ALD1_STAHJ RecName: Full=Putative aldehyde dehydrogenase SH0913;   
   19::479     5e-57  31%  490 aa  BETB_PSEAB RecName: Full=Betaine aldehyde dehydrogenase;       
   46::520     6e-57  33%  523 aa  SSDH_RAT RecName: Full=Succinate-semialdehyde dehydrogenase,
   37::471     6e-57  33%  515 aa  ROCA_BACWK RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   84::496     6e-57  35%  501 aa  AL1A1_MOUSE RecName: Full=Retinal dehydrogenase 1;       
   37::471     8e-57  32%  515 aa  ROCA_GEOSW RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
  102::514     8e-57  35%  519 aa  AL1B1_RAT RecName: Full=Aldehyde dehydrogenase X, mitochondrial;   
   84::496     8e-57  35%  501 aa  AL1A1_RAT RecName: Full=Retinal dehydrogenase 1;       
   86::493     1e-56  35%  503 aa  YF19_SCHPO RecName: Full=Putative aldehyde dehydrogenase-like
   37::471     1e-56  32%  515 aa  ROCA_BACCN RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
    7::479     2e-56  31%  490 aa  BETB_ACIBT RecName: Full=Betaine aldehyde dehydrogenase;       
   66::479     2e-56  33%  490 aa  BETB_PECCP RecName: Full=Betaine aldehyde dehydrogenase;       
    7::475     3e-56  34%  483 aa  NAHF_PSEU8 RecName: Full=Salicylaldehyde dehydrogenase;       
    7::475     3e-56  34%  483 aa  NAHF_PSEPU RecName: Full=Salicylaldehyde dehydrogenase;       
   66::480     3e-56  34%  487 aa  BETB_BRUSU RecName: Full=Betaine aldehyde dehydrogenase;       
   66::480     3e-56  34%  487 aa  BETB_BRUSI RecName: Full=Betaine aldehyde dehydrogenase;       
   66::480     3e-56  34%  487 aa  BETB_BRUO2 RecName: Full=Betaine aldehyde dehydrogenase;       
   66::480     3e-56  34%  487 aa  BETB_BRUME RecName: Full=Betaine aldehyde dehydrogenase;       
   66::480     3e-56  34%  487 aa  BETB_BRUC2 RecName: Full=Betaine aldehyde dehydrogenase;       
   66::480     3e-56  34%  487 aa  BETB_BRUAB RecName: Full=Betaine aldehyde dehydrogenase;       
   66::480     3e-56  34%  487 aa  BETB_BRUA2 RecName: Full=Betaine aldehyde dehydrogenase;       
   66::480     3e-56  34%  487 aa  BETB_BRUA1 RecName: Full=Betaine aldehyde dehydrogenase;       
    7::479     3e-56  31%  490 aa  BETB_ACIBY RecName: Full=Betaine aldehyde dehydrogenase;       
    7::479     3e-56  31%  490 aa  BETB_ACIB5 RecName: Full=Betaine aldehyde dehydrogenase;       
    7::479     3e-56  31%  490 aa  BETB_ACIB3 RecName: Full=Betaine aldehyde dehydrogenase;       
    9::470     3e-56  34%  475 aa  ALD1_STAAW RecName: Full=Putative aldehyde dehydrogenase MW2046;   
    9::470     3e-56  34%  475 aa  ALD1_STAAS RecName: Full=Putative aldehyde dehydrogenase SAS2025;  
    9::470     3e-56  34%  475 aa  ALD1_STAAN RecName: Full=Putative aldehyde dehydrogenase SA1924;   
    9::470     3e-56  34%  475 aa  ALD1_STAAM RecName: Full=Putative aldehyde dehydrogenase SAV2122;  
    9::470     3e-56  34%  475 aa  ALD1_STAAC RecName: Full=Putative aldehyde dehydrogenase SACOL2114;
    9::470     3e-56  34%  475 aa  ALD1_STAA8 RecName: Full=Putative aldehyde dehydrogenase
    9::470     3e-56  34%  475 aa  ALD1_STAA3 RecName: Full=Putative aldehyde dehydrogenase
  100::512     3e-56  35%  517 aa  AL1B1_HUMAN RecName: Full=Aldehyde dehydrogenase X, mitochondrial; 
    7::479     4e-56  31%  490 aa  BETB_ACIBC RecName: Full=Betaine aldehyde dehydrogenase;       
    9::486     4e-56  33%  497 aa  BADH_SPIOL RecName: Full=Betaine aldehyde dehydrogenase,
    9::470     4e-56  34%  475 aa  ALD1_STAAR RecName: Full=Putative aldehyde dehydrogenase SAR2210;  
   92::504     4e-56  35%  509 aa  AL1A1_CHICK RecName: Full=Retinal dehydrogenase 1;       
    7::479     5e-56  31%  490 aa  BETB_ACIBS RecName: Full=Betaine aldehyde dehydrogenase;       
   37::471     7e-56  33%  515 aa  ROCA_GEOTN RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   37::471     7e-56  32%  515 aa  ROCA_BACCR RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   37::471     7e-56  32%  515 aa  ROCA_BACC4 RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   37::471     7e-56  32%  515 aa  ROCA_BACC2 RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   24::472     7e-56  32%  483 aa  BETB_RHOS5 RecName: Full=Betaine aldehyde dehydrogenase;       
  505::902     7e-56  36%  923 aa  AL1L2_HUMAN RecName: Full=Probable 10-formyltetrahydrofolate
   66::479     9e-56  33%  490 aa  BETB_YERPY RecName: Full=Betaine aldehyde dehydrogenase;       
   80::496     9e-56  33%  503 aa  BADH_GADCA RecName: Full=Betaine aldehyde dehydrogenase;       
   88::496     9e-56  33%  500 aa  ALDH6_YEAST RecName: Full=Magnesium-activated aldehyde
   84::496     9e-56  34%  501 aa  ALDH1_MACPR RecName: Full=Aldehyde dehydrogenase, cytosolic 1;     
  100::512     9e-56  35%  517 aa  AL1B1_PONAB RecName: Full=Aldehyde dehydrogenase X, mitochondrial; 
   83::495     9e-56  35%  500 aa  AL1A1_HORSE RecName: Full=Retinal dehydrogenase 1;       
   66::472     1e-55  34%  483 aa  BETB_RHOSK RecName: Full=Betaine aldehyde dehydrogenase;       
   66::472     1e-55  34%  483 aa  BETB_RHOS1 RecName: Full=Betaine aldehyde dehydrogenase;       
   66::480     1e-55  33%  487 aa  BETB_BRUMB RecName: Full=Betaine aldehyde dehydrogenase;       
   13::486     1e-55  33%  495 aa  ALDA_STAAW RecName: Full=Putative aldehyde dehydrogenase aldA;     
   13::486     1e-55  33%  495 aa  ALDA_STAAS RecName: Full=Putative aldehyde dehydrogenase aldA;     
   13::486     1e-55  33%  495 aa  ALDA_STAAN RecName: Full=Putative aldehyde dehydrogenase aldA;     
   13::486     1e-55  33%  495 aa  ALDA_STAAM RecName: Full=Putative aldehyde dehydrogenase aldA;     
   37::471     2e-55  32%  515 aa  ROCA_BACHK RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   37::471     2e-55  32%  515 aa  ROCA_BACCZ RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   37::471     2e-55  32%  515 aa  ROCA_BACCQ RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   37::471     2e-55  32%  515 aa  ROCA_BACC7 RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   37::471     2e-55  32%  515 aa  ROCA_BACC3 RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   37::471     2e-55  32%  515 aa  ROCA_BACC0 RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   37::471     2e-55  32%  515 aa  ROCA_BACAN RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   37::471     2e-55  32%  515 aa  ROCA_BACAH RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   37::471     2e-55  32%  515 aa  ROCA_BACAC RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   37::471     2e-55  32%  515 aa  ROCA_BACAA RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   12::463     2e-55  31%  477 aa  GABD_DEIRA RecName: Full=Succinate-semialdehyde dehydrogenase
   81::489     2e-55  34%  497 aa  ALDH_ENCBU RecName: Full=Aldehyde dehydrogenase;       
   82::498     2e-55  34%  506 aa  ALDH2_YEAST RecName: Full=Aldehyde dehydrogenase [NAD(P)+] 1;      
   84::496     2e-55  34%  501 aa  ALDH1_ELEED RecName: Full=Aldehyde dehydrogenase, cytosolic 1;     
   13::486     2e-55  33%  495 aa  ALDA_STAAR RecName: Full=Putative aldehyde dehydrogenase aldA;     
   37::471     2e-55  32%  515 aa  ROCA_BACC1 RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
    9::470     2e-55  34%  475 aa  ALD1_STAAB RecName: Full=Putative aldehyde dehydrogenase SAB2006c; 
   66::472     3e-55  33%  483 aa  BETB_RHOS4 RecName: Full=Betaine aldehyde dehydrogenase;       
    9::470     3e-55  32%  475 aa  ALD1_STAES RecName: Full=Putative aldehyde dehydrogenase SE_1720;  
    9::470     3e-55  32%  475 aa  ALD1_STAEQ RecName: Full=Putative aldehyde dehydrogenase SERP1729; 
  143::487     3e-55  34%  494 aa  AL9A1_HUMAN RecName: Full=4-trimethylaminobutyraldehyde
   37::471     4e-55  32%  515 aa  ROCA_ANOFW RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
  484::901     4e-55  35%  902 aa  FTHFD_MOUSE RecName: Full=10-formyltetrahydrofolate dehydrogenase; 
  136::476     4e-55  35%  487 aa  BETB_SINMW RecName: Full=Betaine aldehyde dehydrogenase;       
  102::514     4e-55  33%  519 aa  ALDH2_RAT RecName: Full=Aldehyde dehydrogenase, mitochondrial;     
   83::495     4e-55  33%  500 aa  ALDH2_MESAU RecName: Full=Aldehyde dehydrogenase, mitochondrial;   
   13::486     4e-55  33%  495 aa  ALDA_STAAC RecName: Full=Putative aldehyde dehydrogenase aldA;     
   13::486     4e-55  33%  495 aa  ALDA_STAAB RecName: Full=Putative aldehyde dehydrogenase aldA;     
   13::486     4e-55  33%  495 aa  ALDA_STAA8 RecName: Full=Putative aldehyde dehydrogenase aldA;     
   13::486     4e-55  33%  495 aa  ALDA_STAA3 RecName: Full=Putative aldehyde dehydrogenase aldA;     
  143::487     4e-55  34%  494 aa  AL9A1_PONAB RecName: Full=4-trimethylaminobutyraldehyde
   18::488     6e-55  31%  497 aa  UGA2_YEAST RecName: Full=Succinate-semialdehyde dehydrogenase
   38::492     6e-55  34%  516 aa  ROCA_BACLD RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
  102::514     6e-55  33%  519 aa  ALDH2_MOUSE RecName: Full=Aldehyde dehydrogenase, mitochondrial;   
  102::514     6e-55  35%  519 aa  AL1B1_MOUSE RecName: Full=Aldehyde dehydrogenase X, mitochondrial; 
   11::478     8e-55  31%  489 aa  BETB_BURP8 RecName: Full=Betaine aldehyde dehydrogenase;       
   13::488     8e-55  34%  497 aa  ALDA_STAHJ RecName: Full=Putative aldehyde dehydrogenase aldA;     
   82::502     1e-54  34%  506 aa  ALDH3_YEAST RecName: Full=Aldehyde dehydrogenase [NAD(P)+] 2;      
  101::512     1e-54  33%  517 aa  ALDH2_PONAB RecName: Full=Aldehyde dehydrogenase, mitochondrial;   
  131::501     1e-54  35%  508 aa  A9A1A_DANRE RecName: Full=Aldehyde dehydrogenase family 9 member
  101::512     1e-54  33%  517 aa  ALDH2_HUMAN RecName: Full=Aldehyde dehydrogenase, mitochondrial;   
   17::475     2e-54  30%  486 aa  BETB_VIBHB RecName: Full=Betaine aldehyde dehydrogenase;       
   14::488     2e-54  31%  497 aa  ALDA_STAES RecName: Full=Putative aldehyde dehydrogenase aldA;     
   14::488     2e-54  31%  497 aa  ALDA_STAEQ RecName: Full=Putative aldehyde dehydrogenase aldA;     
    6::458     2e-54  31%  487 aa  IOLA_BACSU RecName: Full=Methylmalonate semialdehyde dehydrogenase
    6::458     2e-54  31%  487 aa  IOLA_BACNA RecName: Full=Methylmalonate semialdehyde dehydrogenase
  484::881     3e-54  37%  902 aa  FTHFD_XENLA RecName: Full=10-formyltetrahydrofolate dehydrogenase; 
  112::497     3e-54  34%  505 aa  AL9A1_ORYLA RecName: Full=Aldehyde dehydrogenase family 9 member
   66::480     4e-54  33%  487 aa  BETB_OCHA4 RecName: Full=Betaine aldehyde dehydrogenase;       
    5::485     5e-54  33%  501 aa  BADH1_ARATH RecName: Full=Betaine aldehyde dehydrogenase 1,
   37::471     6e-54  32%  515 aa  ROCA_GEOKA RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
  101::487     6e-54  32%  494 aa  AL9A1_BOVIN RecName: Full=4-trimethylaminobutyraldehyde
  484::901     8e-54  36%  902 aa  FTHFD_PONAB RecName: Full=10-formyltetrahydrofolate dehydrogenase; 
   20::479     8e-54  29%  490 aa  BETB_PSEPK RecName: Full=Betaine aldehyde dehydrogenase;       
   20::479     8e-54  29%  490 aa  BETB_PSEP1 RecName: Full=Betaine aldehyde dehydrogenase;       
   80::470     8e-54  34%  497 aa  ALDH_ALTAL RecName: Full=Aldehyde dehydrogenase;       
   82::492     8e-54  33%  501 aa  AL2C4_ARATH RecName: Full=Aldehyde dehydrogenase family 2 member
    6::458     1e-53  30%  487 aa  IOLA_BACA2 RecName: Full=Methylmalonate semialdehyde dehydrogenase
  117::476     1e-53  35%  487 aa  BETB_RHISN RecName: Full=Betaine aldehyde dehydrogenase;       
  136::476     1e-53  35%  487 aa  BETB_RHILW RecName: Full=Betaine aldehyde dehydrogenase;       
   20::479     1e-53  29%  490 aa  BETB_PSEPW RecName: Full=Betaine aldehyde dehydrogenase;       
    9::491     1e-53  32%  502 aa  BADH_ATRHO RecName: Full=Betaine aldehyde dehydrogenase,
  505::922     1e-53  33%  923 aa  AL1L2_MOUSE RecName: Full=Probable 10-formyltetrahydrofolate
  136::476     2e-53  35%  487 aa  BETB_RHIL3 RecName: Full=Betaine aldehyde dehydrogenase;       
   20::479     2e-53  29%  490 aa  BETB_PSEPG RecName: Full=Betaine aldehyde dehydrogenase;       
   11::479     2e-53  29%  490 aa  BETB_PSEPF RecName: Full=Betaine aldehyde dehydrogenase;       
   66::458     2e-53  35%  479 aa  ALDA_ECOLI RecName: Full=Lactaldehyde dehydrogenase;       
   66::478     2e-53  32%  489 aa  BETB_BURM1 RecName: Full=Betaine aldehyde dehydrogenase;       
   37::491     3e-53  35%  515 aa  ROCA2_BACSU RecName: Full=1-pyrroline-5-carboxylate dehydrogenase
    6::458     3e-53  30%  487 aa  IOLA2_BACLD RecName: Full=Methylmalonate semialdehyde dehydrogenase
  103::476     3e-53  35%  487 aa  BETB_RHILO RecName: Full=Betaine aldehyde dehydrogenase;       
   20::479     4e-53  29%  490 aa  BETB_PSEF5 RecName: Full=Betaine aldehyde dehydrogenase;       
  116::529     4e-53  35%  534 aa  AL2B7_ARATH RecName: Full=Aldehyde dehydrogenase family 2 member
  130::439     5e-53  38%  487 aa  XYLC_PSEPU RecName: Full=Benzaldehyde dehydrogenase [NAD+];        
   66::478     5e-53  32%  489 aa  BETB_BURCH RecName: Full=Betaine aldehyde dehydrogenase;       
   66::478     5e-53  32%  489 aa  BETB_BURCA RecName: Full=Betaine aldehyde dehydrogenase;       
  136::476     5e-53  35%  487 aa  BETB1_RHIME RecName: Full=Betaine aldehyde dehydrogenase 1;        
   74::488     5e-53  32%  501 aa  BADH_AMAHP RecName: Full=Betaine aldehyde dehydrogenase,
  103::515     5e-53  33%  520 aa  ALDH2_BOVIN RecName: Full=Aldehyde dehydrogenase, mitochondrial;   
   10::465     7e-53  34%  486 aa  IOLA1_OCEIH RecName: Full=Methylmalonate semialdehyde dehydrogenase
   10::462     7e-53  30%  491 aa  IOLA1_BACSK RecName: Full=Methylmalonate semialdehyde dehydrogenase
   66::478     7e-53  32%  489 aa  BETB_BURCC RecName: Full=Betaine aldehyde dehydrogenase;       
    6::471     9e-53  31%  474 aa  ABDH_ERWCT RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   11::479     1e-52  29%  490 aa  BETB_SERP5 RecName: Full=Betaine aldehyde dehydrogenase;       
  484::901     2e-52  35%  902 aa  FTHFD_HUMAN RecName: Full=10-formyltetrahydrofolate dehydrogenase; 
  136::476     2e-52  35%  487 aa  BETB_RHIEC RecName: Full=Betaine aldehyde dehydrogenase;       
   20::479     2e-52  30%  490 aa  BETB_PSEE4 RecName: Full=Betaine aldehyde dehydrogenase;       
    6::458     2e-52  30%  488 aa  IOLA_LISMF RecName: Full=Methylmalonate semialdehyde dehydrogenase
  136::476     2e-52  35%  487 aa  BETB_RHIE6 RecName: Full=Betaine aldehyde dehydrogenase;       
   66::478     2e-52  32%  489 aa  BETB_BURS3 RecName: Full=Betaine aldehyde dehydrogenase;       
   66::478     2e-52  32%  489 aa  BETB_BURCJ RecName: Full=Betaine aldehyde dehydrogenase;       
   74::482     3e-52  32%  493 aa  BETB_AGRT5 RecName: Full=Betaine aldehyde dehydrogenase;       
   46::520     3e-52  32%  523 aa  SSDH_MOUSE RecName: Full=Succinate-semialdehyde dehydrogenase,
   66::483     3e-52  31%  490 aa  BETB_PSE14 RecName: Full=Betaine aldehyde dehydrogenase;       
   40::490     5e-52  31%  514 aa  ROCA_STAS1 RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
  104::516     5e-52  32%  521 aa  ALDH2_PIG RecName: Full=Aldehyde dehydrogenase, mitochondrial;     
    6::471     5e-52  31%  474 aa  ABDH_PECCP RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
    6::458     6e-52  30%  488 aa  IOLA_LISMC RecName: Full=Methylmalonate semialdehyde dehydrogenase
   66::479     6e-52  32%  490 aa  BETB_YERP3 RecName: Full=Betaine aldehyde dehydrogenase;       
    9::470     6e-52  31%  475 aa  ALD1_STAS1 RecName: Full=Putative aldehyde dehydrogenase SSP0762;  
   11::483     6e-52  31%  487 aa  AL8A1_HUMAN RecName: Full=Aldehyde dehydrogenase family 8 member
    9::463     8e-52  29%  488 aa  IOLA1_GEOKA RecName: Full=Methylmalonate semialdehyde dehydrogenase
   66::483     8e-52  31%  490 aa  BETB_PSEU2 RecName: Full=Betaine aldehyde dehydrogenase;       
    6::458     1e-51  30%  488 aa  IOLA_LISIN RecName: Full=Methylmalonate semialdehyde dehydrogenase
   10::462     1e-51  30%  487 aa  IOLA3_BACCZ RecName: Full=Methylmalonate semialdehyde dehydrogenase
    7::481     1e-51  34%  490 aa  BETB_BACSU RecName: Full=Betaine aldehyde dehydrogenase;       
   83::489     1e-51  33%  495 aa  ALDH4_BACSU RecName: Full=Putative aldehyde dehydrogenase dhaS;    
   66::478     2e-51  32%  489 aa  BETB_BURVG RecName: Full=Betaine aldehyde dehydrogenase;       
  484::901     3e-51  34%  902 aa  FTHFD_RAT RecName: Full=10-formyltetrahydrofolate dehydrogenase;   
   66::479     3e-51  32%  490 aa  BETB_YERPP RecName: Full=Betaine aldehyde dehydrogenase;       
   66::479     3e-51  32%  490 aa  BETB_YERPN RecName: Full=Betaine aldehyde dehydrogenase;       
   66::479     3e-51  32%  490 aa  BETB_YERPE RecName: Full=Betaine aldehyde dehydrogenase;       
   66::479     3e-51  32%  490 aa  BETB_YERPB RecName: Full=Betaine aldehyde dehydrogenase;       
   66::479     3e-51  32%  490 aa  BETB_YERPA RecName: Full=Betaine aldehyde dehydrogenase;       
   66::479     4e-51  32%  490 aa  BETB_PSEU5 RecName: Full=Betaine aldehyde dehydrogenase;       
    6::458     5e-51  30%  488 aa  IOLA_LISMO RecName: Full=Methylmalonate semialdehyde dehydrogenase
   11::463     5e-51  30%  488 aa  IOLA2_BACCZ RecName: Full=Methylmalonate semialdehyde dehydrogenase
   10::462     7e-51  30%  487 aa  IOLA2_BACAH RecName: Full=Methylmalonate semialdehyde dehydrogenase
   19::483     7e-51  28%  490 aa  BETB_PSESM RecName: Full=Betaine aldehyde dehydrogenase;       
   93::506     7e-51  33%  511 aa  AL1B1_BOVIN RecName: Full=Aldehyde dehydrogenase X, mitochondrial; 
    6::458     9e-51  30%  488 aa  IOLA_LISMH RecName: Full=Methylmalonate semialdehyde dehydrogenase
  120::529     9e-51  33%  538 aa  AL2B4_ARATH RecName: Full=Aldehyde dehydrogenase family 2 member
   37::491     1e-50  30%  515 aa  ROCA_OCEIH RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   66::479     1e-50  32%  490 aa  BETB_YERPS RecName: Full=Betaine aldehyde dehydrogenase;       
   10::462     2e-50  30%  487 aa  IOLA2_BACHK RecName: Full=Methylmalonate semialdehyde dehydrogenase
  142::483     2e-50  36%  487 aa  AL8A1_MOUSE RecName: Full=Aldehyde dehydrogenase family 8 member
   84::496     2e-50  33%  501 aa  AL1A7_RAT RecName: Full=Aldehyde dehydrogenase, cytosolic 1;       
   10::462     2e-50  30%  487 aa  IOLA2_BACAN RecName: Full=Methylmalonate semialdehyde dehydrogenase
   47::455     4e-50  33%  458 aa  GABD1_MYCUA RecName: Full=Succinate-semialdehyde dehydrogenase
   11::489     6e-50  35%  517 aa  GABD2_MYCS2 RecName: Full=Putative succinate-semialdehyde
   66::482     7e-50  31%  489 aa  BETB_CHRSD RecName: Full=Betaine aldehyde dehydrogenase;       
  142::483     7e-50  36%  487 aa  AL8A1_BOVIN RecName: Full=Aldehyde dehydrogenase family 8 member
    1::479     9e-50  29%  490 aa  BETB_ERWCT RecName: Full=Betaine aldehyde dehydrogenase;       
   87::490     9e-50  31%  498 aa  ALDH2_LEITA RecName: Full=Aldehyde dehydrogenase, mitochondrial;   
   17::478     1e-49  29%  486 aa  BETB_VIBSL RecName: Full=Betaine aldehyde dehydrogenase;       
    4::479     1e-49  29%  490 aa  BETB_ECOLC RecName: Full=Betaine aldehyde dehydrogenase;       
   64::478     2e-49  31%  486 aa  BETB_VIBVU RecName: Full=Betaine aldehyde dehydrogenase;       
   66::479     2e-49  30%  490 aa  BETB_STRMK RecName: Full=Betaine aldehyde dehydrogenase;       
   66::479     2e-49  30%  490 aa  BETB_STRM5 RecName: Full=Betaine aldehyde dehydrogenase;       
    4::479     2e-49  29%  490 aa  BETB_ECOLI RecName: Full=Betaine aldehyde dehydrogenase;       
    4::479     2e-49  29%  490 aa  BETB_ECODH RecName: Full=Betaine aldehyde dehydrogenase;       
   66::478     2e-49  31%  489 aa  BETB_BURP1 RecName: Full=Betaine aldehyde dehydrogenase;       
   66::478     2e-49  31%  489 aa  BETB_BURP0 RecName: Full=Betaine aldehyde dehydrogenase;       
    8::465     2e-49  30%  486 aa  IOLA_BACCN RecName: Full=Methylmalonate semialdehyde dehydrogenase
    4::479     2e-49  29%  490 aa  BETB_ECOHS RecName: Full=Betaine aldehyde dehydrogenase;       
   66::478     2e-49  31%  489 aa  BETB_BURPS RecName: Full=Betaine aldehyde dehydrogenase;       
    4::479     3e-49  29%  490 aa  BETB_ECO55 RecName: Full=Betaine aldehyde dehydrogenase;       
    4::479     3e-49  29%  490 aa  BETB_ECO24 RecName: Full=Betaine aldehyde dehydrogenase;       
    9::461     4e-49  30%  484 aa  IOLA1_GEOTN RecName: Full=Methylmalonate semialdehyde dehydrogenase
   64::478     4e-49  31%  486 aa  BETB_VIBVY RecName: Full=Betaine aldehyde dehydrogenase;       
    4::479     5e-49  29%  490 aa  BETB_ECO8A RecName: Full=Betaine aldehyde dehydrogenase;       
   66::478     5e-49  31%  489 aa  BETB_BURMS RecName: Full=Betaine aldehyde dehydrogenase;       
   66::478     5e-49  31%  489 aa  BETB_BURMA RecName: Full=Betaine aldehyde dehydrogenase;       
   66::478     5e-49  31%  489 aa  BETB_BURM9 RecName: Full=Betaine aldehyde dehydrogenase;       
   66::478     5e-49  31%  489 aa  BETB_BURM7 RecName: Full=Betaine aldehyde dehydrogenase;       
   74::489     5e-49  31%  500 aa  BADH_BETVU RecName: Full=Betaine aldehyde dehydrogenase,
    8::465     6e-49  31%  486 aa  IOLA1_BACWK RecName: Full=Methylmalonate semialdehyde dehydrogenase
   80::491     6e-49  30%  496 aa  CROM_ENTDO RecName: Full=Omega-crystallin;
    4::479     6e-49  29%  490 aa  BETB_ECO5E RecName: Full=Betaine aldehyde dehydrogenase;       
    4::479     6e-49  29%  490 aa  BETB_ECO57 RecName: Full=Betaine aldehyde dehydrogenase;       
    8::465     8e-49  31%  486 aa  IOLA1_BACHK RecName: Full=Methylmalonate semialdehyde dehydrogenase
    8::465     8e-49  31%  486 aa  IOLA1_BACCZ RecName: Full=Methylmalonate semialdehyde dehydrogenase
    8::465     8e-49  31%  486 aa  IOLA1_BACAN RecName: Full=Methylmalonate semialdehyde dehydrogenase
    8::465     8e-49  31%  486 aa  IOLA1_BACAH RecName: Full=Methylmalonate semialdehyde dehydrogenase
    1::478     8e-49  28%  485 aa  BETB_MARMS RecName: Full=Betaine aldehyde dehydrogenase;       
    4::479     8e-49  30%  490 aa  BETB_KLEP3 RecName: Full=Betaine aldehyde dehydrogenase;       
   66::478     8e-49  31%  489 aa  BETB_BURP6 RecName: Full=Betaine aldehyde dehydrogenase;       
    8::465     1e-48  31%  486 aa  IOLA_BACCQ RecName: Full=Methylmalonate semialdehyde dehydrogenase
    8::465     1e-48  31%  486 aa  IOLA_BACC7 RecName: Full=Methylmalonate semialdehyde dehydrogenase
   73::455     1e-48  34%  472 aa  GABD1_MYCPA RecName: Full=Succinate-semialdehyde dehydrogenase
   73::455     1e-48  34%  472 aa  GABD1_MYCA1 RecName: Full=Succinate-semialdehyde dehydrogenase
    4::479     1e-48  29%  490 aa  BETB_SHIF8 RecName: Full=Betaine aldehyde dehydrogenase;       
    8::465     1e-48  31%  486 aa  IOLA_BACC4 RecName: Full=Methylmalonate semialdehyde dehydrogenase
    8::465     1e-48  31%  486 aa  IOLA_BACC2 RecName: Full=Methylmalonate semialdehyde dehydrogenase
    8::465     1e-48  32%  486 aa  IOLA_BACC1 RecName: Full=Methylmalonate semialdehyde dehydrogenase
   19::488     2e-48  31%  493 aa  SSDH2_SCHPO RecName: Full=Putative succinate-semialdehyde
    8::462     2e-48  31%  486 aa  IOLA_BACCR RecName: Full=Methylmalonate semialdehyde dehydrogenase
    9::461     2e-48  30%  484 aa  IOLA2_GEOKA RecName: Full=Methylmalonate semialdehyde dehydrogenase
    4::479     2e-48  29%  490 aa  BETB_ECOL6 RecName: Full=Betaine aldehyde dehydrogenase;       
    4::479     2e-48  29%  490 aa  BETB_ECOL5 RecName: Full=Betaine aldehyde dehydrogenase;       
   85::495     2e-48  33%  500 aa  BADH_SCHPO RecName: Full=Probable betaine aldehyde dehydrogenase;  
   60::532     2e-48  31%  535 aa  SSDH_HYLLA RecName: Full=Succinate-semialdehyde dehydrogenase,
    9::462     2e-48  30%  485 aa  IOLA_BACHD RecName: Full=Methylmalonate semialdehyde dehydrogenase
    8::460     2e-48  32%  483 aa  IOLA2_GEOTN RecName: Full=Methylmalonate semialdehyde dehydrogenase
    4::479     2e-48  29%  490 aa  BETB_ECOSE RecName: Full=Betaine aldehyde dehydrogenase;       
   45::511     2e-48  31%  511 aa  ALDHY_YEAST RecName: Full=Aldehyde dehydrogenase 2, mitochondrial; 
    8::460     3e-48  31%  484 aa  IOLA3_GEOKA RecName: Full=Methylmalonate semialdehyde dehydrogenase
   60::532     4e-48  30%  535 aa  SSDH_PANPA RecName: Full=Succinate-semialdehyde dehydrogenase,
   60::532     4e-48  30%  535 aa  SSDH_GORGO RecName: Full=Succinate-semialdehyde dehydrogenase,
   84::490     4e-48  30%  495 aa  CROM_OMMSL RecName: Full=Omega-crystallin;
    4::479     4e-48  29%  490 aa  BETB_ECOSM RecName: Full=Betaine aldehyde dehydrogenase;       
    7::485     4e-48  29%  503 aa  BADH2_ARATH RecName: Full=Betaine aldehyde dehydrogenase 2,
   63::532     5e-48  30%  535 aa  SSDH_HUMAN RecName: Full=Succinate-semialdehyde dehydrogenase,
    4::479     5e-48  28%  490 aa  BETB_ECOLU RecName: Full=Betaine aldehyde dehydrogenase;       
  117::476     5e-48  34%  487 aa  BETB_AGRRK RecName: Full=Betaine aldehyde dehydrogenase;       
   60::532     7e-48  30%  535 aa  SSDH_PONPY RecName: Full=Succinate-semialdehyde dehydrogenase,
   17::484     7e-48  33%  491 aa  GABD_RHISN RecName: Full=Probable succinate-semialdehyde
   47::435     7e-48  35%  471 aa  ASTD_NOVAD RecName: Full=N-succinylglutamate 5-semialdehyde
   60::532     1e-47  30%  535 aa  SSDH_PANTR RecName: Full=Succinate-semialdehyde dehydrogenase,
  112::490     1e-47  31%  514 aa  ROCA_STAES RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
  112::490     1e-47  31%  514 aa  ROCA_STAEQ RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   28::479     1e-47  29%  490 aa  BETB_ECO7I RecName: Full=Betaine aldehyde dehydrogenase;       
    4::479     1e-47  29%  490 aa  BETB_ECO45 RecName: Full=Betaine aldehyde dehydrogenase;       
    4::479     2e-47  29%  490 aa  BETB_ECO27 RecName: Full=Betaine aldehyde dehydrogenase;       
   37::491     8e-47  32%  515 aa  ROCA_BACP2 RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   24::477     8e-47  29%  511 aa  AL7A1_HUMAN RecName: Full=Alpha-aminoadipic semialdehyde
   83::495     1e-46  31%  500 aa  ALDH2_HORSE RecName: Full=Aldehyde dehydrogenase, mitochondrial;   
   65::482     1e-46  33%  486 aa  DMPC_PSEUF RecName: Full=2-hydroxymuconic semialdehyde
    8::460     2e-46  28%  483 aa  IOLA2_BACWK RecName: Full=Methylmalonate semialdehyde dehydrogenase
    1::480     2e-46  31%  491 aa  AMNC_PSESP RecName: Full=2-aminomuconic 6-semialdehyde
   57::530     3e-46  30%  596 aa  AL221_ARATH RecName: Full=Aldehyde dehydrogenase 22A1;       
    1::441     6e-46  29%  468 aa  HPCC_ECOLX RecName: Full=5-carboxymethyl-2-hydroxymuconate
   11::483     6e-46  31%  487 aa  AL8A1_DANRE RecName: Full=Aldehyde dehydrogenase family 8 member
  104::487     1e-45  31%  505 aa  BADH_ORYSJ RecName: Full=Betaine aldehyde dehydrogenase;       
    5::470     2e-45  29%  522 aa  YOSF_SCHPO RecName: Full=Putative aldehyde dehydrogenase-like
   70::489     5e-45  32%  518 aa  GABD2_MYCUA RecName: Full=Putative succinate-semialdehyde
   37::491     7e-45  29%  515 aa  ROCA1_BACHD RecName: Full=1-pyrroline-5-carboxylate dehydrogenase
   62::472     7e-45  31%  474 aa  ABDH_SERP5 RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
  112::490     9e-45  31%  514 aa  ROCA_STAHJ RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   12::463     9e-45  26%  492 aa  IOLA_LACCA RecName: Full=Methylmalonate semialdehyde dehydrogenase
   25::493     1e-44  29%  498 aa  SSDH1_SCHPO RecName: Full=Putative succinate-semialdehyde
   46::514     2e-44  29%  537 aa  MMSA_BOVIN RecName: Full=Methylmalonate-semialdehyde dehydrogenase
   37::471     2e-44  28%  515 aa  ROCA_BACSU RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   10::464     3e-44  29%  486 aa  IOLA2_BACSK RecName: Full=Methylmalonate semialdehyde dehydrogenase
   46::451     3e-44  31%  454 aa  GABD_SYNY3 RecName: Full=Probable succinate-semialdehyde
   53::457     3e-44  31%  462 aa  YNEI_ECOLI RecName: Full=Aldehyde dehydrogenase-like protein yneI; 
  172::490     3e-44  33%  514 aa  ROCA_STAAW RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
  172::490     3e-44  33%  514 aa  ROCA_STAAT RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
  172::490     3e-44  33%  514 aa  ROCA_STAAS RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
  172::490     3e-44  33%  514 aa  ROCA_STAAR RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
  172::490     3e-44  33%  514 aa  ROCA_STAAN RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
  172::490     3e-44  33%  514 aa  ROCA_STAAM RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
  172::490     3e-44  33%  514 aa  ROCA_STAAE RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
  172::490     3e-44  33%  514 aa  ROCA_STAAC RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
  172::490     3e-44  33%  514 aa  ROCA_STAAB RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
  172::490     3e-44  33%  514 aa  ROCA_STAA9 RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
  172::490     3e-44  33%  514 aa  ROCA_STAA8 RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
  172::490     3e-44  33%  514 aa  ROCA_STAA3 RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
  172::490     3e-44  33%  514 aa  ROCA_STAA2 RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
  172::490     3e-44  33%  514 aa  ROCA_STAA1 RecName: Full=1-pyrroline-5-carboxylate dehydrogenase;  
   10::462     3e-44  28%  486 aa  IOLA2_OCEIH RecName: Full=Methylmalonate semialdehyde dehydrogenase
   20::476     8e-44  29%  497 aa  MMSA_PSEAE RecName: Full=Methylmalonate-semialdehyde dehydrogenase
   10::462     1e-43  28%  486 aa  IOLA_BACP2 RecName: Full=Methylmalonate semialdehyde dehydrogenase
   28::477     1e-43  28%  511 aa  AL7A1_BOVIN RecName: Full=Alpha-aminoadipic semialdehyde
   44::472     2e-43  28%  535 aa  MMSA_MOUSE RecName: Full=Methylmalonate-semialdehyde dehydrogenase
    5::448     3e-43  30%  485 aa  ASTD_VIBHB RecName: Full=N-succinylglutamate 5-semialdehyde
   66::484     4e-43  29%  490 aa  BETB_XANCB RecName: Full=Betaine aldehyde dehydrogenase;       
   66::484     4e-43  29%  490 aa  BETB_XANC8 RecName: Full=Betaine aldehyde dehydrogenase;       
   44::472     5e-43  27%  535 aa  MMSA_RAT RecName: Full=Methylmalonate-semialdehyde dehydrogenase
   44::472     5e-43  27%  535 aa  MMSA_HUMAN RecName: Full=Methylmalonate-semialdehyde dehydrogenase
   66::484     5e-43  29%  490 aa  BETB_XANCP RecName: Full=Betaine aldehyde dehydrogenase;       
   11::489     7e-43  31%  518 aa  GABD2_MYCTU RecName: Full=Putative succinate-semialdehyde
   11::489     7e-43  31%  518 aa  GABD2_MYCTA RecName: Full=Putative succinate-semialdehyde
   11::489     7e-43  31%  518 aa  GABD2_MYCBP RecName: Full=Putative succinate-semialdehyde
   11::489     7e-43  31%  518 aa  GABD2_MYCBO RecName: Full=Putative succinate-semialdehyde
    5::448     9e-43  33%  485 aa  ASTD_VIBPA RecName: Full=N-succinylglutamate 5-semialdehyde
   24::477     1e-42  27%  511 aa  AL7A1_MOUSE RecName: Full=Alpha-aminoadipic semialdehyde
  148::487     1e-42  34%  505 aa  BADH_HORVU RecName: Full=Betaine aldehyde dehydrogenase;       
    4::452     1e-42  29%  489 aa  ASTD_CHRSD RecName: Full=N-succinylglutamate 5-semialdehyde
    1::452     6e-42  30%  489 aa  ASTD_IDILO RecName: Full=N-succinylglutamate 5-semialdehyde
   62::450     1e-41  31%  487 aa  ASTD_BURM1 RecName: Full=N-succinylglutamate 5-semialdehyde
   91::463     2e-41  31%  484 aa  IOLA1_BACLD RecName: Full=Methylmalonate semialdehyde dehydrogenase
    5::448     2e-41  29%  485 aa  ASTD_VIBSL RecName: Full=N-succinylglutamate 5-semialdehyde
    2::471     2e-41  32%  474 aa  ABDH_SALTY RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
    2::471     2e-41  31%  474 aa  ABDH_ECOLU RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
    2::471     3e-41  31%  474 aa  ABDH_SHIF8 RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   25::431     4e-41  28%  508 aa  AL7A1_MALDO RecName: Full=Aldehyde dehydrogenase family 7 member
    2::471     4e-41  31%  474 aa  ABDH_SHIFL RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   66::484     5e-41  29%  490 aa  BETB_XANC5 RecName: Full=Betaine aldehyde dehydrogenase;       
   63::471     5e-41  29%  474 aa  ABDH_ESCF3 RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   63::471     5e-41  29%  474 aa  ABDH_ECOUT RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   63::471     5e-41  29%  474 aa  ABDH_ECOSE RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   63::471     5e-41  29%  474 aa  ABDH_ECOLI RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   63::471     5e-41  29%  474 aa  ABDH_ECOL6 RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   63::471     5e-41  29%  474 aa  ABDH_ECOL5 RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   63::471     5e-41  29%  474 aa  ABDH_ECOK1 RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   63::471     5e-41  29%  474 aa  ABDH_ECODH RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   63::471     5e-41  29%  474 aa  ABDH_ECOBW RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   63::471     5e-41  29%  474 aa  ABDH_ECO8A RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   63::471     5e-41  29%  474 aa  ABDH_ECO81 RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   63::471     5e-41  29%  474 aa  ABDH_ECO45 RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   63::471     5e-41  29%  474 aa  ABDH_ECO27 RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   63::471     5e-41  29%  474 aa  ABDH_ECO24 RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   62::450     6e-41  31%  487 aa  ASTD_BURCH RecName: Full=N-succinylglutamate 5-semialdehyde
   62::450     6e-41  31%  487 aa  ASTD_BURCA RecName: Full=N-succinylglutamate 5-semialdehyde
   63::471     6e-41  29%  474 aa  ABDH_SHISS RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   63::471     6e-41  29%  474 aa  ABDH_ECOSM RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   63::471     6e-41  29%  474 aa  ABDH_ECOLC RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   63::471     6e-41  29%  474 aa  ABDH_ECOHS RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   61::434     8e-41  32%  487 aa  ASTD_BURXL RecName: Full=N-succinylglutamate 5-semialdehyde
   62::450     8e-41  32%  487 aa  ASTD_BURCM RecName: Full=N-succinylglutamate 5-semialdehyde
    5::448     1e-40  29%  485 aa  ASTD_VIBVY RecName: Full=N-succinylglutamate 5-semialdehyde
   62::450     1e-40  31%  487 aa  ASTD_BURCC RecName: Full=N-succinylglutamate 5-semialdehyde
   62::450     1e-40  31%  487 aa  ASTD_BURA4 RecName: Full=N-succinylglutamate 5-semialdehyde
   63::471     1e-40  29%  474 aa  ABDH_ECO55 RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
    3::471     1e-40  30%  474 aa  ABDH_CITK8 RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   62::450     2e-40  31%  487 aa  ASTD_BURS3 RecName: Full=N-succinylglutamate 5-semialdehyde
   25::456     2e-40  28%  508 aa  AL7B4_ARATH RecName: Full=Aldehyde dehydrogenase family 7 member
  104::590     2e-40  28%  644 aa  YHJ9_YEAST RecName: Full=Putative aldehyde dehydrogenase-like
  120::454     2e-40  32%  457 aa  GABD1_MYCTU RecName: Full=Succinate-semialdehyde dehydrogenase
  120::454     2e-40  32%  457 aa  GABD1_MYCTA RecName: Full=Succinate-semialdehyde dehydrogenase
  120::454     2e-40  32%  457 aa  GABD1_MYCBP RecName: Full=Succinate-semialdehyde dehydrogenase
  120::454     2e-40  32%  457 aa  GABD1_MYCBO RecName: Full=Succinate-semialdehyde dehydrogenase
    5::448     2e-40  29%  485 aa  ASTD_VIBVU RecName: Full=N-succinylglutamate 5-semialdehyde
    8::452     2e-40  29%  491 aa  ASTD_PHOLL RecName: Full=N-succinylglutamate 5-semialdehyde
   63::471     2e-40  29%  474 aa  ABDH_ECO5E RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   63::471     2e-40  29%  474 aa  ABDH_ECO57 RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
  115::482     3e-40  32%  486 aa  XYLG_PSEPU RecName: Full=2-hydroxymuconic semialdehyde
   34::503     3e-40  27%  528 aa  MMSA_DICDI RecName: Full=Probable methylmalonate-semialdehyde
   63::471     4e-40  29%  474 aa  ABDH_SHIDS RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   65::453     5e-40  31%  491 aa  ASTD_MARAV RecName: Full=N-succinylglutamate 5-semialdehyde
    2::471     9e-40  29%  474 aa  ABDH_SALAR RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
  113::586     1e-39  27%  607 aa  MMSA_ARATH RecName: Full=Methylmalonate-semialdehyde dehydrogenase
   66::484     1e-39  28%  490 aa  BETB_XANAC RecName: Full=Betaine aldehyde dehydrogenase;       
   24::455     2e-39  29%  494 aa  AL7A1_BRANA RecName: Full=Aldehyde dehydrogenase family 7 member
    2::471     2e-39  31%  474 aa  ABDH_SALTI RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
    5::448     3e-39  28%  485 aa  ASTD_ALISL RecName: Full=N-succinylglutamate 5-semialdehyde
    2::471     3e-39  31%  474 aa  ABDH_SALPC RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
    2::471     3e-39  31%  474 aa  ABDH_SALCH RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   46::479     3e-39  27%  531 aa  AL7A1_CAEEL RecName: Full=Putative aldehyde dehydrogenase family 7
   30::497     4e-39  26%  520 aa  MMSA_DROME RecName: Full=Probable methylmalonate-semialdehyde
   62::450     4e-39  31%  487 aa  ASTD_BURVG RecName: Full=N-succinylglutamate 5-semialdehyde
    2::471     4e-39  28%  474 aa  ABDH_SALPA RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   30::497     6e-39  27%  520 aa  MMSA_DROPS RecName: Full=Probable methylmalonate-semialdehyde
    2::471     6e-39  31%  474 aa  ABDH_SALPB RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   46::434     8e-39  32%  481 aa  ASTD_SPHAL RecName: Full=N-succinylglutamate 5-semialdehyde
   62::450     8e-39  30%  487 aa  ASTD_BURCJ RecName: Full=N-succinylglutamate 5-semialdehyde
  112::491     1e-38  28%  515 aa  ROCA2_BACHD RecName: Full=1-pyrroline-5-carboxylate dehydrogenase
   60::448     1e-38  29%  485 aa  ASTD_VIBCM RecName: Full=N-succinylglutamate 5-semialdehyde
    5::449     1e-38  29%  495 aa  ASTD_ENT38 RecName: Full=N-succinylglutamate 5-semialdehyde
    5::449     3e-38  28%  486 aa  ASTD_SHEHH RecName: Full=N-succinylglutamate 5-semialdehyde
   60::449     3e-38  30%  492 aa  ASTD_ECO5E RecName: Full=N-succinylglutamate 5-semialdehyde
   60::449     3e-38  30%  492 aa  ASTD_ECO57 RecName: Full=N-succinylglutamate 5-semialdehyde
   61::460     6e-38  32%  492 aa  ASTD_KLEP7 RecName: Full=N-succinylglutamate 5-semialdehyde
   31::498     8e-38  27%  521 aa  MMSA_ANOGA RecName: Full=Probable methylmalonate-semialdehyde
   60::449     8e-38  32%  492 aa  ASTD_ECOLC RecName: Full=N-succinylglutamate 5-semialdehyde
   61::449     8e-38  30%  492 aa  ASTD_CITK8 RecName: Full=N-succinylglutamate 5-semialdehyde
    5::449     1e-37  28%  486 aa  ASTD_SHEPW RecName: Full=N-succinylglutamate 5-semialdehyde
   49::437     1e-37  31%  472 aa  ASTD1_CAUCR RecName: Full=N-succinylglutamate 5-semialdehyde
   19::430     1e-37  27%  508 aa  AL7A1_PEA RecName: Full=Aldehyde dehydrogenase family 7 member A1; 
   47::483     2e-37  26%  523 aa  MMSA_CAEEL RecName: Full=Probable methylmalonate-semialdehyde
   62::450     2e-37  32%  487 aa  ASTD_PSEMY RecName: Full=N-succinylglutamate 5-semialdehyde
    6::450     2e-37  28%  488 aa  ASTD_PSEF5 RecName: Full=N-succinylglutamate 5-semialdehyde
   60::449     2e-37  32%  492 aa  ASTD_ECO8A RecName: Full=N-succinylglutamate 5-semialdehyde
   60::449     2e-37  32%  492 aa  ASTD_ECO55 RecName: Full=N-succinylglutamate 5-semialdehyde
   60::449     2e-37  32%  492 aa  ASTD_ECO24 RecName: Full=N-succinylglutamate 5-semialdehyde
   61::449     3e-37  31%  492 aa  ASTD_SALA4 RecName: Full=N-succinylglutamate 5-semialdehyde
    1::449     4e-37  28%  486 aa  ASTD_SHEPC RecName: Full=N-succinylglutamate 5-semialdehyde
   62::448     4e-37  33%  485 aa  ASTD2_CAUCR RecName: Full=N-succinylglutamate 5-semialdehyde
   61::449     5e-37  30%  486 aa  ASTD_SHESH RecName: Full=N-succinylglutamate 5-semialdehyde
   61::449     5e-37  31%  492 aa  ASTD_SALNS RecName: Full=N-succinylglutamate 5-semialdehyde
   62::447     5e-37  31%  484 aa  ASTD_CAUSK RecName: Full=N-succinylglutamate 5-semialdehyde
   61::450     7e-37  31%  489 aa  ASTD_SORC5 RecName: Full=N-succinylglutamate 5-semialdehyde
    5::449     7e-37  28%  486 aa  ASTD_SHEPA RecName: Full=N-succinylglutamate 5-semialdehyde
   63::449     7e-37  31%  492 aa  ASTD_SALSV RecName: Full=N-succinylglutamate 5-semialdehyde
   61::449     7e-37  32%  492 aa  ASTD_SALPB RecName: Full=N-succinylglutamate 5-semialdehyde
   61::449     7e-37  32%  492 aa  ASTD_SALAR RecName: Full=N-succinylglutamate 5-semialdehyde
   60::449     7e-37  32%  492 aa  ASTD_ECOSE RecName: Full=N-succinylglutamate 5-semialdehyde
   61::449     9e-37  31%  492 aa  ASTD_SALG2 RecName: Full=N-succinylglutamate 5-semialdehyde
   61::449     9e-37  31%  492 aa  ASTD_SALEP RecName: Full=N-succinylglutamate 5-semialdehyde
   60::449     9e-37  32%  492 aa  ASTD_ECOHS RecName: Full=N-succinylglutamate 5-semialdehyde
    5::448     1e-36  28%  485 aa  ASTD_VIBF1 RecName: Full=N-succinylglutamate 5-semialdehyde
    6::450     1e-36  29%  488 aa  ASTD_PSE14 RecName: Full=N-succinylglutamate 5-semialdehyde
   60::448     2e-36  28%  485 aa  ASTD_VIBCH RecName: Full=N-succinylglutamate 5-semialdehyde
   60::448     2e-36  28%  485 aa  ASTD_VIBC3 RecName: Full=N-succinylglutamate 5-semialdehyde
   65::449     2e-36  32%  492 aa  ASTD_SALTY RecName: Full=N-succinylglutamate 5-semialdehyde
   65::449     2e-36  31%  492 aa  ASTD_SALDC RecName: Full=N-succinylglutamate 5-semialdehyde
   19::495     2e-36  28%  506 aa  ALDH_VIBCH RecName: Full=Aldehyde dehydrogenase;       
   19::495     2e-36  28%  506 aa  ALDH_VIBC3 RecName: Full=Aldehyde dehydrogenase;       
  705::1112    3e-36  30% 1320 aa  PUTA_ECOLI RecName: Full=Bifunctional protein putA;Includes:
   60::449     3e-36  31%  492 aa  ASTD_ECOLI RecName: Full=N-succinylglutamate 5-semialdehyde
   60::449     3e-36  31%  492 aa  ASTD_ECODH RecName: Full=N-succinylglutamate 5-semialdehyde
   60::449     3e-36  31%  492 aa  ASTD_ECOBW RecName: Full=N-succinylglutamate 5-semialdehyde
   60::449     4e-36  32%  492 aa  ASTD_SHIB3 RecName: Full=N-succinylglutamate 5-semialdehyde
    5::449     4e-36  27%  486 aa  ASTD_SHEWM RecName: Full=N-succinylglutamate 5-semialdehyde
    5::448     4e-36  26%  485 aa  ASTD_PHOPR RecName: Full=N-succinylglutamate 5-semialdehyde
   61::449     4e-36  32%  486 aa  ASTD_CHRVO RecName: Full=N-succinylglutamate 5-semialdehyde
   71::460     4e-36  30%  498 aa  ASTD1_SHEDO RecName: Full=N-succinylglutamate 5-semialdehyde
    3::454     5e-36  25%  457 aa  GABD1_MYCLE RecName: Full=Succinate-semialdehyde dehydrogenase
   61::449     5e-36  30%  492 aa  ASTD_SALPK RecName: Full=N-succinylglutamate 5-semialdehyde
   61::449     5e-36  31%  492 aa  ASTD_SALPC RecName: Full=N-succinylglutamate 5-semialdehyde
   61::449     5e-36  30%  492 aa  ASTD_SALPA RecName: Full=N-succinylglutamate 5-semialdehyde
   19::463     6e-36  30%  505 aa  ASTD_YERPS RecName: Full=N-succinylglutamate 5-semialdehyde
   19::463     6e-36  30%  505 aa  ASTD_YERPB RecName: Full=N-succinylglutamate 5-semialdehyde
  705::1105    8e-36  31% 1312 aa  PUTA_KLEAE RecName: Full=Bifunctional protein putA;Includes:
   60::449     8e-36  32%  492 aa  ASTD_SHIBS RecName: Full=N-succinylglutamate 5-semialdehyde
    3::449     8e-36  29%  487 aa  ASTD_SHESA RecName: Full=N-succinylglutamate 5-semialdehyde
   65::449     8e-36  30%  492 aa  ASTD_SALHS RecName: Full=N-succinylglutamate 5-semialdehyde
   24::501     8e-36  29%  512 aa  ALDB_ECOLI RecName: Full=Aldehyde dehydrogenase B;       
    5::448     1e-35  29%  485 aa  ASTD_VIBFM RecName: Full=N-succinylglutamate 5-semialdehyde
    1::453     1e-35  25%  490 aa  ASTD_PSEA6 RecName: Full=N-succinylglutamate 5-semialdehyde
   19::463     1e-35  30%  505 aa  ASTD_YERPY RecName: Full=N-succinylglutamate 5-semialdehyde
   19::463     1e-35  30%  505 aa  ASTD_YERPG RecName: Full=N-succinylglutamate 5-semialdehyde
   19::463     1e-35  30%  505 aa  ASTD_YERPE RecName: Full=N-succinylglutamate 5-semialdehyde
   19::463     1e-35  30%  505 aa  ASTD_YERPA RecName: Full=N-succinylglutamate 5-semialdehyde
   60::449     1e-35  32%  492 aa  ASTD_ENTS8 RecName: Full=N-succinylglutamate 5-semialdehyde
   63::452     2e-35  32%  490 aa  ASTD_SERP5 RecName: Full=N-succinylglutamate 5-semialdehyde
   31::498     2e-35  26%  521 aa  MMSA_AEDAE RecName: Full=Probable methylmalonate-semialdehyde
   61::449     2e-35  30%  486 aa  ASTD_SHESW RecName: Full=N-succinylglutamate 5-semialdehyde
   61::449     2e-35  31%  486 aa  ASTD_SHEFN RecName: Full=N-succinylglutamate 5-semialdehyde
   60::449     3e-35  31%  492 aa  ASTD_ECOUT RecName: Full=N-succinylglutamate 5-semialdehyde
   60::449     3e-35  31%  492 aa  ASTD_ECO45 RecName: Full=N-succinylglutamate 5-semialdehyde
   64::452     3e-35  32%  489 aa  ASTD_AERHH RecName: Full=N-succinylglutamate 5-semialdehyde
   28::504     3e-35  30%  515 aa  ALDH_DEIRA RecName: Full=Aldehyde dehydrogenase;       
   18::495     4e-35  32%  506 aa  DHA2_RALEH RecName: Full=Acetaldehyde dehydrogenase 2;       
   19::463     5e-35  30%  505 aa  ASTD_YERPP RecName: Full=N-succinylglutamate 5-semialdehyde
   60::449     5e-35  31%  490 aa  ASTD_SHIDS RecName: Full=N-succinylglutamate 5-semialdehyde
    1::449     5e-35  27%  486 aa  ASTD_SHEB9 RecName: Full=N-succinylglutamate 5-semialdehyde
    1::449     5e-35  27%  486 aa  ASTD_SHEB5 RecName: Full=N-succinylglutamate 5-semialdehyde
   65::449     5e-35  30%  492 aa  ASTD_SALTI RecName: Full=N-succinylglutamate 5-semialdehyde
   63::452     5e-35  30%  489 aa  ASTD_AERS4 RecName: Full=N-succinylglutamate 5-semialdehyde
   60::449     9e-35  31%  492 aa  ASTD_ECOLU RecName: Full=N-succinylglutamate 5-semialdehyde
   69::449     9e-35  31%  492 aa  ASTD_ECO27 RecName: Full=N-succinylglutamate 5-semialdehyde
   63::471     9e-35  27%  474 aa  ABDH_ENT38 RecName: Full=Gamma-aminobutyraldehyde dehydrogenase;   
   60::449     1e-34  31%  492 aa  ASTD_SHIF8 RecName: Full=N-succinylglutamate 5-semialdehyde
   72::449     1e-34  32%  487 aa  ASTD_SHEON RecName: Full=N-succinylglutamate 5-semialdehyde
   60::449     1e-34  31%  492 aa  ASTD_ECO81 RecName: Full=N-succinylglutamate 5-semialdehyde
   60::449     1e-34  31%  492 aa  ASTD_ECOL5 RecName: Full=N-succinylglutamate 5-semialdehyde
   60::449     2e-34  31%  492 aa  ASTD_SHIFL RecName: Full=N-succinylglutamate 5-semialdehyde
   61::450     2e-34  31%  488 aa  ASTD_PSEU2 RecName: Full=N-succinylglutamate 5-semialdehyde
   60::449     2e-34  31%  492 aa  ASTD_ECOL6 RecName: Full=N-succinylglutamate 5-semialdehyde
   61::450     3e-34  29%  487 aa  ASTD_PSEAE RecName: Full=N-succinylglutamate 5-semialdehyde
   72::449     3e-34  32%  486 aa  ASTD2_SHEDO RecName: Full=N-succinylglutamate 5-semialdehyde
    1::451     3e-34  27%  489 aa  ASTD1_PSEHT RecName: Full=N-succinylglutamate 5-semialdehyde
   61::449     6e-34  29%  486 aa  ASTD_SHEB2 RecName: Full=N-succinylglutamate 5-semialdehyde
   65::453     6e-34  30%  490 aa  ASTD_HAHCH RecName: Full=N-succinylglutamate 5-semialdehyde
   62::434     7e-34  29%  487 aa  ASTD_BURTA RecName: Full=N-succinylglutamate 5-semialdehyde
   62::450     1e-33  30%  487 aa  ASTD_PSEPW RecName: Full=N-succinylglutamate 5-semialdehyde
   62::450     1e-33  31%  487 aa  ASTD_PSEE4 RecName: Full=N-succinylglutamate 5-semialdehyde
  705::1105    1e-33  29% 1320 aa  PUTA_SALTY RecName: Full=Bifunctional protein putA;Includes:
   66::455     1e-33  28%  492 aa  ASTD_COLP3 RecName: Full=N-succinylglutamate 5-semialdehyde
   18::477     2e-33  32%  506 aa  THCA_RHOER RecName: Full=EPTC-inducible aldehyde dehydrogenase;    
   61::449     2e-33  29%  486 aa  ASTD_SHEB8 RecName: Full=N-succinylglutamate 5-semialdehyde
   62::450     2e-33  30%  487 aa  ASTD_PSEPK RecName: Full=N-succinylglutamate 5-semialdehyde
   61::450     2e-33  28%  488 aa  ASTD2_PSEHT RecName: Full=N-succinylglutamate 5-semialdehyde
   62::450     4e-33  30%  487 aa  ASTD_PSEPG RecName: Full=N-succinylglutamate 5-semialdehyde
  206::535     5e-33  35%  572 aa  PUT2_EMENI RecName: Full=Delta-1-pyrroline-5-carboxylate
   62::450     5e-33  30%  487 aa  ASTD_PSEP1 RecName: Full=N-succinylglutamate 5-semialdehyde
   34::443     5e-33  27%  484 aa  AL3H1_ARATH RecName: Full=Aldehyde dehydrogenase family 3 member
   60::449     8e-33  30%  492 aa  ASTD_ECOSM RecName: Full=N-succinylglutamate 5-semialdehyde
   60::449     1e-32  30%  492 aa  ASTD_ESCF3 RecName: Full=N-succinylglutamate 5-semialdehyde
   62::434     1e-32  29%  487 aa  ASTD_BURPS RecName: Full=N-succinylglutamate 5-semialdehyde
   62::434     1e-32  29%  487 aa  ASTD_BURP6 RecName: Full=N-succinylglutamate 5-semialdehyde
   62::434     1e-32  29%  487 aa  ASTD_BURP1 RecName: Full=N-succinylglutamate 5-semialdehyde
   62::434     1e-32  29%  487 aa  ASTD_BURP0 RecName: Full=N-succinylglutamate 5-semialdehyde
   62::434     1e-32  29%  487 aa  ASTD_BURMS RecName: Full=N-succinylglutamate 5-semialdehyde
   62::434     1e-32  29%  487 aa  ASTD_BURMA RecName: Full=N-succinylglutamate 5-semialdehyde
   18::495     1e-32  29%  506 aa  ALDH_RHORT RecName: Full=Aldehyde dehydrogenase;       
   70::458     2e-32  28%  496 aa  ASTD_LEGPH RecName: Full=N-succinylglutamate 5-semialdehyde
   69::457     2e-32  28%  495 aa  ASTD_LEGPC RecName: Full=N-succinylglutamate 5-semialdehyde
    5::445     2e-32  31%  489 aa  ASTD_ERWT9 RecName: Full=N-succinylglutamate 5-semialdehyde
   63::452     2e-32  29%  489 aa  ASTD_ACIAD RecName: Full=N-succinylglutamate 5-semialdehyde
  100::427     2e-32  31%  453 aa  AL3A1_RAT RecName: Full=Aldehyde dehydrogenase, dimeric
   76::429     2e-32  34%  476 aa  CALB_PSEAE RecName: Full=Probable coniferyl aldehyde dehydrogenase;
   69::457     2e-32  27%  495 aa  ASTD_LEGPL RecName: Full=N-succinylglutamate 5-semialdehyde
  114::436     9e-32  33%  485 aa  CALB_CAUCR RecName: Full=Probable coniferyl aldehyde dehydrogenase;
   25::439     9e-32  26%  509 aa  AL7A1_DICDI RecName: Full=Putative aldehyde dehydrogenase family 7
   61::450     2e-31  29%  488 aa  ASTD_PSESM RecName: Full=N-succinylglutamate 5-semialdehyde
   61::450     2e-31  30%  488 aa  ASTD_PSEFS RecName: Full=N-succinylglutamate 5-semialdehyde
  103::439     2e-31  29%  445 aa  ALDH3_BACSU RecName: Full=Probable aldehyde dehydrogenase aldX;    
   26::427     2e-31  27%  468 aa  AL3B1_MOUSE RecName: Full=Aldehyde dehydrogenase family 3 member
  100::436     2e-31  29%  479 aa  ALDH_CRAPL RecName: Full=Aldehyde dehydrogenase;       
   26::427     2e-31  28%  468 aa  AL3B1_RAT RecName: Full=Aldehyde dehydrogenase family 3 member B1; 
   69::457     3e-31  27%  495 aa  ASTD_LEGPA RecName: Full=N-succinylglutamate 5-semialdehyde
  114::455     3e-31  32%  483 aa  ALDH_PSEOL RecName: Full=Aldehyde dehydrogenase;       
    2::235     3e-31  36%  240 aa  ALDH2_MACPR RecName: Full=Aldehyde dehydrogenase, cytosolic 2;     
  100::427     3e-31  31%  453 aa  AL3A1_HUMAN RecName: Full=Aldehyde dehydrogenase, dimeric
  100::427     6e-31  30%  453 aa  AL3A1_MOUSE RecName: Full=Aldehyde dehydrogenase, dimeric
  192::518     8e-31  35%  558 aa  AL4A1_DICDI RecName: Full=Delta-1-pyrroline-5-carboxylate
   60::449     1e-30  28%  492 aa  ASTD_ECO7I RecName: Full=N-succinylglutamate 5-semialdehyde
   26::424     1e-30  27%  468 aa  AL3B1_HUMAN RecName: Full=Aldehyde dehydrogenase family 3 member
    6::450     2e-30  27%  488 aa  ASTD_PSEPF RecName: Full=N-succinylglutamate 5-semialdehyde
   98::429     2e-30  29%  456 aa  ALDH2_BACSU RecName: Full=Probable aldehyde dehydrogenase ywdH;    
    1::226     6e-30  37%  228 aa  ALDH9_POLMI RecName: Full=Aldehyde dehydrogenase 9;       
   64::520     8e-30  30%  575 aa  PUT2_YEAST RecName: Full=Delta-1-pyrroline-5-carboxylate
   26::424     2e-29  28%  468 aa  AL3B1_BOVIN RecName: Full=Aldehyde dehydrogenase family 3 member
   80::496     3e-29  29%  507 aa  ALDH_STRCO RecName: Full=Probable aldehyde dehydrogenase;       
  186::530     5e-29  33%  546 aa  PUT2_AGABI RecName: Full=Delta-1-pyrroline-5-carboxylate
   29::484     5e-29  24%  488 aa  ALDH_PSESP RecName: Full=Probable aldehyde dehydrogenase;       
  109::449     5e-28  30%  481 aa  CALB_PSEUH RecName: Full=Coniferyl aldehyde dehydrogenase;       
  107::441     1e-27  29%  484 aa  AL3F1_ARATH RecName: Full=Aldehyde dehydrogenase family 3 member
  184::512     1e-27  33%  548 aa  PUT2_SCHPO RecName: Full=Probable delta-1-pyrroline-5-carboxylate
  123::527     2e-27  30%  563 aa  AL4A1_HUMAN RecName: Full=Delta-1-pyrroline-5-carboxylate
   33::421     2e-27  28%  484 aa  AL3A2_RAT RecName: Full=Fatty aldehyde dehydrogenase;       
   34::421     3e-27  27%  484 aa  AL3A2_MOUSE RecName: Full=Fatty aldehyde dehydrogenase;       
  116::520     1e-26  29%  556 aa  AL4A1_DANRE RecName: Full=Delta-1-pyrroline-5-carboxylate
  162::491     2e-26  29%  529 aa  ALDH1_ENTHI RecName: Full=Aldehyde dehydrogenase 1;       
  100::427     3e-26  29%  453 aa  AL3A1_CANFA RecName: Full=Aldehyde dehydrogenase, dimeric
   95::421     6e-26  27%  485 aa  AL3A2_HUMAN RecName: Full=Fatty aldehyde dehydrogenase;       
  123::527     7e-26  27%  563 aa  AL4A1_BOVIN RecName: Full=Delta-1-pyrroline-5-carboxylate
   95::421     7e-26  27%  485 aa  AL3A2_PONAB RecName: Full=Fatty aldehyde dehydrogenase;       
  633::1018    1e-25  26% 1224 aa  PUTA_RHIME RecName: Full=Bifunctional protein putA;Includes:
   34::421     4e-25  26%  485 aa  AL3A2_MACFA RecName: Full=Fatty aldehyde dehydrogenase;       
   97::506     5e-25  25%  550 aa  AL3I1_ARATH RecName: Full=Aldehyde dehydrogenase family 3 member
   18::496     6e-25  26%  507 aa  ALDH_MYCTU RecName: Full=Probable aldehyde dehydrogenase;       
   18::496     6e-25  26%  507 aa  ALDH_MYCBO RecName: Full=Probable aldehyde dehydrogenase;       
   21::343     2e-24  27%  385 aa  AL3B2_HUMAN RecName: Full=Aldehyde dehydrogenase family 3 member
  107::437     3e-24  27%  470 aa  ALDH3_DICDI RecName: Full=Aldehyde dehydrogenase family 3 comG;    
  122::526     9e-24  28%  563 aa  AL4A1_RAT RecName: Full=Delta-1-pyrroline-5-carboxylate
  122::526     2e-23  27%  562 aa  AL4A1_MOUSE RecName: Full=Delta-1-pyrroline-5-carboxylate
   44::476     1e-19  29%  800 aa  A16A1_BOVIN RecName: Full=Aldehyde dehydrogenase family 16 member
   62::435     6e-18  27%  515 aa  BOXD_AZOEV RecName: Full=3,4-dehydroadipyl-CoA semialdehyde
  116::389     5e-17  31%  467 aa  EUTE_SALTY RecName: Full=Ethanolamine utilization protein eutE;
  254::503     5e-16  29%  533 aa  ALDHX_YEAST RecName: Full=Aldehyde dehydrogenase 1, mitochondrial; 
  164::476     2e-15  27%  802 aa  A16A1_RAT RecName: Full=Aldehyde dehydrogenase family 16 member A1;
   44::476     4e-15  25%  802 aa  A16A1_HUMAN RecName: Full=Aldehyde dehydrogenase family 16 member
  101::476     6e-15  25%  802 aa  A16A1_MOUSE RecName: Full=Aldehyde dehydrogenase family 16 member
   62::431     1e-14  24%  681 aa  MAOC_ECOLI RecName: Full=Protein maoC;AltName: Full=Phenylacetic
  116::389     2e-14  30%  467 aa  EUTE_ECOLI RecName: Full=Ethanolamine utilization protein eutE;
    7::213     4e-14  29%  239 aa  AL3A1_BOVIN RecName: Full=Aldehyde dehydrogenase, dimeric
  156::420     1e-13  27%  532 aa  HFD1_YEAST RecName: Full=Putative fatty aldehyde dehydrogenase
   54::372     2e-12  25%  556 aa  AL121_ARATH RecName: Full=Delta-1-pyrroline-5-carboxylate
   51::538     3e-12  24%  551 aa  ALDH_LINUS RecName: Full=Probable aldehyde dehydrogenase;       
   11::194     5e-11  25%  228 aa  AL7A1_RAT RecName: Full=Alpha-aminoadipic semialdehyde
  102::401     2e-09  24%  862 aa  ADHE_CLOAB RecName: Full=Aldehyde-alcohol dehydrogenase;Includes:
  117::422     3e-09  27%  430 aa  PROA_POLNA RecName: Full=Gamma-glutamyl phosphate reductase;       
   23::406     5e-09  27%  413 aa  PROA_LACLS RecName: Full=Gamma-glutamyl phosphate reductase;       
   23::406     5e-09  27%  413 aa  PROA_LACLM RecName: Full=Gamma-glutamyl phosphate reductase;       
  117::436     6e-09  28%  444 aa  PROA_RHOFD RecName: Full=Gamma-glutamyl phosphate reductase;       
   53::427     6e-09  24%  510 aa  ALDH_VIBHA RecName: Full=NADP-dependent fatty aldehyde
   37::409     1e-08  29%  417 aa  PROA_THICR RecName: Full=Gamma-glutamyl phosphate reductase;       
  120::426     4e-08  26%  433 aa  PROA_PSYCK RecName: Full=Gamma-glutamyl phosphate reductase;       
  116::414     7e-08  26%  421 aa  PROA_ACIAD RecName: Full=Gamma-glutamyl phosphate reductase;       
   26::397     9e-08  25%  442 aa  PROA_CAMC5 RecName: Full=Gamma-glutamyl phosphate reductase;       
  127::428     1e-07  29%  436 aa  PROA_POLSJ RecName: Full=Gamma-glutamyl phosphate reductase;       
  110::408     1e-07  25%  415 aa  PROA_CLOPH RecName: Full=Gamma-glutamyl phosphate reductase;       
   58::419     2e-07  27%  426 aa  PROA_RALEH RecName: Full=Gamma-glutamyl phosphate reductase;       
   29::418     3e-07  24%  425 aa  PROA_AZOSE RecName: Full=Gamma-glutamyl phosphate reductase;       
  114::385     4e-07  27%  417 aa  PROA_HELMI RecName: Full=Gamma-glutamyl phosphate reductase;       
  111::408     8e-07  22%  415 aa  PROA_DICT6 RecName: Full=Gamma-glutamyl phosphate reductase;       
  110::369     1e-06  23%  414 aa  PROA_CLOBA RecName: Full=Gamma-glutamyl phosphate reductase;       
   29::405     1e-06  25%  416 aa  PROA_STRPF RecName: Full=Gamma-glutamyl phosphate reductase;       
  117::419     2e-06  27%  426 aa  PROA_RALEJ RecName: Full=Gamma-glutamyl phosphate reductase;       
  111::369     2e-06  21%  415 aa  PROA_DICTD RecName: Full=Gamma-glutamyl phosphate reductase;       
  117::300     4e-06  24%  451 aa  PROA_SCHPO RecName: Full=Probable gamma-glutamyl phosphate
  117::418     5e-06  27%  426 aa  PROA_ACISJ RecName: Full=Gamma-glutamyl phosphate reductase;       
  111::368     6e-06  24%  414 aa  PROA_KOSOT RecName: Full=Gamma-glutamyl phosphate reductase;       
  117::418     6e-06  27%  426 aa  PROA_DIAST RecName: Full=Gamma-glutamyl phosphate reductase;       
  114::282     8e-06  27%  423 aa  PROA_DESDA RecName: Full=Gamma-glutamyl phosphate reductase;       
  114::411     1e-05  26%  418 aa  PROA_TERTT RecName: Full=Gamma-glutamyl phosphate reductase;       
  120::422     1e-05  27%  429 aa  PROA_METPP RecName: Full=Gamma-glutamyl phosphate reductase;       
   53::370     2e-05  24%  415 aa  PROA_CLOPE RecName: Full=Gamma-glutamyl phosphate reductase;       
  114::287     2e-05  25%  417 aa  PROA_CLONN RecName: Full=Gamma-glutamyl phosphate reductase;       
  116::273     3e-05  29%  421 aa  PROA_PSESM RecName: Full=Gamma-glutamyl phosphate reductase;       
  110::292     3e-05  26%  414 aa  PROA_FRAP2 RecName: Full=Gamma-glutamyl phosphate reductase;       
  110::405     4e-05  25%  416 aa  PROA_STRP1 RecName: Full=Gamma-glutamyl phosphate reductase;       
   30::369     4e-05  25%  415 aa  PROA_CARHZ RecName: Full=Gamma-glutamyl phosphate reductase;       
   23::279     5e-05  23%  417 aa  PROA_ENT38 RecName: Full=Gamma-glutamyl phosphate reductase;       
  108::412     5e-05  26%  419 aa  PROA_AZOSB RecName: Full=Gamma-glutamyl phosphate reductase;       
  110::405     9e-05  24%  416 aa  PROA_STRPM RecName: Full=Gamma-glutamyl phosphate reductase;       
  110::405     9e-05  24%  416 aa  PROA_STRPG RecName: Full=Gamma-glutamyl phosphate reductase;       
  110::405     9e-05  24%  416 aa  PROA_STRPC RecName: Full=Gamma-glutamyl phosphate reductase;       
  110::405     9e-05  24%  416 aa  PROA_STRPB RecName: Full=Gamma-glutamyl phosphate reductase;       
  110::405     9e-05  24%  416 aa  PROA_STRP8 RecName: Full=Gamma-glutamyl phosphate reductase;       
  110::405     9e-05  24%  416 aa  PROA_STRP6 RecName: Full=Gamma-glutamyl phosphate reductase;       
  294::408     1e-04  31%  415 aa  PROA_LISW6 RecName: Full=Gamma-glutamyl phosphate reductase;       
   23::280     1e-04  25%  413 aa  PROA_LACLA RecName: Full=Gamma-glutamyl phosphate reductase;       
  106::287     1e-04  28%  418 aa  PROA_CLOK5 RecName: Full=Gamma-glutamyl phosphate reductase;       
  106::287     1e-04  28%  418 aa  PROA_CLOK1 RecName: Full=Gamma-glutamyl phosphate reductase;       
   36::370     3e-04  25%  416 aa  PROA_VIBCH RecName: Full=Gamma-glutamyl phosphate reductase;       
   36::370     3e-04  25%  416 aa  PROA_VIBC3 RecName: Full=Gamma-glutamyl phosphate reductase;       
   30::282     4e-04  23%  416 aa  PROA_STRTD RecName: Full=Gamma-glutamyl phosphate reductase;       
  113::383     4e-04  21%  428 aa  PROA_CLOTE RecName: Full=Gamma-glutamyl phosphate reductase;       
   30::282     5e-04  23%  416 aa  PROA_STRTR RecName: Full=Gamma-glutamyl phosphate reductase;       
  294::408     6e-04  30%  415 aa  PROA_LISMO RecName: Full=Gamma-glutamyl phosphate reductase;       
  294::408     6e-04  30%  415 aa  PROA_LISIN RecName: Full=Gamma-glutamyl phosphate reductase;       
  300::411     6e-04  26%  418 aa  PROA_EUBR3 RecName: Full=Gamma-glutamyl phosphate reductase;       
  320::418     6e-04  31%  426 aa  PROA_DELAS RecName: Full=Gamma-glutamyl phosphate reductase;       
   49::282     8e-04  24%  416 aa  PROA_STREM RecName: Full=Gamma-glutamyl phosphate reductase;       
  109::372     8e-04  25%  418 aa  PROA_PHOPR RecName: Full=Gamma-glutamyl phosphate reductase;       
    1::474

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTRYQNLVNGKWKSSEQEITIYSPINQEELGTVPAMTQTEXXXXXXXXXXXXXXXXXXXXIERAAYLHKT
GAPN_STRMU      --QYKNYVNGEWKLSENEIKIYEPASGAELGSVPAMSTEEVDYVYASAKKAQPAWRSLSYIERAAYLHKV
GAPN_STREI      --QYKNYVNGEWKLSKEEIKIYAPATGEELGSVPAMSQEEVDYVYXXXXXXXXXXXXLSYVERAEYLHKA
GAPN_NICPL      ---------GEWKKSAKSVAIINPTTRKTQYKVQACTQEEVNKVMEVAKTAQKSWAKTPLWKRAELLHKA
GAPN_WHEAT      ---YKYYADGEWRASAKTVAIVNPTTRQTQYRVQACTQEEVNKVMDAAKVAQKSWARTPLWKRAELLHKA
GAPN_APIGR      --------DGEWKSSGKSVAIINPTTRMTQFKVQACTQEEVNKAMETAKKVQKQWAKTPLWKRAELLHKA
GAPN_MAIZE      ---YRYYADGEWRTSAKSVAIVNPTTRKTQYRVQACTQEEVNKAMDAAKVAQKAWARTPLWKRADVLHKA
GAPN_PEA        ---YKYYADGEWKKSTKSVAIINPTTRKPQYKVQACSQEEVNKVMDSAKSAQKSWAKTPLWKRAELLHKA
GAPN_ARATH      ---YKYYADGEWKSSGKSVAIMNPATRKTQYKVQACTQEEVNAVMELAKSAQKSWAKTPLWKRAELLHKA
LADH_META3      -------INGEW-INRKDIEVKNPYNNEIIGYIPSLSRNETKEAIKIAEEHKSTMKNLSPTIRYNILMKI
GAPN_SCEVA      ----------------------------------------------------------------------
LADH_METJA      -------IDGKWINRE-DMDVINPYSLEVIKKIPALSREEAKEAIDTAEKYKEVMKNLPITKRYNILMNX
LADH_METVS      -------IDGKWILRE-DLDILNPYTLEIIERITALDREETKYAIEVATENKDVMKELNPSKRYSLLMKI
LADH_METM7      -------IDGKWIIRD-DIDVFDPYTLKNIEKITALDREETKNAIEITEKNKEVMKNLSPSKRYSILMKI
LADH_METM5      -------IDGKWILRE-DIDVFDPYTLENIEKITALDREETKSAIEVAEKNKEIMKNLSPSKRYSILMKI
LADH_METMP      -------IDGKWIIRE-DIDVFDPYTLENIEKITALDREETKNAIEVTEKHKEIMKNLSPSKRYKILMKV
GABD_ECOLI      --RQQALINGEWLDANEAIDVTNPANGDKLGSVPKMGADETRAAIDAANRALPAWRALTAKERATILRNW
ALDH1_BACSU     ---YLNFINGEWVKSQSGVKVENPADVNDIGYVQNSTAEDVERAVTAANEAKTAWRKLTGAERGQYLYKT
ALDH5_BACSU     MFQYEELIGGKWQSSPNVLENKNPYTQKTFTTFRKATADDVDEAYRAAALAKKKWDAVNPFEKRTILEKA
SSDH_ARATH      LLRTQGLIGGKWLDSNKTIKVNNPATGEIIADVACMGTKETNDAIASSYEAFTSWSRLTAGERSKVLRRW
ALDH_BACST      ------------------------------------------------------------VERGEYLYKA
YLX7_SCHPO      -------INGEWHKSAETWETVDPSIEEVIAKVYLAGEKEIDYAVKSAKEAFKTWKKVPGSEKGELLMKL
ALDY_BACSU      -TLNKSFINGKWTGGESGRTILNPYDQSVITTASLATGKQLEDAFDIAQKAQKEWAKSTTEDRKAVLQKA
AL1A3_HUMAN     ------------------------------------------------------------LSRGRLLHQL
AL1A3_RAT       ------------------------------------------------------------LSRGQLLHQL
Y4UC_RHISN      ------------------IAVHSPYDGSLLGSVEATDPADIDRLLATARRGAEISRNLPRHKRASILEGA
AL1A2_CHICK     -------INNEWQNSERVFPVYNPATGEQICEIQEADKVDTDKAVRAARLAFSLGSVWRRMERGQLLDKL
GABD_BACSU      -----------------QLTVYNPATGEEIKTIPQQSATEVEEAIERSHQAFKTWSKTSANERTSLLKKW
BETB_PSEMY      -------------SSGQTFDSINPATGEVLAKVQRASQADVDRAVASAAEGQKVWAAMTAMQRSRILRRA
ALDH_ASPNG      --------------------------------------------------------------RGRMLTKL
AL1A2_HUMAN     -------INNEWQNSERVFPVYNPATGEQVCEVQEADKADIDKAVQAARLAFSLGSVWRRMERGRLLDKL
ALDH5_YEAS7     -------INGEFVASKQKKTVINPSNEEKITTVYXXXXXXXXXXXXXXXXXFETKWSIVEPERAKALFNL
A9A1B_DANRE     ------------------------------------------------------------MERARVMLEA
ALDH5_YEAST     -------INGEFVASKQKKTVINPSNEEKITTVYXXXXXXXXXXXXXXXXXFETKWSIVEPERAKALFNL
PUUC_ECOLI      ----------------------------------------------------------------------
BETB_PSEFS      --------------SDATFEAINPANGEVLAQVQRATKEDVERAVVSAEKGQKIWAAMTAMERSRILRRA
AL9A1_MOUSE     ------------------------------------------------------------LERCQVLLEA
AL1A2_RAT       -------------------------------------------------------------ERGRLLDKL
AL1A2_MOUSE     -------------------------------------------------------------ERGRLLDKL
BETB_BURPP      ------------------------------------------------------------MQRSRILRRA
ALDH_EMENI      -------------------------------------------------------------ERGILINKL
FEAB_ECOLI      -------------------------------------------------------------ERERILLRF
ALDH_AGABI      -------------------------------------------------------------KRGDMLYKL
ALDH4_YEAST     ------------------------------------------------------------IDRGKALYRL
AL1A1_MACFA     -------------------------------------------------------------ERGRLLYKL
BETB_BURXL      ------------------------------------------------------------MQRSRVLRRA
AL1A3_MOUSE     ------------------------------------------------------------LSRGQLLHQL
AL1A2_TAEGU     -------INNEWQNSESGFPVYNPATGEQICDIQEADKVDTDKAVRAARLAFSLGSVWRRMERGHLLDKL
AL9A1_RAT       ------------------------------------------------------------LERCQVLLEA
AL1A1_SHEEP     -------------------------------------------------------------ERGRLLNKL
BETB_ACIAD      ----------------------NPATGEVIATIQQASQTDIEAAVKSAAEGQKVWAAKTAVERSRILRRA
AL1A1_RABIT     -------------------------------------------------------------ERGRLLYKL
AL1A1_HUMAN     -------INNEWHDSVKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQAFQIGSPWRTMERGRLLYKL
AL1A1_BOVIN     -------------------------------------------------------------ERGRLLNKL
FTHFD_XENTR     -------------------------------------------------------------DRGRILYRL
BETB_VIBPA      --------------SEEHFTTYNPANGEPLANIKQANQSDMEAAIESAKRGFEVWSAMTAIERSRILNKA
AL1A7_MOUSE     -------------------------------------------------------------ERGRLLNKL
BETB_BURCM      ------------------------------------------------------------MQRSRILRRA
ALDH_CLAHE      --------------------------------------------------------------RGKLLNNL
BETB_BURA4      ------------------------------------------------------------MQRSRILRRA
BETB2_RHIME     -------------------------------------------------------------ERGRVLSRA
BETB_PSEAE      -------------SSGATFETINPANGEVLAKVQRASREDVERAVQSAVEGQKVWAAMTAMQRSRILRRA
BETB_PSEA8      -------------SSGATFETINPANGEVLAKVQRASREDVERAVQSAVEGQKVWAAMTAMQRSRILRRA
BETB_PSEA7      -------------SSGATFETINPANGEVLAKVQRASREDVERAVQSAVEGQKVWAAMTAMQRSRILRRA
ALD1_STAHJ      ----QQYINGEWSDSNETIEVINPATEEVIGKVAKGNSNDVEKAVEAANNVYLEFRHSSVKERKELLDK-
BETB_PSEAB      -------------SSGATFETINPANGEVLAKVQRASREDVERAVQSAVEGQKVWAAMTAMQRSRILRRA
SSDH_RAT        LLRGDSFVGGRWLPTPATFPVYDPASGAKLGTVADCGVPEXXXXXXXXXXXFSSWKEISVKERSSLLRKW
ROCA_BACWK      ---YPLIIGGEKITTEDKIVSVNPANKEELGRVSKASRELAEKAMQVADATFQTWRKSKPEMRADILFRA
AL1A1_MOUSE     -------------------------------------------------------------ERGRLLNKL
ROCA_GEOSW      ---YPLIIGGERVTTDEKIVSINPANKTEIGRVSKANKELAEKAMKVADEAFKWWSKTKPEARADILFRA
AL1B1_RAT       -------------------------------------------------------------ERGRLLNRL
AL1A1_RAT       -------------------------------------------------------------ERGRLLNKL
YF19_SCHPO      -------------------------------------------------------------QRGRCLSRL
ROCA_BACCN      ---YPLIIGGEKITTEDKIVSVNPANKEEIGSVSKASRELAEKAMQVADETFQTWRKSKPEMRADILFRA
BETB_ACIBT      ---HQLYIHGRYVEATSGKTFNSPANGEIIATLQQASEQDIEAAVKSAQQGQKIWAAMTAMERSRILRRA
BETB_PECCP      ------------------------------------------------------------MERSRILRRA
NAHF_PSEU8      -------INNAWSSDQQTFERIHPVSSDVVTESANATVTDXXXXXXXXXXXFKTWKAVGPSERRRLLLKV
NAHF_PSEPU      -------INNAWSSDQQTFERIHPVSSDVVTESANATVTDXXXXXXXXXXXFKTWKAVGPSERRRLLLKV
BETB_BRUSU      ------------------------------------------------------------VERGRILRRT
BETB_BRUSI      ------------------------------------------------------------VERGRILRRT
BETB_BRUO2      ------------------------------------------------------------VERGRILRRT
BETB_BRUME      ------------------------------------------------------------VERGRILRRT
BETB_BRUC2      ------------------------------------------------------------VERGRILRRT
BETB_BRUAB      ------------------------------------------------------------VERGRILRRT
BETB_BRUA2      ------------------------------------------------------------VERGRILRRT
BETB_BRUA1      ------------------------------------------------------------VERGRILRRT
BETB_ACIBY      ---HQLYIHGRYVEATSGKTFNSPANGEIIATLQQASEQDIEAAVKSAQQGQKIWAAMTAMERSRILRRA
BETB_ACIB5      ---HQLYIHGRYVEATSGKTFNSPANGEIIATLQQASEQDIEAAVKSAQQGQKIWAAMTAMERSRILRRA
BETB_ACIB3      ---HQLYIHGRYVEATSGKTFNSPANGEIIATLQQASEQDIEAAVKSAQQGQKIWAAMTAMERSRILRRA
ALD1_STAAW      -------INGEWSNSNETIEVINPATEEVIGKVAKGXXXXXXXXXXXXXXXYLEFRHTSVKERQALLDKI
ALD1_STAAS      -------INGEWSNSNETIEVINPATEEVIGKVAKGXXXXXXXXXXXXXXXYLEFRHTSVKERQALLDKI
ALD1_STAAN      -------INGEWSNSNETIEVINPATEEVIGKVAKGNXXXXXXXXXXXXXXYLEFRHTSVKERQALLDKI
ALD1_STAAM      -------INGEWSNSNETIEVINPATEEVIGKVAKGNXXXXXXXXXXXXXXYLEFRHTSVKERQALLDKI
ALD1_STAAC      -------INGEWSNSNETIEVINPATEEVIGKVAKGNXXXXXXXXXXXXXXYLEFRHTSVKERQALLDKI
ALD1_STAA8      -------INGEWSNSNETIEVINPATEEVIGKVAKGNXXXXXXXXXXXXXXYLEFRHTSVKERQALLDKI
ALD1_STAA3      -------INGEWSNSNETIEVINPATEEVIGKVAKGNXXXXXXXXXXXXXXYLEFRHTSVKERQALLDKI
AL1B1_HUMAN     -------------------------------------------------------------ERGRLLNLL
BETB_ACIBC      ---HQLYIHGRYVEATSGKTFNSPANGEIIATLQQASEQDIEAAVKSAQQGQKIWAAMTAMERSRILRRA
BADH_SPIOL      ----QLFIDGEWREKKNRIPVINPSTEEIIGDIPXXXXXXXXXXXXXXXXXXXXNNWSATAHRATYLRAI
ALD1_STAAR      -------INGEWSNSNETIEVINPATEEVIGKVAKGXXXXXXXXXXXXXXXYLEFRHTSVKERQALLDKI
AL1A1_CHICK     -------------------------------------------------------------ERGRLLNKL
BETB_ACIBS      ---HQLYIHGRYVEATSGKTFNSPANGEIIATLQQASEQDIEAAVKSAQQGQKIWAAMTAMERSRILRRA
ROCA_GEOTN      ---YPLIIGGERVMTEDKITSVNPANKAEIGRVAKANKELAERAMKTADEAFRTWSRTSPEARADILFRA
ROCA_BACCR      ---YPLIIGGEKITTEDKIVSVNPANKEELGRVSKASRELAEKAMQVADETFQTWRKSKPEMRADILFRA
ROCA_BACC4      ---YPLIIGGEKITTEDKIVSVNPANKEELGRVSKASRELAEKAMQVADETFQTWRKSKPEMRADILFRA
ROCA_BACC2      ---YPLIIGGEKITTEDKIVSVNPANKEELGRVSKASRELAEKAMQVADETFQTWRKSKPEMRADILFRA
BETB_RHOS5      ------------------IPVIHPANGEEIARLHEATPAVIEAALASGARAQKDWAALRPVERARILRRA
AL1L2_HUMAN     -------------------------------------------------------------ERGRLMYRL
BETB_YERPY      ------------------------------------------------------------MERSRILRRA
BADH_GADCA      ------------------------------------------------------------IERSRVMLEA
ALDH6_YEAST     -------------------------------------------------------------ERGRLLSKL
ALDH1_MACPR     -------------------------------------------------------------ERGQLIYKL
AL1B1_PONAB     -------------------------------------------------------------ERGRLLNCL
AL1A1_HORSE     -------------------------------------------------------------ERGRLLYKL
BETB_RHOSK      ------------------------------------------------------------VERARILRRA
BETB_RHOS1      ------------------------------------------------------------VERARILRRA
BETB_BRUMB      ------------------------------------------------------------VERGRILRRT
ALDA_STAAW      ---YGLFINGEFVSSDETIEVTNPATGETLSHITRAKDKDVDHAVKVAQEAFESWSLTSKSERAQMLRDI
ALDA_STAAS      ---YGLFINGEFVSSDETIEVTNPATGETLSHITRAKDKDVDHAVKVAQDAFESWSLTSKSERAQMLRDI
ALDA_STAAN      ---YGLFINGEFVSSDETIEVTNPATGETLSHITRAKDKDVDHAVKVAQEAFESWSLTSKSERAQMLRDI
ALDA_STAAM      ---YGLFINGEFVSSDETIEVTNPATGETLSHITRAKDKDVDHAVKVAQEAFESWSLTSKSERAQMLRDI
ROCA_BACHK      ---YPLIIGGEKITTEDKIVSVNPANKEELGRVSKASRELAEKAMQVADETFQTWRKSKPEMRADILFRA
ROCA_BACCZ      ---YPLIIGGEKITTEDKIVSVNPANKEELGRVSKASRELAEKAMQVADETFQTWRKSKPEMRADILFRA
ROCA_BACCQ      ---YPLIIGGEKITTEDKIVSVNPANKEELGRVSKASRELAEKAMQVADETFQTWRKSKPEMRADILFRA
ROCA_BACC7      ---YPLIIGGEKITTEDKIVSVNPANKEELGRVSKASRELAEKAMQVADETFQTWRKSKPEMRADILFRA
ROCA_BACC3      ---YPLIIGGEKITTEDKIVSVNPANKEELGRVSKASRELAEKAMQVADETFQTWRKSKPEMRADILFRA
ROCA_BACC0      ---YPLIIGGEKITTEDKIVSVNPANKEELGRVSKASRELAEKAMQVADETFQTWRKSKPEMRADILFRA
ROCA_BACAN      ---YPLIIGGEKITTEDKIVSVNPANKEELGRVSKASRELAEKAMQVADETFQTWRKSKPEMRADILFRA
ROCA_BACAH      ---YPLIIGGEKITTEDKIVSVNPANKEELGRVSKASRELAEKAMQVADETFQTWRKSKPEMRADILFRA
ROCA_BACAC      ---YPLIIGGEKITTEDKIVSVNPANKEELGRVSKASRELAEKAMQVADETFQTWRKSKPEMRADILFRA
ROCA_BACAA      ---YPLIIGGEKITTEDKIVSVNPANKEELGRVSKASRELAEKAMQVADETFQTWRKSKPEMRADILFRA
GABD_DEIRA      ---------------ERPFATVNPYTGETVKTFPFLESAEIPALIERADQAYREWGQRPVTERAAIMRRA
ALDH_ENCBU      -------------------------------------------------------------DRGRLLFKL
ALDH2_YEAST     -------------------------------------------------------------QRGIYLSNL
ALDH1_ELEED     -------------------------------------------------------------ERGQLIYKL
ALDA_STAAR      ---YGLFINGEFVSSDETIEVTNPATGETLSHITRAKDKDVDHAVKVAQEAFESWSLTSKSERAQMLRDI
ROCA_BACC1      ---YPLIIGGEKITTEDKIVSVNPANKEELGRVSKASRELAEKAMQVADETFQTWRKSKPEMRADILFRA
ALD1_STAAB      -------INGEWSNSNETIEVINPATEEVIGKVAKGXXXXXXXXXXXXXXXYLEFRHTSVKERQALLDKI
BETB_RHOS4      ------------------------------------------------------------VERARILRRA
ALD1_STAES      -------INGEWSASGETIDVINPATEEVMGKIAKGNEEDVNKAVDAADKVYLEFRHSSVEERRELLDKI
ALD1_STAEQ      -------INGEWSASGETIDVINPATEEVMGKIAKGNEEDVNKAVDAADKVYLEFRHSSVEERRELLDKI
AL9A1_HUMAN     ----------------------------------------------------------------------
ROCA_ANOFW      ---YPLVIGGERVMTEDKIVSINPANKTEVGRVAKANKDLAEKAMQTADAAFKWWSKTKPEMRADILFRA
FTHFD_MOUSE     -------------------------------------------------------------DRGRLLYRL
BETB_SINMW      ----------------------------------------------------------------------
ALDH2_RAT       -------------------------------------------------------------DRGRLLYRL
ALDH2_MESAU     -------------------------------------------------------------DRGRLLNRL
ALDA_STAAC      ---YGLFINGEFVSSDETIEVTNPATGETLSHITRAKDKDVDHAVKVAQEAFESWSLTSKSERAQMLRDI
ALDA_STAAB      ---YGLFINGEFVSSDETIEVTNPATGETLSHITRAKDKDVDHAVEVAQEAFESWSLTSKSERAQMLRDI
ALDA_STAA8      ---YGLFINGEFVSSDETIEVTNPATGETLSHITRAKDKDVDHAVKVAQEAFESWSLTSKSERAQMLRDI
ALDA_STAA3      ---YGLFINGEFVSSDETIEVTNPATGETLSHITRAKDKDVDHAVKVAQEAFESWSLTSKSERAQMLRDI
AL9A1_PONAB     ----------------------------------------------------------------------
UGA2_YEAST      --RESGYIDGKWKGTDEVFEVVDPASGEIIARVPEQPVSVVEEAIDVAYETFKTYKNTTPRERAKWLRNM
ROCA_BACLD      ---YPLVIDGERYETENKIVSINPANKEEVGTVSKATQDHXXXXXXXXXXXFETWRYTDPEERAAVLFRA
ALDH2_MOUSE     -------------------------------------------------------------DRGRLLYRL
AL1B1_MOUSE     -------------------------------------------------------------ERGRLLNRL
BETB_BURP8      -------IGGDYVDATSGVTFFDPATGELLATVQQASEADIERAVQSAREGQRAWAAMTAMQRSRILRRA
ALDA_STAHJ      --QYGLFINGEFQASESTLTVTNPANGEDLAKVAKASKSXXXXXXXXXXXXXXSWSKTSKEERADYLLEI
ALDH3_YEAST     -------------------------------------------------------------QRGIYLSNL
ALDH2_PONAB     --------------------------------------------------------------RGRLLNRL
A9A1A_DANRE     ----------------------------------------------------------------------
ALDH2_HUMAN     --------------------------------------------------------------RGRLLNRL
BETB_VIBHB      --------------SEEHFTTYNPANGEPLANVKQANQQDMQAAIESAKRGFAIWSAMTATERSRILLKA
ALDA_STAES      ---YGLFINNEFQASDETLTVSNPANGEDLAKVARAGKKDVDKAVQAAHDAFDSWSKISKEERADYLLEI
ALDA_STAEQ      ---YGLFINNEFQASDETLTVSNPANGEDLAKVARAGKKDVDKAVQAAHDAFDSWSKISKEERADYLLEI
IOLA_BACSU      --KLKNYINGEWVESDQYEDVVNPATKEVLCQVPISTKEDIDYAAQTAAEAFKTWSKVAVPRRARILFNF
IOLA_BACNA      --KLKNYINGEWVESDQYEDVVNPATKEVLCQVPISTKEDIDYAAQTAAEAFETWSKVAVPRRARILFNF
FTHFD_XENLA     -------------------------------------------------------------DRGRLLYRL
AL9A1_ORYLA     ----------------------------------------------------------------------
BETB_OCHA4      ------------------------------------------------------------VERGRILRRT
BADH1_ARATH     MPTRQLFIDGEWREPKKRIPIVNPATEEVIGDIPAATTEXXXXXXXXXXXXLSRNKGKDWAKRAKYLRAI
ROCA_GEOKA      ---YPLVIGGERVMTEDKIISINPANKTEVVGRVAKANKELAERAMKTADEAFRTWSRTSPERADILFRA
AL9A1_BOVIN     ----------------------------------------------------------------------
FTHFD_PONAB     -------------------------------------------------------------DRGRLLYRL
BETB_PSEPK      --------------SDATFEAINPATGEVLAHVQRATEADVEKAVESAERGQKVWAAMTAMQRSRILRRA
BETB_PSEP1      --------------SDATFEAINPATGEVLAHVQRATEADVEKAVESAERGQKVWAAMTAMQRSRILRRA
ALDH_ALTAL      --------------------------------------------------------------RGKLLNKL
AL2C4_ARATH     -------------------------------------------------------------ERAKLINKF
IOLA_BACA2      --KLKNYINGEWVESDQYEDVINPATKEVMCQVPISTREDVEYAVRSASEAFQTWSKTAVPRRARILFNY
BETB_RHISN      ----------------------------------------------------------------------
BETB_RHILW      ----------------------------------------------------------------------
BETB_PSEPW      --------------SDATFEAINPATGEVLAHVQRATQADVEKAVESAERGQKIWAAMTAMQRSRILRRA
BADH_ATRHO      ----QLFIDGEWREPKNRIPIINPSTEEIIGDIPXXXXXXXXXXXXXXRKAFKRNKGRDWAHRAKYLRAI
AL1L2_MOUSE     -------------------------------------------------------------DRGRLMYRL
BETB_RHIL3      ----------------------------------------------------------------------
BETB_PSEPG      --------------SDATFEAINPATGEVLAHVQRATEADVEKAVESAERGQKVWAAMTAMQRSRILRRA
BETB_PSEPF      -------IDGAYSDAGSDATFINPANGEVLAHVQRATKEDVERAVVSAEKGQKIWAAMTAMERSRILRRA
ALDA_ECOLI      ------------------------------------------------------------IERASWLRKI
BETB_BURM1      ------------------------------------------------------------MQRSRILRRA
ROCA2_BACSU     ---YPLVINGERVETEAKIVSINPADKEEVGRVSKXXXXXXXXXXXXXXXXXXXWRYTSPEERAAVLFRA
IOLA2_BACLD     --KLRNYINGEWVESKTDKDVVNPATKEVLCQVPISTREDIEYAAQTAAEAFKTWSKVAVPRRARILFNF
BETB_RHILO      ----------------------------------------------------------------------
BETB_PSEF5      --------------SDATFDAINPANGEVLAQVQRATKEDVERAVVSAEKGQKIWAAMTAMERSRILRRA
AL2B7_ARATH     -------------------------------------------------------------ERSKILFRF
XYLC_PSEPU      ----------------------------------------------------------------------
BETB_BURCH      ------------------------------------------------------------MQRSRILRRA
BETB_BURCA      ------------------------------------------------------------MQRSRILRRA
BETB1_RHIME     ----------------------------------------------------------------------
BADH_AMAHP      --------------------------------------------------------------RAKYLRAI
ALDH2_BOVIN     -------------------------------------------------------------ERGRLLNRL
IOLA1_OCEIH     ----QNYINGKWKSGKQEV-IPNPATGETIATVTISXXXXXXXXXXXXXXXFPEWSDIPVPNRTRYLLDY
IOLA1_BACSK     --KVKNYINGKWIESSTSLDVVNPATKEVICQVPLSTKADVEYAVEAAKTAFAKWSKVAVPRRARILFNY
BETB_BURCC      ------------------------------------------------------------MQRSRILRRA
ABDH_ERWCT      ------LIEGKLIAGNGELAVFNPATGEQIAAIPQADLHQIDAAVLAAESAFAHWGQTTPKTRATLLLKI
BETB_SERP5      -------INGAYVDSTDGKTFVNPANGEVLAEIQSASAEDVNRAVASAASGQKVWAAMTAMARSRILRRA
FTHFD_HUMAN     -------------------------------------------------------------DRGRLMYRL
BETB_RHIEC      ----------------------------------------------------------------------
BETB_PSEE4      --------------SDATFEAINPATGEVLAHVQRATQADVEKAVESAERGQKVWAAMTAMQRSRILRRA
IOLA_LISMF      --KLKNYINGEWVESRADKDVINPATGEVLCQVPISTRAELDQAAVIAEQAFEKWSQVAVPRRARVLFSF
BETB_RHIE6      ----------------------------------------------------------------------
BETB_BURS3      ------------------------------------------------------------MQRSRILRRA
BETB_BURCJ      ------------------------------------------------------------MQRSRILRRA
BETB_AGRT5      --------------------------------------------------------------RGRILKRA
SSDH_MOUSE      LLRGDSFVGGRWLPAPATFPVYDPASGAKLGTVADCGVPEXXXXXXXXXXXFNSWKGVSVKERSLLLRKW
BETB_PSE14      ------------------------------------------------------------VERSRILRRA
ROCA_STAS1      ------VINGEEKFTKDTYQSINPANTTEIAEVSKATQKDVDDAFEAANEAYKSWKRWSHKDRAEFLIRV
ALDH2_PIG       -------------------------------------------------------------DRGRLLNRL
ABDH_PECCP      ------LIEGKLVAGKGELAVFNPATGEQIAAIAQADLHQVDAAVLAAESAFAHWGQTTPKTRATLLLQI
IOLA_LISMC      --KLKNYINGEWVESRADKDVINPATGEVLCQVPISTRAELDQAAVIAEQAFEKWSQVAVPRRARVLFSF
BETB_YERP3      ------------------------------------------------------------MERSRILRRA
ALD1_STAS1      -------INGEWSTSGETLEVINPATEEVAGTIAKGNKEDVEKAVEAADNVYLEFRHTSVKERQDLLDQI
AL8A1_HUMAN     ----ENFIDGKFLPCSSYIDSYDPSTGEVYCRVPNSGKDEIEAAVKAAREAFPSWSSRSPQERSRVLNQV
IOLA1_GEOKA     -TVLKNYIGGQWVASSETLEVPNPATGEVLARVPISTKEDVDQAVQAAKKAFATWKDVPVPKRARIMFSF
BETB_PSEU2      ------------------------------------------------------------VERSRILRRA
IOLA_LISIN      --KLKNYINGEWVESKADKDVINPATGEVLCQVPISTRAELDQAAVIAEQAFEKWSQVAVPRRARVLFSF
IOLA3_BACCZ     ----KNYIGGEWVESTKMEAVYNPATGEVIAQVPLSTKVDVEQAVLAANEAFKSWSKTAVPKRARILFKY
BETB_BACSU      -------IDGEWISAEKEQSIINPFNQEEIATVSEGGREDXXXXXXXXXXXFDKGEWSSLLERGKIVLKX
ALDH4_BACSU     --------------------------------------------------------------RSRLMYKL
BETB_BURVG      ------------------------------------------------------------MQRSRILRRA
FTHFD_RAT       -------------------------------------------------------------DRGRLLYRL
BETB_YERPP      ------------------------------------------------------------MERSRILRRA
BETB_YERPN      ------------------------------------------------------------MERSRILRRA
BETB_YERPE      ------------------------------------------------------------MERSRILRRA
BETB_YERPB      ------------------------------------------------------------MERSRILRRA
BETB_YERPA      ------------------------------------------------------------MERSRILRRA
BETB_PSEU5      ------------------------------------------------------------IERARIMRRA
IOLA_LISMO      --KLKNYIDGEWVESKTDKDVINPATGEVLCQVPISTRAELDQAAVIAEQAFEKWSQVAVPRRARVLFGF
IOLA2_BACCZ     ----KNYIGGEWVESTKMEAVYNPATGEVIAQVPLSTKVDVEQAVSAANEAFKSWSKTAVPKRARILFKY
IOLA2_BACAH     ----KNYIGGEWVESTKMEAVYNPATGEVIAQVPLSTKGDVEQAVLAANEAFKSWSKTAVPKRARILFKY
BETB_PSESM      -------------SNTETFDSINPANGEVLAKIQRASKEDVERAVVAAEKGQKIWAAMTAVERSRILRRA
AL1B1_BOVIN     ------------------------------------------------------------LKRGWLLNHL
IOLA_LISMH      --KLKNYIDGEWVESKTDKDVINPATGEVLCQVPISTRAELDQAAVIAEQAFEKWSQVAVPRRARVLFSF
AL2B4_ARATH     -------------------------------------------------------------ERSRVLLRF
ROCA_OCEIH      ---YPLVINGEKIYTDDKLISINPSNKNEVGNVSKATKQHIEEAFTSAKEAFKEWKSWSAEDRARVLYRA
BETB_YERPS      ------------------------------------------------------------MERSRILRRA
IOLA2_BACHK     ----KNYIGGEWVESTKMEAVYNPATGEVIAQVPLSTKVDVEQAVLAANEAFKSWSKTAVPKRARILFKY
AL8A1_MOUSE     ----------------------------------------------------------------------
AL1A7_RAT       -------------------------------------------------------------ERGCLLNKL
IOLA2_BACAN     ----KNYIGGEWVESTKMEAVYNPATGEVIAQVPLSTKVDVEQAVLAANEAFKSWSKTAVPRRARILFKY
GABD1_MYCUA     -------------------------------------------------------------QRAEWAHAT
GABD2_MYCS2     --RLRSLVAIEDLDARQSRPIEEVFTGRELTTIPVGTXXXXXXXXXXXXXXXXXXXHRPVAERAAIMERF
BETB_CHRSD      ------------------------------------------------------------MERSRILLRA
AL8A1_BOVIN     ----------------------------------------------------------------------
BETB_ERWCT      MSRYQLYINGAYVDSTGNDTFVNPANGDIIACIQSATAADVDRAVSAATAGQKVWAAMTAMERSRILRRA
ALDH2_LEITA     --------------------------------------------------------------------RL
BETB_VIBSL      -------------SGETFVSI-NPANGEPIATLGQASSADVENAIESAKRGFAVWSAMTAVERSRILLKA
BETB_ECOLC      MAEQQLYIHGGYTSATSGRTFINPANGNVLATVQAAGREDVDRAVKSAQQGQKIWASMTAMERSRILRRA
BETB_VIBVU      -------------------------------------------------------------ERSRCLLKA
BETB_STRMK      ------------------------------------------------------------MERSRILRRA
BETB_STRM5      ------------------------------------------------------------MERSRILRRA
BETB_ECOLI      MAEQQLYIHGGYTSATSGRTFINPANGNVLATVQAAGREDVDRAVKSAQQGQKIWASMTAMERSRILRRA
BETB_ECODH      MAEQQLYIHGGYTSATSGRTFINPANGNVLATVQAAGREDVDRAVKSAQQGQKIWASMTAMERSRILRRA
BETB_BURP1      ------------------------------------------------------------MQRSRILRRA
BETB_BURP0      ------------------------------------------------------------MQRSRILRRA
IOLA_BACCN      --RVKNHINGEWESTGTEVAVPNPATGKIIAYVPLSPKEDVERAVEAAKNAYETWSKVPVPNRSRMLYKY
BETB_ECOHS      MAEQQLYIHGGYTSATSGRTFINPANGNVLATVQAAGREDVDRAVKSAQQGQKIWAAMTAMERSRILRRA
BETB_BURPS      ------------------------------------------------------------MQRSRILRRA
BETB_ECO55      MAEQQLYIHGGYTSATSGRTFINPANGNVLATVQAAGREDVDRAVKSAQQGQKIWAAMTAMERSRILRRA
BETB_ECO24      MAEQQLYIHGGYTSATSGRTFINPANGNVLATVQAAGREDVDRAVKSAQQGQKIWAAMTAMERSRILRRA
IOLA1_GEOTN     ----KNYIGGQWVESRSAKTVPNPATGEVLAYVPISTREDLDRAVAAAKEAFKTWSKTPVPRRARILFKY
BETB_VIBVY      -------------------------------------------------------------ERSRCLLKA
BETB_ECO8A      MAEQQLYIHGGYTSATSGRTFINPANGNVLATVQAAGREDVDRAVKSAQQGQKIWAAMTAMERSRILRRA
BETB_BURMS      ------------------------------------------------------------MQRSRILRRA
BETB_BURMA      ------------------------------------------------------------MQRSRILRRA
BETB_BURM9      ------------------------------------------------------------MQRSRILRRA
BETB_BURM7      ------------------------------------------------------------MQRSRILRRA
BADH_BETVU      --------------------------------------------------------------RARYLRAI
IOLA1_BACWK     --RVKNHINGEWESTGTEVAVPNPATGKIIAYVPLSPKEDXXXXXXXXXXXYKTWSKVPVPNRSRQLYKY
CROM_ENTDO      --------------------------------------------------------------RGHLLYRL
BETB_ECO5E      MAEQQLYIHGGYTSATSGRTFINPANGNVLATVQAAGREDVDRAVKSAQQGQKIWAAMTAMERSRILRRA
BETB_ECO57      MAEQQLYIHGGYTSATSGRTFINPANGNVLATVQAAGREDVDRAVKSAQQGQKIWAAMTAMERSRILRRA
IOLA1_BACHK     --RVKNHINGEWESTGTEVAVPNPATGKIIAYVPLSPKEDXXXXXXXXXXXYETWSKVPVPNRSRQLYKY
IOLA1_BACCZ     --RVKNHINGEWESTGTEVAVPNPATGKIIAYVPLSPKEDXXXXXXXXXXXYETWSKVPVPNRSRQLYKY
IOLA1_BACAN     --RVKNHINGEWESTGTEVAVPNPATGKIIAYVPLSPKEDXXXXXXXXXXXYETWSKVPVPNRSRQLYKY
IOLA1_BACAH     --RVKNHINGEWESTGTEVAVPNPATGKIIAYVPLSPKEDXXXXXXXXXXXYETWSKVPVPNRSRQLYKY
BETB_MARMS      MAHQQQYIHGRYHASTEHFETINPATGEVIATVEHAGQAELDAAVESAKQGQKVWSAMSPVERGRILKKX
BETB_KLEP3      MAEQQLYINGGYTSATSGRTFINPATGEVLATVQAAGREDVDRAVESAQRGQKIWAAMTAMERSRILRRA
BETB_BURP6      ------------------------------------------------------------MQRSRILRRA
IOLA_BACCQ      --RVKNHINGEWESTGTEVAVPNPATGKIIAYVPLSPKEDXXXXXXXXXXXYETWSKVPVPNRSRQLYKY
IOLA_BACC7      --RVKNHINGEWESTGTEVAVPNPATGKIIAYVPLSPKEDXXXXXXXXXXXYETWSKVPVPNRSRQLYKY
GABD1_MYCPA     ----------------------------------------------------------------------
GABD1_MYCA1     ----------------------------------------------------------------------
BETB_SHIF8      MAEQQLYIHGGYTSATSGRTFINPANGNVLATVQAAGREDVDRAVKSAQQGQKIWAAMTAMERSRILRRA
IOLA_BACC4      --RVKNHINGEWESTGTEVAVPNPATGKIIAYVPLSPKEDXXXXXXXXXXXFETWSKVPVPNRSRNLYKY
IOLA_BACC2      --RVKNHINGEWESTGTEVAVPNPATGKIIAYVPLSPKEDXXXXXXXXXXXFETWSKVPVPNRSRNLYKY
IOLA_BACC1      --RVKNHINGEWESTGTEVAVPNPATGKIIAYVPLSPKEDXXXXXXXXXXXYETWSKVPVPNRSRQLYKY
SSDH2_SCHPO     ----QSFVQGKWISSPNNKTVDNPATGEIIGKVADVSVEETKKAISAANEAFKTYKNFTHVQRSQLLERW
IOLA_BACCR      --RVKNHINGEWESTGTEVAVPNPATGKIIAYVPLSPKEDXXXXXXXXXXXFETWSKVPVPNRSRNLYKY
IOLA2_GEOKA     ----KNYIGGQWVESRSGKTVPNPATGEVLAYVPISSREELDEAVRAAKEAFKTWRKTPVPRRARILFKY
BETB_ECOL6      MAEQQLYIHGGYTSATSGRTFINPANGNVLATVQAAGREDVDRAVKSAQQGQKIWAAMTAMERSRILRRA
BETB_ECOL5      MAEQQLYIHGGYTSATSGHTFINPANGNVLATVQAAGREDVDRAVKSAQQGQKIWAAMTAMERSRILRRA
BADH_SCHPO      -------------------------------------------------------------QRGLVLRKI
SSDH_HYLLA      --RTDSFVGGRWLPAAATFPVQDPASGAALGMVADCGXXXXXXXXXXXXXXFCSWREVSAKERSSLLRKW
IOLA_BACHD      --KLKNFIGGQWVESDSGKTVPNPATGEILAHVPISNREDLDRAVSVAKEAFKTWGKTPVPRRARVLFKY
IOLA2_GEOTN     ----KNFIGGQWSTSGKEEIVPNPATGEVLAKVPISSRXXXXXXXXXXXXXXXXWRKVPVPRRARILFRY
BETB_ECOSE      MAEQQLYIHGGYTSATSGRTFINPANGNVLATVQAAGREDVDRAVKSAQQGQKIWAAMTAMERSRILRRA
ALDHY_YEAST     -------INNEWHNLEKIFPVYNPSTEEDITQVSEKSQHDSTEEDITQVSEKSQHDDDKAVERGRLLNIL
IOLA3_GEOKA     ----KNFIGGQWSTSGKEEVVPNPATGEVLAKVPLSSRXXXXXXXXXXXXXXXXWRKVPVPRRARILFRY
SSDH_PANPA      --RTDSFVGGRWLPAAATFPVQDPASGAALGMVADCGXXXXXXXXXXXXXXFCCWREVSAKERSSLLRKW
SSDH_GORGO      --RTDSFVGGRWLPAAATFPVQDPASGAALGMVADCGXXXXXXXXXXXXXXFCRWREVSAKERSSLLRKW
CROM_OMMSL      ------------------------------------------------------------------LYRL
BETB_ECOSM      MAEQQLYIHGGYTSATSGRTFINPANGNVLATVQAAGREDVDRAVKSAQQGQKIWAAMTAMERSRILRRA
BADH2_ARATH     --RRQLFIGGQWTEPRKTLPVVNPATEDIIGYIPAATSEDVELAVEAARKAFTRNNGKDWARRAKYLRAI
SSDH_HUMAN      -----SFVGGRWLPAAATFPVQDPASGAALGMVADCGXXXXXXXXXXXXXXFCRWREVSAKERSSLLRKW
BETB_ECOLU      MAEQQLYIHGGYTSATSGRTFINPANGNVLATVQAAGREDVDRAVKSAQQGQKIWAAMTAMERSRILRRA
BETB_AGRRK      ----------------------------------------------------------------------
SSDH_PONPY      --RTDSFVGGRWLPAAATFPVQDPASGAALGMVADCGXXXXXXXXXXXXXXFCSWREVSAKERSSLLRKW
GABD_RHISN      ---FRNLANEPHPSQRQRFSVFNPSTGELLAEVPDMGXXXXXXXXXXXXXXQEPWSGLTARARSDILWKW
ASTD_NOVAD      --------------------------------------------------------------RIELVRRF
SSDH_PANTR      --RTDSFVGGRWLPAAATFPVQDPASGAALGMVADCGXXXXXXXXXXXXXXFCRWREVSAKERSSLLRKW
ROCA_STAES      ----------------------------------------------------------------------
ROCA_STAEQ      ----------------------------------------------------------------------
BETB_ECO7I      ----------------------NPANGNVLATVQAAGREDVDRAVKSAQQGQKIWAAMTAMERSRILRRA
BETB_ECO45      MAEQQLYIHGGYTSATSGRTFINPANGNVLATVQAAGREDVDRAVKSAQQGQKIWAAMTAMERSRILRRA
BETB_ECO27      MAEQQLYIHGGYTSATSGRTFINPANGNVLATVQAAGREDVDRAVKSAQQGQKIWAAMTAMERSRILRRA
ROCA_BACP2      ---YPLVINGERIETKDQIVSINPAKKDEVGTVSXXXXXXXXXXXXXXXXXFETWRYTSPEERASVIFRA
AL7A1_HUMAN     ----EGVYNGSWGGRGEVITTYCPANNEPIARVRQASVADYEETVKKAREAWKIWADIPAPKRGEIVRQI
ALDH2_HORSE     -------------------------------------------------------------DRGRLLNRL
DMPC_PSEUF      -------------------------------------------------------------ERAEILHRV
IOLA2_BACWK     ----KNYIGGQWSTSKQVEDVPNPATGEIIARVPLSTKEDLDRAVATAKEAFKTWRKVAVPRRARILFRY
AMNC_PSESP      MKQYRNFVDGKWVESSKTFQDVTPIDGSVVAVVEADRDLVDAAVKAGHRALEGEWGRTTAAQRVDWLRRI
AL221_ARATH     ---------GRSQQSDKKVQCYEPATMKYLGYFPALSPTEVEERVTLSRKAQKTWAQSSFKLRRQFLRIL
HPCC_ECOLX      MKKVNHWINGKNVAGNDYFLTTNPATGEVLADVASGGEAEINQAVATAKEAFPKWANLPMKERARLMRRL
AL8A1_DANRE     ----ENYIGGKFVPCSKLIDSFDPSTGEVYCKVPDSGAEEVNAAVRAAKEAFPDWSAKSPADRSKVLNKL
BADH_ORYSJ      ----------------------------------------------------------------------
YOSF_SCHPO      ------------------LTCYCPGDGSLLGEVKLFNKSDIDQSIILAEEAQKEWKSTSFAERRNFLKAL
GABD2_MYCUA     -------------------------------------------------------------ERAEVIRRY
ROCA1_BACHD     ---YPLIINGERVTTEDKIQSWNPARKDQLGSVSKANQDLAEKAIQSADEAFQTWRNVNPEERANILVKA
ABDH_SERP5      -------------------------------------------------------------ERAEHLLKL
ROCA_STAHJ      ----------------------------------------------------------------------
IOLA_LACCA      ----KNFINGKWVDAKTETNVYNPATGDVLARVPHSTSEDVADAVTAAKEAFKIWQKVSIPKRAKILFKY
SSDH1_SCHPO     ----RSYIGGKWAASGKTFDVENPGLNETLAPVTDMSVEETRKAIKVAHEAFLSYRNSDIKERYAILRRW
MMSA_BOVIN      -------IDGKFIESKSDIDIHNPATNEVIGRVPESTKAEMDAAVSSCKRTFPAWADTSILSRQQVLLRY
ROCA_BACSU      ---YPLVINGEKIETDRKIISINPANKEEIGYASTADQELAEKAMQAALQAFDSWKKQRPEHRANILFKA
IOLA2_BACSK     ----KNWIDGAWVEASTADTVPNPATGEAIAYVPLSGERDVEQAVASAKRAYETWKTVPVPERTRYMFAY
GABD_SYNY3      -------------------------------------------------------------QRGQWLRKA
YNEI_ECOLI      --------------------------------------------------------------RAEKLRDI
ROCA_STAAW      ----------------------------------------------------------------------
ROCA_STAAT      ----------------------------------------------------------------------
ROCA_STAAS      ----------------------------------------------------------------------
ROCA_STAAR      ----------------------------------------------------------------------
ROCA_STAAN      ----------------------------------------------------------------------
ROCA_STAAM      ----------------------------------------------------------------------
ROCA_STAAE      ----------------------------------------------------------------------
ROCA_STAAC      ----------------------------------------------------------------------
ROCA_STAAB      ----------------------------------------------------------------------
ROCA_STAA9      ----------------------------------------------------------------------
ROCA_STAA8      ----------------------------------------------------------------------
ROCA_STAA3      ----------------------------------------------------------------------
ROCA_STAA2      ----------------------------------------------------------------------
ROCA_STAA1      ----------------------------------------------------------------------
IOLA2_OCEIH     ----KNYIGGEWIESRTEKTVFNPATGEVIAQVPISTTEDVHHAIEVANEAFKTWKEVPVPKRARILFKY
MMSA_PSEAE      ----------------QRIPVSNPLDNSTLAEIACASAEQVEQAVASARETFASWKETPVSERARVMLRY
IOLA_BACP2      ----KNYIGGQWIEAETSQTVYNPATGKIIAEVPLSTKKDVERAVQAAQEAFTTWSKTPVPRRARILFKY
AL7A1_BOVIN     --------NGSWGGRGEVITTYCPANNEPIARVRQASMADYEETVEKAREAWSIWADVPAPKRGEVVRQI
MMSA_MOUSE      -------IDGKFVESKSDIDIHNPATNEVVGRVPQSTKAEMDAAVESCKRAFPAWADTSILSRQQVLLRY
ASTD_VIBHB      -------IAGEWVQGQGEFTSLSPYNQEVIWQGNGATAEQVNQAVSAAREAFVDWKKRPFAEREAIVLAF
BETB_XANCB      ------------------------------------------------------------VERSRILLRA
BETB_XANC8      ------------------------------------------------------------VERSRILLRA
MMSA_RAT        -------IDGKFVESKSDIDIHNPATNEVVGRVPQSTKAEMEAAVAACKRAFPAWADTSILSRQQVLLRY
MMSA_HUMAN      -------IGGKFVESKSDIDIHNPATNEVIGRVPQATKAEMDAAIASCKRAFPAWADTSVLSRQQVLLRY
BETB_XANCP      ------------------------------------------------------------VERSRILLRA
GABD2_MYCTU     --RLRNLAAIKDVAARPTRTIDEVFTGKPLTTIPVGTXXXXXXXXXXXXXXQTDWAKRPVIERAAVIRRY
GABD2_MYCTA     --RLRNLAAIKDVAARPTRTIDEVFTGKPLTTIPVGTXXXXXXXXXXXXXXQTDWAKRPVIERAAVIRRY
GABD2_MYCBP     --RLRNLAAIKDVAARPTRTIDEVFTGKPLTTIPVGTXXXXXXXXXXXXXXQTDWAKRPVIERAAVIRRY
GABD2_MYCBO     --RLRNLAAIKDVAARPTRTIDEVFTGKPLTTIPVGTXXXXXXXXXXXXXXQTDWAKRPVIERAAVIRRY
ASTD_VIBPA      -------IAGEWVQGQEEFVSLSPYNQEVIWRGNGXXXXXXXXXXXXXXXXFVEWKKRPFAEREAIVLAF
AL7A1_MOUSE     ----EGVYNGSWGGRGEVITTYCPANNEPIARVRQASLKDYEETIGKAKKAWNIWADIPAPKRGEIVRKI
BADH_HORVU      ----------------------------------------------------------------------
ASTD_CHRSD      --KQQLLIDGAWVDGDARFAKTDPVSGETLWTATAASATQVEHAVAAARQAFPDWARRSFAERQAVVERF
ASTD_IDILO      MTNSIQFIDGCWEAGEGQLKSIDPARNEVIWSGEAASETQVEKAILAARAAFPDWSGRSVEERLAICQKF
ASTD_BURM1      --------------------------------------------------------------RCAIAKRF
IOLA1_BACLD     ----------------------------------------------------------------------
ASTD_VIBSL      -------IAGQWVAGQGDMTSVSPYNNEVVWQGDSATPAQVESAVAAARDAFLVWKKLSFAEREAIVLNF
ABDH_SALTY      --QYQLLINGVLVDGEGERSVYNPATGEVILEIAEASPXXXXXXXXXXXXXXXEWGQTTPKARAECLLKL
ABDH_ECOLU      --QHKLLINGELVSGEGEKQVYNPATGEVLLEIAEXXXXXXXXXXXXXXXXXXXWGQTTPKARAECLLKL
ABDH_SHIF8      --QHKLLINGELVSGEGEKQVYNPATGDVLLEIAEVSXXXXXXXXXXXXXXXXXWGQTTPKARAECLLKL
AL7A1_MALDO     -------INGKWKASGPVISTVSPSNNQEIAKVTEVSMEEYEEGLRSCNDAAKTWKSLPAPKRGEIVRQI
ABDH_SHIFL      --QHKLLINGERVSGEGEKQVYNPATGDVLLEIAEVSXXXXXXXXXXXXXXXXXWGQTTPKARAECLLKL
BETB_XANC5      ------------------------------------------------------------VERSRILLRA
ABDH_ESCF3      --------------------------------------------------------------RAECLLKL
ABDH_ECOUT      --------------------------------------------------------------RAECLLKL
ABDH_ECOSE      --------------------------------------------------------------RAECLLKL
ABDH_ECOLI      --------------------------------------------------------------RAECLLKL
ABDH_ECOL6      --------------------------------------------------------------RAECLLKL
ABDH_ECOL5      --------------------------------------------------------------RAECLLKL
ABDH_ECOK1      --------------------------------------------------------------RAECLLKL
ABDH_ECODH      --------------------------------------------------------------RAECLLKL
ABDH_ECOBW      --------------------------------------------------------------RAECLLKL
ABDH_ECO8A      --------------------------------------------------------------RAECLLKL
ABDH_ECO81      --------------------------------------------------------------RAECLLKL
ABDH_ECO45      --------------------------------------------------------------RAECLLKL
ABDH_ECO27      --------------------------------------------------------------RAECLLKL
ABDH_ECO24      --------------------------------------------------------------RAECLLKL
ASTD_BURCH      --------------------------------------------------------------RCEIVKRF
ASTD_BURCA      --------------------------------------------------------------RCEIVKRF
ABDH_SHISS      --------------------------------------------------------------RAECLLKL
ABDH_ECOSM      --------------------------------------------------------------RAECLLKL
ABDH_ECOLC      --------------------------------------------------------------RAECLLKL
ABDH_ECOHS      --------------------------------------------------------------RAECLLKL
ASTD_BURXL      -------------------------------------------------------------ERCAVVRRF
ASTD_BURCM      --------------------------------------------------------------RCEIVKRF
ASTD_VIBVY      -------IAGEWEGLGEEFTSLSPYDNQVVWRGKGATAEQVEMAVKAARQAFVGWKKLSVAEREAMVLAF
ASTD_BURCC      --------------------------------------------------------------RCAIVKRF
ASTD_BURA4      --------------------------------------------------------------RCAIVKRF
ABDH_ECO55      --------------------------------------------------------------RTECLLKL
ABDH_CITK8      ---HQLLINGELVSGEGEKQVYNPATGEVILEIAEASPXXXXXXXXXXXXXXXEWGQTTPKARAELLLTL
ASTD_BURS3      --------------------------------------------------------------RCAIVKRF
AL7B4_ARATH     -------VAGKWQANGPLVSTLNPANNQPIAQVVEASLEDYEQGLKACEEAAKIWMQVTAPKRGDIVRQI
YHJ9_YEAST      -----------WNPEEPNIQCHCPATGQYLGSFPSKTEADIDEMVSKAGKAQSTWGNSDFSRRLRVLASL
GABD1_MYCTU     ----------------------------------------------------------------------
GABD1_MYCTA     ----------------------------------------------------------------------
GABD1_MYCBP     ----------------------------------------------------------------------
GABD1_MYCBO     ----------------------------------------------------------------------
ASTD_VIBVU      -------IAGEWEGLGEEFTSLSPYDNQVVWRGKGATAEQVEMAVKAARQAFVGWKTLSVAEREAVVLAF
ASTD_PHOLL      -------IGGRWIEGQGEITKFSPIDQQVLWQANSADASQVRAACHAAREAFYAWSHLPASERIKVIQTF
ABDH_ECO5E      --------------------------------------------------------------RAECLLKL
ABDH_ECO57      --------------------------------------------------------------RAECLLKL
XYLG_PSEPU      ----------------------------------------------------------------------
MMSA_DICDI      -------INGKFVESKTKLEVRNPATQELVTKVPVSTKEEMEAAVKAASDAFPAWRDTSVSNRSRIISNY
ABDH_SHIDS      --------------------------------------------------------------RAECLLKL
ASTD_MARAV      -------------------------------------------------------------ERQAVIEAF
ABDH_SALAR      --QYQLLINGALVNGEGERSVYNPATGEVILEIAEASPKQVDAAVLAADNAFTAWGQTTPKVRAECLLEL
MMSA_ARATH      --RVPNLIGGSFVESQSSIDVINPATQEVVSKVPLTTNEEFKAAVSAAKQAFPLWRNTPITTRQRVMLKF
BETB_XANAC      ------------------------------------------------------------VERSRILLRA
AL7A1_BRANA     -----NYVGGKWLGNGPLVSTLNPANNQVLAQVVEASLEDYEIGLKACEEAAKTWMQVPAPKRGDIVRQI
ABDH_SALTI      --QYQLLINGVLVDGEGERSVYNPATGEVILEIAEASPVQXXXXXXXXXXXXXEWGQTTPKARAECLLKL
ASTD_ALISL      -------IAGDWVSGHGEIQSLSPYNSNVVWQGESATKDQVESAVSAARHAFIEWKKQPFEARQVIIERF
ABDH_SALPC      --QYQLLINGVLVDGEGERSVYNPATGEVILEIAEXXXXXXXXXXXXXXXXXXEWGQTTPKARAECLLKL
ABDH_SALCH      --QYQLLINGVLVDGEGERSVYNPATGEVILEIAEXXXXXXXXXXXXXXXXXXEWGQTTPKARAECLLKL
AL7A1_CAEEL     --------HGKWAASGQVVQSFAPANNSPIANVQNGNVQDYEIAISEAKKAYNDWCEVPAPRRGEIVRQI
MMSA_DROME      -------IDGKFVESKTNIDVHDPATNQVVTRVPKATQAEMQAALESNKKAFRSWSNQSILTRQQVMFKL
ASTD_BURVG      --------------------------------------------------------------RCEIVKRF
ABDH_SALPA      --QYQLLINGVLVDGEGERSVYNPATGEVILEIAEASPAQIDAAVQAAVNTFAEWGQTTPKARAECLLKL
MMSA_DROPS      -------IDGKFVESKTKIDVHDPATNKVVTRVPKATQDEMQTALESNKKAFRSWSNQSILTRQAVMFKL
ABDH_SALPB      --QYQLLINGVLVDGEGERSVYNPATGEVILEIAEXXXXXXXXXXXXXXXXXXEWGQTTPKARAECLLKL
ASTD_SPHAL      --------------------------------------------------------------RTETLRRF
ASTD_BURCJ      --------------------------------------------------------------RCEIVKRF
ROCA2_BACHD     ----------------------------------------------------------------------
ASTD_VIBCM      -------------------------------------------------------------EREQKVLAF
ASTD_ENT38      -------INGDWVTGEGERRVKTPVGNEALWQGFDASPAQVEQACQAARKAFPAWAKLPFTARQAIVEKF
ASTD_SHEHH      -------IEGKWVAGGHEVTSINPANQEVIWNSKTATPEQVSQAVDAARNAQFDWFMLGFEGRLAIVEAY
ASTD_ECO5E      -------------------------------------------------------------ERQAVVERF
ASTD_ECO57      -------------------------------------------------------------ERQAVVERF
ASTD_KLEP7      --------------------------------------------------------------RQAIVEKF
MMSA_ANOGA      -------IDGKFVESKTNIDLHDPATNEVVTRVPKCTQDEMQTAVESSKKAYKTWRQSSILSRQQVMLKL
ASTD_ECOLC      -------------------------------------------------------------ERQAVVERF
ASTD_CITK8      --------------------------------------------------------------RQAIVEKF
ASTD_SHEPW      -------IEGKWTAGGHEVTSINPANQEVIWNSKTATPEQVNTAVDAARNAQFDWFMLGFEARLAIVEAY
ASTD1_CAUCR     -------------------------------------------------------------ERRAIALRF
AL7A1_PEA       -TNIGSFINGQWKANGPTVHSVNPSTNQVIASVTEATLDDYEEGLRASSEAAKTWRTVPAPKRGEIVRQI
MMSA_CAEEL      ------------------VELTNPATNEVIAMVPNATQAEMQAAVDSAKNAFNTWKNTSPLTRQQCMFKL
ASTD_PSEMY      --------------------------------------------------------------RIAVLERF
ASTD_PSEF5      -------IAGQWLAGQGEFTSVNPVTQAVIWSGNGATAAQVESAVQAARQAFPAWAKRSLEERISVLEAF
ASTD_ECO8A      -------------------------------------------------------------ERQVVVERF
ASTD_ECO55      -------------------------------------------------------------ERQVVVERF
ASTD_ECO24      -------------------------------------------------------------ERQVVVERF
ASTD_SALA4      --------------------------------------------------------------RQAIVEKF
ASTD_SHEPC      MTHY---IQGQWHTGNHDVTSINPANGETIWCGKTATAEQVNTAVEAARAAQFDWFMLGFDARLAIVEAY
ASTD2_CAUCR     -------------------------------------------------------------ERIAILRRY
ASTD_SHESH      --------------------------------------------------------------RLAIVEAY
ASTD_SALNS      --------------------------------------------------------------RQAIVEKF
ASTD_CAUSK      -------------------------------------------------------------ERIAVLRRY
ASTD_SORC5      -------------------------------------------------------------ERAALVKRF
ASTD_SHEPA      -------IEGKWEGLGHEVTSINPANQKVIWNSKTATPEQVGVAVDAARNAQFDWFMLGFDARLAIVEAY
ASTD_SALSV      ----------------------------------------------------------------AIVEKF
ASTD_SALPB      --------------------------------------------------------------RQAIVEKF
ASTD_SALAR      --------------------------------------------------------------RQAIVEKF
ASTD_ECOSE      -------------------------------------------------------------ERQVVVERF
ASTD_SALG2      --------------------------------------------------------------RQAIVEKF
ASTD_SALEP      --------------------------------------------------------------RQAIVEKF
ASTD_ECOHS      -------------------------------------------------------------ERQVVVERF
ASTD_VIBF1      -------IAGDWVLGEGEIQSLSPYNSEVVWKGESATEAQVESAVNAARNAFIEWKKLPFENRQAIVERF
ASTD_PSE14      -------IAGAWQAGQGELFSLNPVSQQTLWSGQAATPEQVDYAVQAARQAFPGWAQRSLDQRIAVLEAF
ASTD_VIBCH      -------------------------------------------------------------EREQKVLAF
ASTD_VIBC3      -------------------------------------------------------------EREQKVLAF
ASTD_SALTY      ------------------------------------------------------------------VEKF
ASTD_SALDC      ------------------------------------------------------------------VEKF
ALDH_VIBCH      ---YDNYIGGQWMKSGEYFSNTSPVNGLVFCRVARSSSQDVELALDAAHNALESWSTTSAVERSNILLRI
ALDH_VIBC3      ---YDNYIGGQWMKSGEYFSNTSPVNGLVFCRVARSSSQDVELALDAAHNALESWSTTSAVERSNILLRI
PUTA_ECOLI      -------------------------------------------------------------ERAAILHRA
ASTD_ECOLI      -------------------------------------------------------------ERHAVVERF
ASTD_ECODH      -------------------------------------------------------------ERHAVVERF
ASTD_ECOBW      -------------------------------------------------------------ERHAVVERF
ASTD_SHIB3      -------------------------------------------------------------ERQVVVERF
ASTD_SHEWM      -------INGQWVAGGHEVTSKNPANSEVIWSSKTATAEQVNTAVEAAREVQFDWFMLGFEGRLAIVEAY
ASTD_PHOPR      -------IAGNWLAGKGEMNSLNPFSSEEIWQGDAATAEQVEQAVSAAREALTTWRKTDLSERQAVVEKF
ASTD_CHRVO      -------------------------------------------------------------ERAKVVRRF
ASTD1_SHEDO     -------------------------------------------------------------ERLVIVEAF
GABD1_MYCLE     ------------------IATINPATGETVKTFTPTTQDEVEDAIARAYARFDNYRHTTFTQRAKWANAT
ASTD_SALPK      --------------------------------------------------------------RQAIVQKF
ASTD_SALPC      --------------------------------------------------------------RQAIVEKF
ASTD_SALPA      --------------------------------------------------------------RQAIVQKF
ASTD_YERPS      -------IQGEWRGNGVSFEKQDPMSQQRLWQARAADHTDVTLXXXXXXXXXXXXXXXSLEQRATVIQQF
ASTD_YERPB      -------IQGEWRGNGVSFEKQDPMSQQRLWQARAADHTDVTLXXXXXXXXXXXXXXXSLEQRATVIQQF
PUTA_KLEAE      -------------------------------------------------------------ERAAILERA
ASTD_SHIBS      -------------------------------------------------------------ERQVVVERF
ASTD_SHESA      -----HFIKGQWQAGKHDVTSSNPANSEIIWRGQTATAEQVNAAVDAAREAQFDWFMLGFDGRLKIVEAY
ASTD_SALHS      ------------------------------------------------------------------VEKF
ALDB_ECOLI      --RYDNFIGGEWPADGEYYQNLTPVTGQLLCEVASSGKRDIDLALDAAHKVKDKWAHTSVQDRAAILFKI
ASTD_VIBFM      -------IAGDWVSGEGEIQSLSPYNSEVVWKGESATEAQVESAVNAARNAFIEWKKLPFENRQAIVERF
ASTD_PSEA6      MTQQTHFIAGQWHAGQHDIESIDPAKKRQIWQAKSASSEQVNQAVSSARKATVTWAACTFEQRLAYVKRF
ASTD_YERPY      -------IQGEWRGNGVSFEKQDPMSQQRLWQARAADHTDVTLXXXXXXXXXXXXXXXSLEQRATVIQQF
ASTD_YERPG      -------IQGEWRGNGVSFEKQDPMSQQRLWQARAADHTDVTLXXXXXXXXXXXXXXXSLEQRATVIQQF
ASTD_YERPE      -------IQGEWRGNGVSFEKQDPMSQQRLWQARAADHTDVTLXXXXXXXXXXXXXXXSLEQRATVIQQF
ASTD_YERPA      -------IQGEWRGNGVSFEKQDPMSQQRLWQARAADHTDVTLXXXXXXXXXXXXXXXSLEQRATVIQQF
ASTD_ENTS8      -------------------------------------------------------------DRQAIAEKF
ASTD_SERP5      -------------------------------------------------------------QREQLVKRF
MMSA_AEDAE      -------IDGKFVDSKEWIDLHDPATNKVVTRVPKCTQDEMESAVESSKKAFKTWSQTSILGRQQVMFKL
ASTD_SHESW      --------------------------------------------------------------RLAIVEAY
ASTD_SHEFN      --------------------------------------------------------------RLAIVEAY
ASTD_ECOUT      -------------------------------------------------------------DRQVRVERF
ASTD_ECO45      -------------------------------------------------------------DRQVRVERF
ASTD_AERHH      --------------------------------------------------------------RLAIVRRY
ALDH_DEIRA      --RYDNFIGGQWVPKGQYFDNASPVDGKVFTQAARSTAEDVELXXXXXXXXXXXWGRTSVTERSNILLKI
DHA2_RALEH      --QYENYIGGAWPAGGEYFESTTPITGKPFTRVPRSGQQDVDXXXXXXXXXXXXXXRTSTTERANILNRI
ASTD_YERPP      -------IQGEWRGNGVSFEKQDPMSQQRLWQARAADHTDVTLXXXXXXXXXXXXXXXSLEQRATVIQQF
ASTD_SHIDS      -------------------------------------------------------------DRQVRVERF
ASTD_SHEB9      MTHY---IQGQWHAGKHDVASINPANAQTIWTGKTATAEQVNAAVDAAREAQFDWFMLGFDARLAIVEAY
ASTD_SHEB5      MTHY---IQGQWHAGKHDVASINPANAQTIWTGKTATAEQVNAAVDAAREAQFDWFMLGFDARLAIVEAY
ASTD_SALTI      ------------------------------------------------------------------VEKF
ASTD_AERS4      -------------------------------------------------------------DRLAIVRRY
ASTD_ECOLU      -------------------------------------------------------------DRQVRVERF
ASTD_ECO27      ----------------------------------------------------------------------
ABDH_ENT38      --------------------------------------------------------------RAECLLKL
ASTD_SHIF8      -------------------------------------------------------------ERQVVVERF
ASTD_SHEON      ----------------------------------------------------------------------
ASTD_ECO81      -------------------------------------------------------------DRQVRVERF
ASTD_ECOL5      -------------------------------------------------------------DRQVRVERF
ASTD_SHIFL      -------------------------------------------------------------ERQVVVERF
ASTD_PSEU2      -------------------------------------------------------------QRIAVLEAF
ASTD_ECOL6      -------------------------------------------------------------DRQVRVERF
ASTD_PSEAE      -------------------------------------------------------------QRIELLERF
ASTD2_SHEDO     ----------------------------------------------------------------------
ASTD1_PSEHT     MTHPAQFINGQWSQGQTEFSSVNPANNNVIFQANSATAEQVDAAVSAAREAFYAWADKTFAERLEIVKAF
ASTD_SHEB2      --------------------------------------------------------------RLAIVETY
ASTD_HAHCH      --------------------------------------------------------------RIDIVKRF
ASTD_BURTA      --------------------------------------------------------------RCTIVKRF
ASTD_PSEPW      --------------------------------------------------------------RIDVLEKF
ASTD_PSEE4      --------------------------------------------------------------RIGVLEAF
PUTA_SALTY      -------------------------------------------------------------ERAAILQRA
ASTD_COLP3      --------------------------------------------------------------RVAVVTKF
THCA_RHOER      -SRYDNWIGNEWVAKGQYFENPTPVTGQNFCDVARSTXXXXXXXXXXXXXXXXXWGKTSVAERAIILNKI
ASTD_SHEB8      --------------------------------------------------------------RLAIVEAY
ASTD_PSEPK      --------------------------------------------------------------RIDVLEKF
ASTD2_PSEHT     -------------------------------------------------------------QRITILENF
ASTD_PSEPG      --------------------------------------------------------------RIDVLEKF
PUT2_EMENI      ----------------------------------------------------------------------
ASTD_PSEP1      --------------------------------------------------------------RIDVLEKF
AL3H1_ARATH     --------------------------------------------------------------RVTQLKKL
ASTD_ECOSM      -------------------------------------------------------------DRQVRVERF
ASTD_ESCF3      -------------------------------------------------------------DRQVRVERF
ASTD_BURPS      --------------------------------------------------------------RCAIVKRF
ASTD_BURP6      --------------------------------------------------------------RCAIVKRF
ASTD_BURP1      --------------------------------------------------------------RCAIVKRF
ASTD_BURP0      --------------------------------------------------------------RCAIVKRF
ASTD_BURMS      --------------------------------------------------------------RCAIVKRF
ASTD_BURMA      --------------------------------------------------------------RCAIVKRF
ALDH_RHORT      --RYDNFIDGTWQPPVEYFDNVTPITGKVFCKAARSTEEDITXXXXXXXXXXXRWGRTTAAERALILNRI
ASTD_LEGPH      -------------------------------------------------------------ERARYTKAF
ASTD_LEGPC      -------------------------------------------------------------ERARYTKAF
ASTD_ERWT9      -------INGQWLAGEGETVIKTPVSGEVLWQGRGXXXXXXXXXXXXXXXXXXXWARQPFAERQAIVEKF
ASTD_ACIAD      -------------------------------------------------------------DRIAIIERF
AL3A1_RAT       ----------------------------------------------------------------------
CALB_PSEAE      ----------------------------------------------------------------------
ASTD_LEGPL      -------------------------------------------------------------ERARYTKAF
CALB_CAUCR      ----------------------------------------------------------------------
AL7A1_DICDI     --------NGKWGGAGEIIKCLNPTNNKVIATVRGAAPEEYETCIQAMLAAKVKWALTPAPRRGEIVRLI
ASTD_PSESM      -------------------------------------------------------------QRIAVLDAF
ASTD_PSEFS      -------------------------------------------------------------ERISVLETF
ALDH3_BACSU     ----------------------------------------------------------------------
AL3B1_MOUSE     --------------------------------------------------------------RAAQLQGL
ALDH_CRAPL      ----------------------------------------------------------------------
AL3B1_RAT       --------------------------------------------------------------RAAQLQGL
ASTD_LEGPA      -------------------------------------------------------------ERARYTIAF
ALDH_PSEOL      ----------------------------------------------------------------------
ALDH2_MACPR     ----------------------------------------------------------------------
AL3A1_HUMAN     ----------------------------------------------------------------------
AL3A1_MOUSE     ----------------------------------------------------------------------
AL4A1_DICDI     ----------------------------------------------------------------------
ASTD_ECO7I      -------------------------------------------------------------DRQVRVERF
AL3B1_HUMAN     --------------------------------------------------------------RAAQLQGL
ASTD_PSEPF      -------IAGEWLAGQGEFQSLNPVTQQVLWSGEGATAAQVESAVQAARQAFPGWARRTLEDRISVLEAF
ALDH2_BACSU     ----------------------------------------------------------------------
ALDH9_POLMI     ----------------------------------------------------------------------
PUT2_YEAST      ------VINGERIYDNNERALFPQTNQQVLANVTQATEKDVMNXXXXXXXXXXXWYNLPFYDRSAIFLKA
AL3B1_BOVIN     --------------------------------------------------------------RDAQLKGL
ALDH_STRCO      -------------------------------------------------------------ERSDILLKI
PUT2_AGABI      ----------------------------------------------------------------------
ALDH_PSESP      -------IGGHGVATSDYLPVLNPATRQPIGQCPVASEEHVEQARAAAGDAFAVWRQVPYGKRCEQLQAL
CALB_PSEUH      ----------------------------------------------------------------------
AL3F1_ARATH     ----------------------------------------------------------------------
PUT2_SCHPO      ----------------------------------------------------------------------
AL4A1_HUMAN     -------------------------------------------------------------DRAQIFLKA
AL3A2_RAT       ----------------------------------------------------------------------
AL3A2_MOUSE     ----------------------------------------------------------------------
AL4A1_DANRE     -------------------------------------------------------------DRAQIFFKA
ALDH1_ENTHI     ----------------------------------------------------------------------
AL3A1_CANFA     ----------------------------------------------------------------------
AL3A2_HUMAN     ----------------------------------------------------------------------
AL4A1_BOVIN     -------------------------------------------------------------DRAQVFLKA
AL3A2_PONAB     ----------------------------------------------------------------------
PUTA_RHIME      --------------------------------------------------------------------RA
AL3A2_MACFA     ----------------------------------------------------------------------
AL3I1_ARATH     --------------------------------------------------------------RISQLQNI
ALDH_MYCTU      -SRYQNFIGGQWVAPVRYFENPTPVTGQPFCEVPRSXXXXXXXXXXXXXXXXPGWGKTAPAERAAILNMI
ALDH_MYCBO      -SRYQNFIGGQWVAPVRYFENPTPVTGQPFCEVPRSXXXXXXXXXXXXXXXXPGWGKTAPAERAAILNMI
AL3B2_HUMAN     ----------------------------------------------------------------------
ALDH3_DICDI     ----------------------------------------------------------------------
AL4A1_RAT       -------------------------------------------------------------DRAQIFLKA
AL4A1_MOUSE     -------------------------------------------------------------DRAQVFLKA
A16A1_BOVIN     -------VNGQWLKPEHRSSVQDPITGENLASCLXXXXXXXXXXXXXXXXXLENWSTQPGAIRAQHLTRL
BOXD_AZOEV      -------------------------------------------------------------ERAAKLAAI
EUTE_SALTY      ----------------------------------------------------------------------
ALDHX_YEAST     ----------------------------------------------------------------------
A16A1_RAT       ----------------------------------------------------------------------
A16A1_HUMAN     -------VNGKWLKPEHRNSVQDPITGENLASCLXXXXXXXXXXXXXXRMAFKGWSAHPGVVRAQHLTRL
A16A1_MOUSE     --------------------------------------------------------------RGQHLTRL
MAOC_ECOLI      ------------------------------------------------------------IERAAMLKAV
EUTE_ECOLI      ----------------------------------------------------------------------
AL3A1_BOVIN     ----------------------------------------------------------------------
HFD1_YEAST      ----------------------------------------------------------------------
AL121_ARATH     ----QSFVQGKWIGSSNHNTLLDPLNGEESGTQPSLSQCPKHGLHNPFKSPERYLLYGDISTKAAHM---
ALDH_LINUS      -----NLVQGNWGGSSSWHTVVDPLNGEPFIKVAEVDETEIKPFVESLSKCPKHGLHNPFKSPERYLTKA
AL7A1_RAT       ----------------------------------------------------------------------
ADHE_CLOAB      ----------------------------------------------------------------------
PROA_POLNA      ----------------------------------------------------------------------
PROA_LACLS      -------------------------------------------------------------EKNTFLQKL
PROA_LACLM      -------------------------------------------------------------EKNTFLQKL
PROA_RHOFD      ----------------------------------------------------------------------
ALDH_VIBHA      -------------------------------------------------------------KRASLLRTI
PROA_THICR      ----------------------------------------------------------------------
PROA_PSYCK      ----------------------------------------------------------------------
PROA_ACIAD      ----------------------------------------------------------------------
PROA_CAMC5      --------------------------------------------------------------KSQILNAV
PROA_POLSJ      ----------------------------------------------------------------------
PROA_CLOPH      ----------------------------------------------------------------------
PROA_RALEH      ------------------------------------------------------------VERARANGQD
PROA_AZOSE      -------------------------------------------------------------KNAALVAMA
PROA_HELMI      ----------------------------------------------------------------------
PROA_DICT6      ----------------------------------------------------------------------
PROA_CLOBA      ----------------------------------------------------------------------
PROA_STRPF      -----------------------------------------------------------------FLSTL
PROA_RALEJ      ----------------------------------------------------------------------
PROA_DICTD      ----------------------------------------------------------------------
PROA_SCHPO      ----------------------------------------------------------------------
PROA_ACISJ      ----------------------------------------------------------------------
PROA_KOSOT      ----------------------------------------------------------------------
PROA_DIAST      ----------------------------------------------------------------------
PROA_DESDA      ----------------------------------------------------------------------
PROA_TERTT      ----------------------------------------------------------------------
PROA_METPP      ----------------------------------------------------------------------
PROA_CLOPE      ------------------------------------------------------------LEKAIEKGTS
PROA_CLONN      ----------------------------------------------------------------------
PROA_PSESM      ----------------------------------------------------------------------
PROA_FRAP2      ----------------------------------------------------------------------
PROA_STRP1      ----------------------------------------------------------------------
PROA_CARHZ      ------------------------------------------------------------------LLKI
PROA_ENT38      -------------------------------------------------------------EKNRVLEKI
PROA_AZOSB      ----------------------------------------------------------------------
PROA_STRPM      ----------------------------------------------------------------------
PROA_STRPG      ----------------------------------------------------------------------
PROA_STRPC      ----------------------------------------------------------------------
PROA_STRPB      ----------------------------------------------------------------------
PROA_STRP8      ----------------------------------------------------------------------
PROA_STRP6      ----------------------------------------------------------------------
PROA_LISW6      ----------------------------------------------------------------------
PROA_LACLA      -------------------------------------------------------------DKNVFLQNL
PROA_CLOK5      ----------------------------------------------------------------------
PROA_CLOK1      ----------------------------------------------------------------------
PROA_VIBCH      ----------------------------------------------------------------------
PROA_VIBC3      ----------------------------------------------------------------------
PROA_STRTD      ------------------------------------------------------------------LNQV
PROA_CLOTE      ----------------------------------------------------------------------
PROA_STRTR      ------------------------------------------------------------------LNQV
PROA_LISMO      ----------------------------------------------------------------------
PROA_LISIN      ----------------------------------------------------------------------
PROA_EUBR3      ----------------------------------------------------------------------
PROA_DELAS      ----------------------------------------------------------------------
PROA_STREM      ----------------------------------------------------------------------
PROA_PHOPR      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           AAILERDKEKIGTILAKEVAKGIKAAIGEVVRTADLIRYAAEEGXRITGQAMEGGGFEAASKNKLAVVRR
GAPN_STRMU      ADILMRDKEKIGAVLSKEVAKGYKSAVSEVVRTAEIINYAAEEGLRMEGEVLEGGSFEAASKKKIAVVRR
GAPN_STREI      ADILMRDAEKIGAVLSKEIAKGYKSAVGEVIRTAEIINYAAXXXXXXXXXXXXXXSFDPASKKKIAIVRR
GAPN_NICPL      AAILKEHKAPIAECLVKEIAKPAKDAVTEVVRSGDLVSYTAEEGVRILGEGLVSDSFPGNERTKYCLTSK
GAPN_WHEAT      AAILKEHKTPIAESLVKEIAKPAKDAVSEVVRSGDLVSYTAEEGVRILGEGLVSDSFPGNERNKYCLSSK
GAPN_APIGR      AAILKEHKAAIADCLVKEIAKPAKDSVTEVVRSGDLVSYCAEEGVRLLGEGLVSDSFPGNERTKYCLTSK
GAPN_MAIZE      AAILKEHKAPIAECLVKEIAKPAKDAVSEVVRSGDLVSYTAEEGVRILGEGVVSDSFPGNERNKYCLSSK
GAPN_PEA        AAILKEHKAAIAECLVKEIAKPAKDAVTEVVRSGDLVSYCAEEGVRILGEGLVSDSFPGNERTKYCLTSK
GAPN_ARATH      AAILKDNKAPMAESLVKEIAKPAKDSVTEVVRSGDLISYCAEEGVRILGEGLLSDSFPGNDRTKYCLTSK
LADH_META3      ASELSKNKRELAKLITIDVGKPIKQSIIEVDRTITTFKFSAFYSRELRGETIP-------FDDGMVITKR
GAPN_SCEVA      ----------------------------------------------------------------------
LADH_METJA      XXXXXXXXXXXXXXXXXDAGKPIKQARVEVERSIGTFKLAAFYVKEHRDEVIP-------SDDRLIFTRR
LADH_METVS      AEHISSKKDLFANTISVDVGKPIKQSRIEVDRTITAFRLSALYAKELRGETIP-------SENEIIFTKK
LADH_METM7      AEQISLKKDLFAKTISIDVGKPIKQSKIEVDRTLTAFRLSAFYAKELRGETIN-------SENGLIFTKK
LADH_METM5      AEQISLKKDLFAKTISIDVGKPIKQSKIEVDRTLTALKLSAFYAKELRGETIN-------SENGLIFTKK
LADH_METMP      AEHLSSKKDFFAKTISIDVGKPIKQSKIEVDRTLTALKLSAFYAKELRGETIN-------SENGLIFTKK
GABD_ECOLI      FNLMMEHQDDLARLMTLEQGKPLAEAKGEISYAASFIEWFAEEGKRIYGDTIPGH-----QADKRLIVIK
ALDH1_BACSU     ADIMEQRLEEIAACATREMGKTLPEAKGETARGIAILRYYAGEGMRKTGDVIP-----STDKDALMFTTR
ALDH5_BACSU     VTYIEENEEAIIYLIMEELGGTRLKAAFEIGLVKNIIKEAATFPIR-----MEGKILPSTIDGKENRLYR
SSDH_ARATH      YDLLIAHKEELGQLITLEQGKPLKEAIGEVAYGASFIEYYAEEAKRVYGDIIPPN-----LSDRRLLVLK
ALDH_BACST      AHILEQCLQDIAETMTREMGKTLAEAKAETMRGVHILRYYAGEGARKIGDVIPSSDSEG-----LLFTTR
YLX7_SCHPO      AELTEKHADTLAAIEAMDSGKPLVSARGDVDGTIALLRYCAGWADKIYGQVIPTG------PEKLAYAKR
ALDY_BACSU      RGYLHENRDDIIMMIARETGGTIIKSTIELEQTIAIL----DEAMTYTGEL--GGVKEVPSEGKTNKIYR
AL1A3_HUMAN     ADLVERDRATLAALETMDTGKPFLHALEGCIRT---LRYFAGWADKIQGKTIP------TDDNVVCFTRH
AL1A3_RAT       ADLIERDRAILATLETMDTGKPLHAFFVDLEGCIKTFRYFAGWADKIQGRTIP------TDDNVMCFTRH
Y4UC_RHISN      AQMVESRHDAFAEIIVREAGKTIVQARKEVLRCVNTLKLSAEEAKRNAGEIVPFDAY-TGSEQRQGWFTR
AL1A2_CHICK     ADLVERDRAVLATMESLNSGKPLQAFYVDLQGVIKTLRYYAGWADKIHGMTIPVDG------DYFTFTRH
GABD_BACSU      YELIVEHKEELADLITKENGKPYQEAVGEVLYGAGYIEWFAEEAKRVYGRTVP-----APTTGKRIVVTR
BETB_PSEMY      VDILRERNDELAELETLDTGKPLETRYVDIVTGADVLEYYAGLIPAIEGEQIP------LRESSFVYTRR
ALDH_ASPNG      ADLFERDAEILASIEALDNGKSITMAHGDIAGAAGCLRYYGGWADKIHGQTID------TNSETLNYTRH
AL1A2_HUMAN     ADLVERDRAVLATMESLNGGKPLQAFYVDLQGVIKTFRYYAGWADKIHGMTIPVDG------DYFTFTRH
ALDH5_YEAS7     ADLVEKHQETLAAIESMDNGKSLFCARGDVALVSKYLRSCGGWADKIYGNVIDTG------KNHFTYSIK
A9A1B_DANRE     ARLIEKRREEIAEMEVINNGKSITEARLDVDSARLSIEYFAGQATTLSGQHVQGGSF--------AYTRR
ALDH5_YEAST     ADLVEKHQETLAAIESMDNGKSLFCARGDVALVSKYLRSCGGWADKIYGNVIDTG------KNHFTYSIK
PUUC_ECOLI      ----------------------------DIPGAARAIRWYAEAIDKVYGEVA------TTSSHELAMIVR
BETB_PSEFS      VDILRERNDELAALETLDTGKAFETQYVDVVTGADVLEYYAGLVPAIEGEQIP------LRDTSFVYTRR
AL9A1_MOUSE     ARIIKERKDEIATVETINNGKSIFEARLDVDTCWQCLEYYAGLAASMAGEHIQGGSF--------GYTRR
AL1A2_RAT       ADLVERDRATLATMESLNGGKPFLQALQGVIKT---LRYYAGWADKIHGMTIPVDG------DYFTFTRH
AL1A2_MOUSE     ADLVERDRATLATMESLNGGKPFLQALQGVIKT---LRYYAGWADKIHGMTIPVDG------DYFTFTRH
BETB_BURPP      VDLLRERNDELAALETRDTGKPIAETLADIVTGADVIEYYAGLATAIEGQQIP------LRPTSFVYTRR
ALDH_EMENI      ADLMERDIDTLAAIESLDNGKAFTMAKVDLANSIGCLRYYAGWADKIHGQTID------TNPETLTYTRH
FEAB_ECOLI      ADLVEQHSEELAQLETLEQGKSIAISRAEVGCTLNWMRYTAGLTTKIAGKTLDLSIPLPQGARYQAWTRK
ALDH_AGABI      AQLMEKNIDDLSAIEALDNGKTLWAKSVDLSLSISTIKHYAGWADKNFGQVIE------TDEKKLTYSRH
ALDH4_YEAST     AELIEQDKDVIASIETLDNGKAISSSRGDVDLVINYLKSSAGFADKIDGRMIDTG------RTHFSYTKR
AL1A1_MACFA     ADLIERDRLLLATMESMNGGKLYSNALNDLAGCIKTLRYCAGWADKIQGRTIPIDG------NFFTYTRH
BETB_BURXL      VEILRERNDELAALETRDTGKPIAETLAVDIATADVIEYYAGLATAIEGQQIP------LRPTSFVYTRR
AL1A3_MOUSE     ADLVERDRAILATLETMDTGKPLHAFFVDLEGCIKTFRYFAGWADKIQGRTIP------TDDNVVCFTRH
AL1A2_TAEGU     ADLVERDRAILATMESLNSGKPLQAFYVDLQGVIKTLRYYAGWADKIHGMTIPVDG------DYFTFTRH
AL9A1_RAT       ARIIKERRDEIAIMETINNGKSIFEARLDVDTSWQCLEYYAGLAASMAGEHIQGGSF--------GYTRR
AL1A1_SHEEP     ADLIERDRLLLATMEAMNGGKLFSNALGGCIKT---LRYCAGWADKIQGRTIPMDG------NFFTYTRS
BETB_ACIAD      VDILRERNDELAQLETLDTGKAFETSTVDIVTGADVLEYYAGLATAIQGEQVP------LRESSFFYTRR
AL1A1_RABIT     ADLIERDRLLLATMESLNAGKLFPNALGGCIKT---LRYCAGWADKIQGRTMPMDG------DFFCYTRH
AL1A1_HUMAN     ADLIERDRLLLATMESMNGGKLYSNALNDLAGCIKTLRYCAGWADKIQGRTIPIDG------NFFTYTRH
AL1A1_BOVIN     ADLIERDHLLLATMEAMNGGKLFSNALGGCIKT---LRYCAGWADKIQGRTIPMDG------NFFTYTRS
FTHFD_XENTR     ADIMEEHQEELATIESIDSGAALKTHVGMSIQT---FRYFAGWCDKIQGSTIPIN--QARPNRNLTFTRR
BETB_VIBPA      VAILRERNDELAALEVADTGKPIQEAIAVDITTADVIEYYAGLAPSLQGEQ------QPLNENQFFYTRR
AL1A7_MOUSE     ADLMERDRLLLATMESMNAGKVFAHALLDVEISIKALQYFAGWADKIHGQTIPSDG------NIFTYTRR
BETB_BURCM      VDLLRERNDELAAIETRDTGKPIGETLADIVTGADVIEYYAGLATAIEGLQVP------LRAESFVYTRR
ALDH_CLAHE      ANLFEKNIDLLAAVESLDNGKAISMAKGDISMCVGCLRYYGGWADKITGKVID------TTPDTFNYVKK
BETB_BURA4      VDLLRERNDELAAIETRDTGKPIGETLADIVTGADVIEYYAGLATAIEGLQVP------LRAESFVYTRR
BETB2_RHIME     ADIMRARNRELSVLETRDTGKPIETLVADAASGADCLEYFGAIAATLSGDSIQFG-------EDWVYTRR
BETB_PSEAE      VDILRERNDELAALETLDTGKPLAETRSDIVTGADVLEYYAGLVPAIEGEQIP------LRETSFVYTRR
BETB_PSEA8      VDILRERNDELAALETLDTGKPLAETRSDIVTGADVLEYYAGLVPAIEGEQIP------LRETSFVYTRR
BETB_PSEA7      VDLLRERNDELAALETLDTGKPLETRAVDIVTGADVLEYYAGLVPAIEGEQIP------LRETSFVYTRR
ALD1_STAHJ      --IVEEYKNR-----KQDIIEAITDELGAPLTLSENVHY--QMGLNHFEEASRADSFEFEERRGDALVTK
BETB_PSEAB      VDILRERNDELAALETLDTGKPLAETRSDIVTGADVLEYYAGLVPAIEGEQIP------LRETSFVYTRR
SSDH_RAT        YDLMIQNKDELAKIITAESGKPLKEAQGEILYSAFFLEWFSEEARRVYGDIIY-----TSAKDKRGLVLK
ROCA_BACWK      AAIVRRRKHEFSAILVKEAGKPWNEADADTAEAIDFMEYYARQMLKLKGMPVESRPIEY---NRFSYI--
AL1A1_MOUSE     ADLMERDRLLLATMEALNGGKVFNAYLSDLGGCIKALKYCAGWADKIHGQTIPSDG------DIFTYTRR
ROCA_GEOSW      AAIVRRRKHEFSALMVKEAGKPWKEADADTAEAIDFMEYYARQMLKLKGVPVESRPGET---NRFFYI--
AL1B1_RAT       ADLVERDRVYLASLETLDNGKPFQESLDEVIK---VYRYLAGWADKWHGKTIPMDG------EHFCFTRH
AL1A1_RAT       ADLMERDRLLLATIEAINGGKVFNAYLSDLGGSIKALKYCAGWADKIHGQTIPSDG------DIFTFTRR
YF19_SCHPO      ADCIEQNLEYLASIETLDNGKSITLARGDVQAAADCFRYYGGWADKDYGQTIE------TDIKRFAYTRH
ROCA_BACCN      AAIVRRRKHEFSAILVKEAGKPWNEADADTAEAIDFMEYYGRQMLKLKGIPVESRPIEY---NRFSYI--
BETB_ACIBT      VDILRERNDELARLETLDTGKAYETSTVDIVTGADVLEYYAGLATAIQGEQVP------LRESSFFYTRR
BETB_PECCP      VDILRERNDELALLETHDTGKPLETRTVDIVTGADVLEYYAGLIPMLEGQQIP------LRDTSFAYTRR
NAHF_PSEU8      ADVMESKTPKFIEVMAMEVGASALWAGFNVHASANVFREAASLATQIQGETIPTDKAET-----LSMTLR
NAHF_PSEPU      ADVMESKTPKFIEVMAMEVGASALWAGFNVHASANVFREAASLATQIQGETIPTDKAET-----LSMTLR
BETB_BRUSU      AEILREKNRKLSKLETLDTGKALQETVXXXXXXXXXLEFFGGIISGFNGEFVELGG-------SFAYTRR
BETB_BRUSI      AEILREKNRKLSKLETLDTGKALQETVXXXXXXXXXLEFFGGIISGFNGEFVELGG-------SFAYTRR
BETB_BRUO2      AEILREKNRKLSKLETLDTGKALQETVXXXXXXXXXLEFFGGIISGFNGEFVELGG-------SFAYTRR
BETB_BRUME      AEILREKNRKLSKLETLDTGKALQETVXXXXXXXXXLEFFGGIISGFNGEFVELGG-------SFAYTRR
BETB_BRUC2      AEILREKNRKLSKLETLDTGKALQETVXXXXXXXXXLEFFGGIISGFNGEFVELGG-------SFAYTRR
BETB_BRUAB      AEILREKNRKLSKLETLDTGKALQETVXXXXXXXXXLEFFGGIISGFNGEFVELGG-------SFAYTRR
BETB_BRUA2      AEILREKNRKLSKLETLDTGKALQETVXXXXXXXXXLEFFGGIISGFNGEFVELGG-------SFAYTRR
BETB_BRUA1      AEILREKNRKLSKLETLDTGKALQETVXXXXXXXXXLEFFGGIISGFNGEFVELGG-------SFAYTRR
BETB_ACIBY      VDILRERNDELARLETLDTGKAYETSTVDIVTGADVLEYYAGLATAIQGEQVP------LRESSFFYTRR
BETB_ACIB5      VDILRERNDELARLETLDTGKAYETSTVDIVTGADVLEYYAGLATAIQGEQVP------LRESSFFYTRR
BETB_ACIB3      VDILRERNDELARLETLDTGKAYETSTVDIVTGADVLEYYAGLATAIQGEQVP------LRESSFFYTRR
ALD1_STAAW      VKEYENRKD--------DIVQAITDELGAPLSLSERVHYQMGLNHFVAARALDNYEFEERRGDDLVV--K
ALD1_STAAS      VKEYENRKD--------DIVQAITDELGAPLSLSERVHYQMGLNHFVAARALDNYEFEERRGDDLVV--K
ALD1_STAAN      VKEYENRKD--------DIVQAITDELGAPLSLSERVHYQMGLNHFVAARALDNYEFEERRGDDLVV--K
ALD1_STAAM      VKEYENRKD--------DIVQAITDELGAPLSLSERVHYQMGLNHFVAARALDNYEFEERRGDDLVV--K
ALD1_STAAC      VKEYENRKD--------DIVQAITDELGAPLSLSERVHYQMGLNHFVAARALDNYEFEERRGDDLVV--K
ALD1_STAA8      VKEYENRKD--------DIVQAITDELGAPLSLSERVHYQMGLNHFVAARALDNYEFEERRGDDLVV--K
ALD1_STAA3      VKEYENRKD--------DIVQAITDELGAPLSLSERVHYQMGLNHFVAARALDNYEFEERRGDDLVV--K
AL1B1_HUMAN     ADLVERDRVYLASLETLDNGKPFQESLDEVIK---VYRYFAGWADKWHGKTIPMDG------QHFCFTRH
BETB_ACIBC      VDILRERNDELARLETLDTGKAYETSTVDIVTGADVLEYYAGLATAIQGEQVP------LRESSFFYTRR
BADH_SPIOL      AAKITEKKDHFVKLETIDSGKPFDEAVLDIDDVASCFEYFAGQAEALDGK--QKAPVTLPMERFKSHVLR
ALD1_STAAR      VKEYENRKD--------DIVQAITDELGAPLSLSERVHYQMGLNHFVAARALDNYEFEERRGDDLVV--K
AL1A1_CHICK     ADLVERDRLTLATMEAIDGGKLFSTALGACIKT---IRYCAGWADKIHGRTVPMDG------NFFTFTRH
BETB_ACIBS      VDILRERNDELARLETLDTGKAYETSTVDIVTGADVLEYYAGLATAIQGEQVP------LRESSFFYTRR
ROCA_GEOTN      AAIVRRRKHEFSAWLVKEAGKPWREADADTAEAIDFMEYYGRQMLKLKGIPVESRPGET---NRFFYI--
ROCA_BACCR      AAIVRRRKHEFSAILVKEAGKPWNEADADTAEAIDFMEYYGRQMLKLKGIPVESRPIEY---NRFSYI--
ROCA_BACC4      AAIVRRRKHEFSAILVKEAGKPWNEADADTAEAIDFMEYYGRQMLKLKGIPVESRPIEY---NRFSYI--
ROCA_BACC2      AAIVRRRKHEFSAILVKEAGKPWNEADADTAEAIDFMEYYGRQMLKLKGIPVESRPIEY---NRFSYI--
BETB_RHOS5      SDLIRARNEELSILETLDTGKPLQETVADWPSGADALEFFAGLAPAVTGETVPLG-------QDFVYTIR
AL1L2_HUMAN     ADLLEENQEELATIEALDSGAALKTHIGMSVQT---FRYFAGWCDKIQGSTIPIN--QARPNRNLTFTKK
BETB_YERPY      VDILRDRNDELAAIETADTGKPLSETRSDIVTGADVLEYYAGLIPALEGQQIPLRG------SAFVYTRR
BADH_GADCA      ARIIRERRDNIAKLEVINNGKTITEAEYDIDAAWQCIEYYAGLAPTLSGQHIQGGAF--------AYTRR
ALDH6_YEAST     ADELESQIDLVSSIEALDNGKTLALARGDVTIAINCLRDAAAYADKVNGRTINTGD------GYMNFTTL
ALDH1_MACPR     ADLIERDRLLLATLESINAGKIFASALMDLDYCIKVLRYCAGWADKIQGRTIPVDG------EFFSYTRH
AL1B1_PONAB     ADLVERDRVYLASLETLDNGKPFQESLDEVIK---VYRYFAGWADKWHGKTIPMDG------QHFCFTRH
AL1A1_HORSE     ADLVERDRLILATMESMNGGKLFSNALGGCLKT---LRYCAGWADKIQGRTIPSDG------NFFTYTRH
BETB_RHOSK      SDLIRARNEELSLLETLDTGKPLQETVADWASGADALEFFAGLAPAVTGETVPLG-------QDFVYTIR
BETB_RHOS1      SDLIRARNEELSLLETLDTGKPLQETVADWASGADALEFFAGLAPAVTGETVPLG-------QDFVYTIR
BETB_BRUMB      AEILREKNRKLSKLETLDTGKALQETVXXXXXXXXXLEFFGGIISGFNGEFVELGG-------SFAYTRR
ALDA_STAAW      GDKLMAQKDKIAMIETLNNGKPIRET------TAIDIPFAARHFHYFASVITEEGTVNDIDKDTMSIVRH
ALDA_STAAS      GDKLMAQKDKIAMIETLNNGKPIRET------TAIDIPFAARHFHYFASVITEEGTVNDIDKDTMSIVRH
ALDA_STAAN      GDKLMAQKDKIAMIETLNNGKPIRET------TAIDIPFAARHFHYFASVITEEGTVNDIDKDTMSIVRH
ALDA_STAAM      GDKLMAQKDKIAMIETLNNGKPIRET------TAIDIPFAARHFHYFASVITEEGTVNDIDKDTMSIVRH
ROCA_BACHK      AAIVRRRKHEFSAILVKEAGKPWNEADADTAEAIDFMEYYGRQMLKLKGIPVESRPIEY---NRFSYI--
ROCA_BACCZ      AAIVRRRKHEFSAILVKEAGKPWNEADADTAEAIDFMEYYGRQMLKLKGIPVESRPIEY---NRFSYI--
ROCA_BACCQ      AAIVRRRKHEFSAILVKEAGKPWNEADADTAEAIDFMEYYGRQMLKLKGIPVESRPIEY---NRFSYI--
ROCA_BACC7      AAIVRRRKHEFSAILVKEAGKPWNEADADTAEAIDFMEYYGRQMLKLKGIPVESRPIEY---NRFSYI--
ROCA_BACC3      AAIVRRRKHEFSAILVKEAGKPWNEADADTAEAIDFMEYYGRQMLKLKGIPVESRPIEY---NRFSYI--
ROCA_BACC0      AAIVRRRKHEFSAILVKEAGKPWNEADADTAEAIDFMEYYGRQMLKLKGIPVESRPIEY---NRFSYI--
ROCA_BACAN      AAIVRRRKHEFSAILVKEAGKPWNEADADTAEAIDFMEYYGRQMLKLKGIPVESRPIEY---NRFSYI--
ROCA_BACAH      AAIVRRRKHEFSAILVKEAGKPWNEADADTAEAIDFMEYYGRQMLKLKGIPVESRPIEY---NRFSYI--
ROCA_BACAC      AAIVRRRKHEFSAILVKEAGKPWNEADADTAEAIDFMEYYGRQMLKLKGIPVESRPIEY---NRFSYI--
ROCA_BACAA      AAIVRRRKHEFSAILVKEAGKPWNEADADTAEAIDFMEYYGRQMLKLKGIPVESRPIEY---NRFSYI--
GABD_DEIRA      AELMLERTDELASLITLEMGKLLREAKGEVALAASILNYYGEQGPSF----LEPKTIPVPQGE--AAVLH
ALDH_ENCBU      ADLIEAHRVQLRTLETLDNGKPFAMSLGDTLMAQKVLRYYAGFADKIVGQTIPADG------NVFCYTRH
ALDH2_YEAST     LKLIEEEQDTLAALETLDAGKPYHSAKGDLAQILQLTRYFAGSADKF-----DKGATIPLTFNKFAYTLK
ALDH1_ELEED     ADLIERDRLLLATLESINAGKVFASALMDLDYCIKALRYCAGWADKIQGRTIPVDG------EFFSYTRH
ALDA_STAAR      GDKLMAQKDKIAMIETLNNGKPIRET------TAIDIPFAARHFHYFASVITEEGTVNDIDKDTMSIVRH
ROCA_BACC1      AAIVRRRKHEFSAILVKEAGKPWNEADADTAEAIDFMEYYGRQMLKLKGIPVESRPIEY---NRFSYI--
ALD1_STAAB      VKEYENRKD--------DIVQAITDELGAPLSLSERVHYQMGLNHFVAARALDNYEFEERRGDDLVV--K
BETB_RHOS4      SDLIRAHNEELSLLETLDTGKPLQETVADWASGADALEFFAGLAPVVTGETVPLG-------QDFVYTIR
ALD1_STAES      VKEYQNRKNDLIEAITDEL--GAPLSVSENVHQMGLNHFTAAR------DALDSFQFEEQRGDDLVV--K
ALD1_STAEQ      VKEYQNRKNDLIEAITDEL--GAPLSVSENVHQMGLNHFTAAR------DALDSFQFEEQRGDDLVV--K
AL9A1_HUMAN     --------------------------------------------------------------------RR
ROCA_ANOFW      AAIVRRRKHEFSALLVKEAGKPWKEADADTAEAIDFMEYYARQMLKLKGIPVESRPGET---NRFFYI--
FTHFD_MOUSE     ADLMEQHQEELATIEALDAGAALKTHVGMSIQT---FRYFAGWCDKIQGATIPIN--QARPNRNLTLTKK
BETB_SINMW      -----------------------------------------------------------------AYTKR
ALDH2_RAT       ADLIERDRTYLAALETLDNGKPVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDG------DFFSYTRH
ALDH2_MESAU     ADLIERDRTYLAALETLDNGKPVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDG------DFFSYTRH
ALDA_STAAC      GDKLMAQKDKIAMIETLNNGKPIRET------TAIDIPFAARHFHYFASVITEEGTVNDIDKDTMSIVRH
ALDA_STAAB      GDKLMAQKDKIAMIETLNNGKPIRET------TAIDIPFAARHFHYFASVITEEGTVNDIDKDTMSIVRH
ALDA_STAA8      GDKLMAQKDKIAMIETLNNGKPIRET------TAIDIPFAARHFHYFASVITEEGTVNDIDKDTMSIVRH
ALDA_STAA3      GDKLMAQKDKIAMIETLNNGKPIRET------TAIDIPFAARHFHYFASVITEEGTVNDIDKDTMSIVRH
AL9A1_PONAB     --------------------------------------------------------------------RR
UGA2_YEAST      YNLMLENLDDLATIITLENGKALGEAKGEIKYAASYFEWYAEEAPRLYGATIQ-----PLNPHNRVFTIR
ROCA_BACLD      VAKVRRKKHEFSALLVKEAGKPWNEADADTAEAIDFMEYYARQMIELAGKPVNS---REGERNQYVYT--
ALDH2_MOUSE     ADLIERDRTYLAALETLDNGKPVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDG------DFFSYTRH
AL1B1_MOUSE     ADLVERDRVYLASLETLDNGKPFQESLDEVIK---VYRYFAGWADKWHGKTIPMDG------EHFCFTRH
BETB_BURP8      VDLLRERNDELAELEMRDTGKPIETRAVDIVTGADVIEYYAGLATAIEGQQIP------LRAESFVYTRR
ALDA_STAHJ      SRRIHEKVEHFATIESLQNGKPYRTSTIDVPLTANQFKYFASV------LTTDEGSVNEIDENTMSLVVN
ALDH3_YEAST     LKLIEEEQDTLAALETLDAGKPFHSAKQDLAQIIELTRYYAGAVDKFNM-----GETIPLTFNKFAYTLK
ALDH2_PONAB     ADLIERDRTYLAALETLDNGKPVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDG------DFFSYTRH
A9A1A_DANRE     ------------------------------------IEYYAGIAPTLSGQHIQGGSF--------AYTRR
ALDH2_HUMAN     ADLIERDRTYLAALETLDNGKPVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDG------DFFSYTRH
BETB_VIBHB      VALLRERNDELAALEVADTGKPIQEACVDIATGADVIEYYAGLAPSMHGEQ------QPLNESQFFYTRR
ALDA_STAES      SRRIHEKTEHLATVESLQNGKPYRTSTIDVPQAANQFKYFASV------LTTDEGSVNEIDQNTMSLVVN
ALDA_STAEQ      SRRIHEKTEHLATVESLQNGKPYRTSTIDVPQAANQFKYFASV------LTTDEGSVNEIDQNTMSLVVN
IOLA_BACSU      QQLLSQHKEELAHLITIENGKNTKEALGEVGRGIENVEFAAGAPSLMMGDSLASIATDVEAANY-----R
IOLA_BACNA      QQLLSQHKEELAHLITIENGKNTKEALGEVGRGIENVEFAAGAPSLMMGDSLASIATDVEAANY-----R
FTHFD_XENLA     ADLMEEHQEELATIESIDSGAALKTHVGMSIQT---FRYFAGWCDKIQGRTIPIN--QARPNRNLTFTRR
AL9A1_ORYLA     --------------------KSITEALVDIDVAWQCIEYYAGVAGTLAGQHFQGGAF--------AYTRR
BETB_OCHA4      ADILREKNKKLSKLETLDTGKALQETVXXXXXXXXXLEFFGGIISGFNGEFVELGG-------SFAYTRR
BADH1_ARATH     AAKVNERKTDLAKLEALDCGKPLDEAVWDMDDVAGCFEFYADLAEGL--DAKQKAPVSLPMESFKSYVLK
ROCA_GEOKA      AAIVRRRKHEFSAWLVKEAGKPWREADADTAEAIDFMEYYGRQMLKLKGIPVESRPGET---NRFFYI--
AL9A1_BOVIN     --------------------KSIFEARWDIDTSWQCLEYYAGLAGSMAGEHIQGGSF--------GYTRR
FTHFD_PONAB     ADLMEQHQEELATIEALDAGAALKTHVGMSIQT---FRYFAGWCDKIQGSTIPIN--QARPNRNLTLTRK
BETB_PSEPK      VDILRERNDELAMLETLDTGKSYETRYVDIVTGADVLEYYAGLVPAIEGEQIP------LRESSFVYTRR
BETB_PSEP1      VDILRERNDELAMLETLDTGKSYETRYVDIVTGADVLEYYAGLVPAIEGEQIP------LRESSFVYTRR
ALDH_ALTAL      ADLFEKNADLIAAVEALDNGKAFSMAKNDVPAAAGCLRYYGGWADKIEGKVVD------TAPDSFNYIRK
AL2C4_ARATH     ADLIEENIEELAKLDAVDGGKLFQLGYADIPATAGHFRYNAGAADKIHGETLK-----MTRQSLFGYTLK
IOLA_BACA2      QQLLQQNKEELARLITLENGKNTTEALGEVGRGIENVEFAAGAPSLMMGDSLASIATDVEAANY-----R
BETB_RHISN      ------------------------------------------------------GGIAAAALNDFAYTKR
BETB_RHILW      -----------------------------------------------------------------AYTKR
BETB_PSEPW      VDILRERNDELAMLETLDTGKSYETRYVDIVTGADVLEYYAGLVPAIEGEQIP------LRESSFVYTRR
BADH_ATRHO      AAKITEKKDKLETLDSGKPRDEAVLDIDDVATCFEYFEYFAGQAEAL--DAKQKAPVTLPMERFKSHVLR
AL1L2_MOUSE     ADLMEENQEELATIEALDSGAALKTHIGMSVQT---FRYFAGWCDKIQGSTIPIN--QARPNYNLTFTKK
BETB_RHIL3      -----------------------------------------------------------------AYTKR
BETB_PSEPG      VDILRERNDELAQLETLDTGKSYETRYVDIVTGADVLEYYAGLVPAIEGEQIP------LRESSFVYTRR
BETB_PSEPF      VDILRERNDELAALETLDTGKAFETKYVDIVTGADVLEYYAGLVPAIEGEQIP------LRDTSFVYTRR
ALDA_ECOLI      SAGIRERASEISALIVEEGGKIQQLAEVEVAFTADYIDYMAEWARRYEGEIIQS---DRPGENILLFKRA
BETB_BURM1      VELLRERNDELAALETRDTGKPIAETLADIVTGADVIEYYAGLATAIEGLQVP------LRADSFVYTRR
ROCA2_BACSU     AAKVRRRKHEFSALLVKEAGKPWNEADADTAEAIDFMEYYARQMIELAGKPVNS---REGEKNQYVYT--
IOLA2_BACLD     QQLLTQHKEELAHLITIENGKNTKEALGEVGRGIENVEFAAGAPSLMMGDSLATIATDVEAANY-----R
BETB_RHILO      --------------------------VADAPSAADCLEYFGGAVAAYNGEAVDLGG-------PFAYTRR
BETB_PSEF5      VEILRERNDELAALETLDTGKAFETKYVDIVTGADVLEYYAGLVPAIEGEQIP------LRTTSFVYTRR
AL2B7_ARATH     ADLIEKHNDEIAALETWDNGKPYESAQIEVPMLARVFRYYAGWADKIHGMTMPGDGPHHVQ------TLH
XYLC_PSEPU      --------------------------------------------------------FPSAVPGRMNLCQR
BETB_BURCH      VELLRERNDELAAIETRDTGKPIGETLADIVTGADVIEYYAGLATAIEGLQVP------LRAESFVYTRR
BETB_BURCA      VELLRERNDELAAIETRDTGKPIGETLADIVTGADVIEYYAGLATAIEGLQVP------LRAESFVYTRR
BETB1_RHIME     -----------------------------------------------------------------AYTKR
BADH_AMAHP      AAKITEKKDYFAKLEAMDCGKPLDEAARDIDDVAGCFEYYADQAEAL--DAKQKAPIALPMDTFKCHVLK
ALDH2_BOVIN     ADLIERDRTYLAALETLDNGKPIISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDG------DYFSYTRH
IOLA1_OCEIH     WKLLQDNKEELAKIITLENGKSLRDAQGEVQRGIEVVELATS-----TPSMMMGDALPSIAKGIDGSIWR
IOLA1_BACSK     QQLLQRDKEELARLITIENGKNLTEARGEVQRGIENVEFAAGAPSLMMGDSLPMIATDVEASNY-----R
BETB_BURCC      VDLLRERNDELAAIETRDTGKPIGETLADIVTGADVIEYYAGLATAIEGLQVP------LRAESFVYTRR
ABDH_ERWCT      ADAIEENAEVFAKLESLNCGKPYHAVLNEVPAVADVFRFFAGAARCLSGSAA-GEYLEGHT----SMIRR
BETB_SERP5      VDILRERNDELAALETLDTGKAMSETTADIVTGADVLEYYAGLIPSIEGQQIP------LRDTSFVYTRR
FTHFD_HUMAN     ADLMEQHQEELATIEALDAGAALKTHVGMSIQT---FRYFAGWCDKIQGSTIPIN--QARPNRNLTLTRK
BETB_RHIEC      -----------------------------------------------------------------AYTKR
BETB_PSEE4      VDILRERNDELAMLETLDTGKSYETRYVDIVTGADVLEYYAGLVPAIEGEQIP------LRESSFVYTRR
IOLA_LISMF      QQLLIQHKEKLARLITLENGKNLSEARGEVQRGIENVEFAAGAPTLMMGDSLASIATDVEAANY-----R
BETB_RHIE6      -----------------------------------------------------------------AYTKR
BETB_BURS3      VDLLRERNDELAALETRDTGKPIGETLADIVTGADVIEYYAGLATAIEGLQVP------LRAESFVYTRR
BETB_BURCJ      VDLLRERNDELAAIETRDTGKPIGETLADIVTGADVIEYYAGLATAIEGLQVP------LRAESFVYTRR
BETB_AGRT5      ADIMRERNDALSTLETLDTGKPIQETIADPTSGADAFEFFGG----IAPSALNGDYIPLGGD--FAYTKR
SSDH_MOUSE      YDLMIQNKDDLAKIITAESGKPLKEAQGEILYSALFLEWFSEEARRIYGDIIY-----TSAKDKRGLVLK
BETB_PSE14      VDILRERNDELAALETLDTGKAIETRYVDIVTGADVLEYYAGLVPAIEGEQIP------LRDSSFVYTRR
ROCA_STAS1      AAIIRRRKEEISAVMVYEAGKPWDEAVGDAAEGIDFIEYYARSMMELADPVLDREG----EHNKYFY---
ALDH2_PIG       ADLIERDRTYLAALETLDNGKPVISYLVDLDMVLKCLRYYAGWADKYHGKTLPIDG------DYFSYTRH
ABDH_PECCP      ADAIEENAEAFARLESLNCGKPYHAALNEVPAVADVFRFFAGAARCLSGSAA-GEYLEGHT----SMIRR
IOLA_LISMC      QQLLIQHKEELARLITLENGKNLSEARGEVQRGIENVEFAAGAPTLMMGDSLASIATDVEAANY-----R
BETB_YERP3      VDILRDRNDELAAIETADTGKPLSETRSDIVTGADVLEYYAGLIPALEGQQIPLRG------SAFVYTRR
ALD1_STAS1      VQEYKNRKE--------DLIQAITDELGAPLSVAENVHYQMGDHFEAARDALNDFQFEERRGDDLVV--K
AL8A1_HUMAN     ADLLEQSLEEFAQAESKDQGKTLALA-----RTMDIPR--SVQNFRFFASSSLHHTSECTQMDHLGCMHR
IOLA1_GEOKA     HHLLNQHHEELAELVVQENGKAYKEAYGEIQRGIECVEFAAGAPTLLMGESLSNIAEEIDSE-----MFR
BETB_PSEU2      VDILRERNDELAALETLDTGKAIETRYVDIVTGADVLEYYAGLVPAIEGEQIP------LRDSSFVYTRR
IOLA_LISIN      QQLLIQHKEELARLITLENGKNLSEARGEVQRGIENVEFAAGAPTLMMGDSLASIATDVEAANY-----R
IOLA3_BACCZ     QQLLVDNWEDLAKLITIENGKSYNEAYGEVLRGIECVEFAAGAPTLMMGKQLPATGIESG-------MYR
BETB_BACSU      XXXXXXXXXXXXXXXXXXTGKTLEESKADMDDIANVFQYYA-------GLADKDGGXXXXXXXXXXXXXR
ALDH4_BACSU     ADLMEEHKTELAQLETLDNGKPINETTGDIPLAIEHMRYYAGWCTKITGQTIPVSGAY------FNYTRH
BETB_BURVG      VDLLRERNDELAAIETRDTGKPIGETLADIVTGADVIEYYAGLATAIEGLQVP------LRAESFVYTRR
FTHFD_RAT       ADVMEQHQEELATIEALDYTLALKTHVGMSIQT---FRYFAGWCDKIQGATIPIN--QARPNRNLTLTKK
BETB_YERPP      VDILRDRNDELAAIETADTGKPLSETRSDIVTGADVLEYYAGLIPALEGQQIPLRG------SAFVYTRR
BETB_YERPN      VDILRDRNDELAAIETADTGKPLSETRSDIVTGADVLEYYAGLIPALEGQQIPLRG------SAFVYTRR
BETB_YERPE      VDILRDRNDELAAIETADTGKPLSETRSDIVTGADVLEYYAGLIPALEGQQIPLRG------SAFVYTRR
BETB_YERPB      VDILRDRNDELAAIETADTGKPLSETRSDIVTGADVLEYYAGLIPALEGQQIPLRG------SAFVYTRR
BETB_YERPA      VDILRDRNDELAAIETADTGKPLSETRSDIVTGADVLEYYAGLIPALEGQQIPLRG------SAFVYTRR
BETB_PSEU5      VDLLRERNDELALLETLDTGKPLSETRSDIITGADVLEYYAGLAPAIEGEQIP------LRDSSFVYTRR
IOLA_LISMO      QQLLIQHKEELARLITLENGKNLSEARGEVQRGIENVEFAAGAPTLMMGDSLASIATDVEAANY-----R
IOLA2_BACCZ     QQLLVDNWEELAKLITIENGKSYNEAYGEVLRGIECVEFAAGAPTLMMGKQLPATGIESG-------MYR
IOLA2_BACAH     QQLLVDNWEELAKLITIENGKSYNEAYGEVLRGIECVEFAAGAPTLMMGKQLPATGIESG-------MYR
BETB_PSESM      VDILRERNDELAALETLDTGKAIETRYVDIVTGADVLEYYAGLVPAIEGEQIP------LRDSSFVYTRR
AL1B1_BOVIN     ADLVERDCVYLASLESLDNGKPFQESLDEVIK---VYRYFAGWADKWHGKTIPMDG------EHFCFTRH
IOLA_LISMH      QQLLIQHKEELARLITLENGKNLSEARGEVQRGIENVEFAAGAPTLMMGDSLASIATDVEAANY-----R
AL2B4_ARATH     ADLVEKHSEELASLETWDNGKPYQQSLAEIPMFARLFRYYAGWADKIHGLTIPADG------NYQVHTLH
ROCA_OCEIH      AAIVRRRKHEFSAWLSYDAGKPWDQADGDTAEGIDFLEYYARHMVEL-----EKGKPLADRPNEDNKYFY
BETB_YERPS      VDILRDRNDELAAIETADTGKPLSETRSDIVTGADVLEYYAGLIPALEGQQIPLRG------SAFVYTRR
IOLA2_BACHK     QQLLVDNWEELAKLITIENGKSYNEAYGEVLRGIECVEFAAGAPTLMMGKQLPATGIESG-------MYR
AL8A1_MOUSE     ---------------------------------------------------------------------R
AL1A7_RAT       ADLMERDRVLLATMESMNAGKIFTHALLDTEVSIKALKYFAGWADKIHGQTIPSDG------DVFTYTRR
IOLA2_BACAN     QQLLVDNWEELAKLITIENGKSYNEAYGEVLRGIECVEFAAGAPTLMMGKQLPATGIESG-------MYR
GABD1_MYCUA     ADLIEAEADQTAALMTLEMGKTIASAKAEVLKSAKGFRYYXXXXXXXXXXXXXXXGKVGASQ---AYTRY
GABD2_MYCS2     RDLVAKNRDFLMDVAQAETGKARSAAQEEIVDMMLNARYYARQAVKLLAPKRVQGLLPGVVKT---VVNH
BETB_CHRSD      VALLRERNDELAELETRNTGKPIETASVDIVTGADALEYYAGLAPAIEGSQIP------LRDTRLVYTRR
AL8A1_BOVIN     ---------------------------------------------------------------------R
BETB_ERWCT      VDILRERNDELALLETHDTGKPLETRTVDIVTGADVLEYYAGLIPMLEGQQIP------LRDTSFVYTRR
ALDH2_LEITA     ADILEKNSKEMAALESLDNGKPYEVALNDVALSVECFRYCAGLADKVNGTVPPRSG------NFLGIVKR
BETB_VIBSL      VEILRARNNDLANLEVVDTGKPLQEAIEDVASGADVIEYFAGLAPTLQGDQ------QPLSDTQFFYTRR
BETB_ECOLC      VDILRERNDELAKLETLDTGKAYETSTVDIVTGADVLEYYAGLIPALEGSQIP------LRETSFVYTRR
BETB_VIBVU      AQLIRDHNDELAELEVRDTGKPIQASVVDIATGADVIEYFA---GLVNGL---GGEQQSLGSNQFFYTRR
BETB_STRMK      VEILRERNDELAHLETLDTGKALETTTVDIVTGADVVEYYAGLATAIEGIQLP------LRESSFFYTRR
BETB_STRM5      VEILRERNDELAHLETLDTGKALETTTVDIVTGADVVEYYAGLATAIEGIQLP------LRESSFFYTRR
BETB_ECOLI      VDILRERNDELAKLETLDTGKAYETSTVDIVTGADVLEYYAGLIPALEGSQIP------LRETSFVYTRR
BETB_ECODH      VDILRERNDELAKLETLDTGKAYETSTVDIVTGADVLEYYAGLIPALEGSQIP------LRETSFVYTRR
BETB_BURP1      VELLRERNDALAELEMRDTGKPIETRAVDIVTGADVIEYYAGLATAIEGLQVP------LRPESFVYTRR
BETB_BURP0      VELLRERNDALAELEMRDTGKPIETRAVDIVTGADVIEYYAGLATAIEGLQVP------LRPESFVYTRR
IOLA_BACCN      LQLLQENKDELSKIITLENGKTLKDASGEVQRGIEAVELATSAPNLMMGQALPNGGIDGS-------IWR
BETB_ECOHS      VDILRERNDELAKLETLDTGKAYETSTVDIVTGADVLEYYAGLIPALEGSQIP------LRETSFVYTRR
BETB_BURPS      VELLRERNDALAELEMRDTGKPIETRAVDIVTGADVIEYYAGLATAIEGLQVP------LRPESFVYTRR
BETB_ECO55      VDILRERNDELAKLETLDTGKAYETSTVDIVTGADVLEYYAGLIPALEGSQIP------LRETSFVYTRR
BETB_ECO24      VDILRERNDELAKLETLDTGKAYETSTVDIVTGADVLEYYAGLIPSLEGSQIP------LRETSFVYTRR
IOLA1_GEOTN     QQLLVEHWEELARLVTLENGKSYNEAYGEIQRGIECVEFAAGAPTLMMGRQLPSTGIESG-------MYR
BETB_VIBVY      AQLIRDHNDELAELEVRDTGKPIQASVVDIATGADVIEYFA---GLVNGL---GGEQQSLGSNQFFYTRR
BETB_ECO8A      VDILRERNDELAKLETLDTGKAYETSTVDIVTGADVLEYYAGLIPALEGSQIP------LRETLFVYTRR
BETB_BURMS      VELLRERNDALAELEMRDTGKPIETRAVDIVTGADVIEYYAGLATAIEGLQVP------LRPESFVYTRR
BETB_BURMA      VELLRERNDALAELEMRDTGKPIETRAVDIVTGADVIEYYAGLATAIEGLQVP------LRPESFVYTRR
BETB_BURM9      VELLRERNDALAELEMRDTGKPIETRAVDIVTGADVIEYYAGLATAIEGLQVP------LRPESFVYTRR
BETB_BURM7      VELLRERNDALAELEMRDTGKPIETRAVDIVTGADVIEYYAGLATAIEGLQVP------LRPESFVYTRR
BADH_BETVU      AAKVTERKDHFVKLETIDSGKPFDEAVLDIDDVATCFEYFAGQAEAM--DAKQKAPVTLPMERFKSHVLR
IOLA1_BACWK     LQLLQENKEELAKIITLENGKTLTDATGEVQRGIEAVELATSAPNLMMGQALPNSGIDGS-------IWR
CROM_ENTDO      ADLFERDIAYLSSLETLNTGKPYKSAYQDIVHCIQVLRYYAGWADKNMGQNIPVDG------DFFSFTKH
BETB_ECO5E      VDILRERNDELAKLETLDTGKAYETSTVDIVTGADVLEYYAGLIPSLEGSQIP------LRETSFVYTRR
BETB_ECO57      VDILRERNDELAKLETLDTGKAYETSTVDIVTGADVLEYYAGLIPSLEGSQIP------LRETSFVYTRR
IOLA1_BACHK     LQLLQENKEELAKIITLENGKTLTDATGEVQRGIEAVELATSAPNLMMGQALPNSGIDGS-------IWR
IOLA1_BACCZ     LQLLQENKEELAKIITLENGKTLTDATGEVQRGIEAVELATSTPNLMMGQALPNSGIDGS-------IWR
IOLA1_BACAN     LQLLQENKEELAKIITLENGKTLTDATGEVQRGIEAVELATSAPNLMMGQALPNSGIDGS-------IWR
IOLA1_BACAH     LQLLQENKEELAKIITLENGKTLTDATGEVQRGIEAVELATSTPNLMMGQALPNSGIDGS-------IWR
BETB_MARMS      XXXXXXXXXXXXXXXVLDTGKPLQEAIVVDIQTADVIEYYAGLTDKIQGDYQDLGN------GNFFYTRR
BETB_KLEP3      VDLLRQRNDELARLETLDTGKPLETAAVDIVTGADVLEYYAG-----LIPALEGSQIPLRDSS-FVYTRR
BETB_BURP6      VELLRERNNALAELEMRDTGKPIETRAVDIVTGADVIEYYAGLATAIEGLQVP------LRPESFVYTRR
IOLA_BACCQ      LQLLQENKEELAKIITLENGKTLTDATGEVQRGIEAVELATSTPNLMMGQALPNSGIDGS-------IWR
IOLA_BACC7      LQLLQENKEELAKIITLENGKTLTDATGEVQRGIEAVELATSTPNLMMGQALPNSGIDGS-------IWR
GABD1_MYCPA     -----------------EMGKTLKSAKAEALKCAKGFRYYAQNAEQLLADEPADAGKVGAAR---AYIRY
GABD1_MYCA1     -----------------EMGKTLKSAKAEALKCAKGFRYYAQNAEQLLADEPADAGKVGAAR---AYIRY
BETB_SHIF8      VDILRERNDELAKLETLDTGKAYETSTVDIVTGADVLEYYAGLIPALEGSQIP------LRETSFVYTRR
IOLA_BACC4      LQLLQENKDELAKIITLENGKTLTDATGEVQRGIEAVELATSTPNLMMGQALPNSGIDGS-------IWR
IOLA_BACC2      LQLLQENKDELAKIITLENGKTLTDATGEVQRGIEAVELATSAPNLMMGQALPNSGIDGS-------IWR
IOLA_BACC1      LQLLQENKEELAKIITLENGKTLTDATGEVQRGIEAVELATSTPNLMMGQALPNSGIDGS-------IWR
SSDH2_SCHPO     AELIMENKDDLVKMLTLENGKPLSQAEMEVTTCSGYLKWYAAEAVRTFGDVAPSS---LQSQNFLISIK-
IOLA_BACCR      LQLLQENKDELAKIITLENGKTLTDATGEVQRGIEAVELATSTPNLMMGQALPNSGIDGS-------IWR
IOLA2_GEOKA     QQLLVEHWEELARLVTLENGKSYNEAYGEVQRGIECVEFAAGAPTLMMGRQLPATGIESG-------MYR
BETB_ECOL6      VDILRERNDELAKLETLDTGKAYETSTVDIVTGADVLEYYAGLIPALEGSQIP------LRETSFVYTRR
BETB_ECOL5      VDILRERNDELAKLETLDTGKAYETSTVDIVTGADVLEYYAGLIPSLEGSQIP------LRETSFVYTRR
BADH_SCHPO      AKMMREKRELLAGIDTINCGKPTPYALFDIDSCADMFEYYAEDNPTVKVPLPNNPGFCAFEK-------R
SSDH_HYLLA      YNLMIQNKDDLARIITAESGKPLKEAHGEILYSAFFLEWFSEEARRVYGDIIY-----TPAKDRRALVLK
IOLA_BACHD      QQLLVENWEELARLVTLENGKSYKEAYGEVQRGIECVEFAAGAPSLMMGKQLPD-----IATNIESGMYR
IOLA2_GEOTN     QQLLVEHWEELARLVTLENGKVYEDAYGEVQRGIECVEFAAGIPTLMMGQQLPATGIESG-------MYR
BETB_ECOSE      VDILRERNDELAKLETLDTGKAYETSTVDIVTGADVLEYYAGLIPALEGSQIP------LRETLFVYTRR
ALDHY_YEAST     ADLIERDRDILAAIEHLDNGKPFEAYLLDLASVLKELRYTAGWADKLHGTLRFAITIPTFQDLRLRYTRH
IOLA3_GEOKA     QQLLVEHWDELARLVTLENGKVYEDAYGEVQRGIECVEFAAGIPTLMMGQQLPDIATDIESG-----MYR
SSDH_PANPA      YNLMIQNKDDLARIITAESGKPLKEAHGEILYSAFFLEWFSEEARRVYGDIIY-----TPAKDRRALVLK
SSDH_GORGO      YNLMIQNKDDLARIITAESGKPLKEAHGEILYSAFFLEWFSEEARRVYGDIIY-----TPAKDRRALVLK
CROM_OMMSL      ADLMERDIAYMASLETMDTGKPYKNSYQDMVHCIQVLRYFAGWADKNMGESIPVDG------DFFCYTRN
BETB_ECOSM      VDILRERNDELAKLETLDTGKAYETSTVDIVTGADVLEYYAGLIPALEGSQIP------LRETSFVYTRR
BADH2_ARATH     AAKVIERKSELANLEAIDCGKPLDEAAWDMDDVAGCFEYYADLAE----------GLDAKQKTPLSLILK
SSDH_HUMAN      YNLMIQNKDDLARIITAESGKPLKEAHGEILYSAFFLEWFSEEARRVYGDIIH-----TPAKDRRALVLK
BETB_ECOLU      VDILRERNNELAKLETLDTGKAYETSTVDIVTGADVLEYYAGLIPSLEGSQIP------LRETSFVYTRR
BETB_AGRRK      ------------------------------------------------------GGIAAAGLNDFAYTKR
SSDH_PONPY      YXLMIXNKDDLARIITAESGKPLKEAHGEILYSAFFLEWFSEEARRVYGDIIY-----TPAKDRRALVLK
GABD_RHISN      HRFILEHSDDLAAILTAEMGKPLGEAKSEVQHAAAYLQWYAEEANRIYGETIS-----APSTDRRMLVIK
ASTD_NOVAD      ANEVRKDADNLATMISRETGKPLWEARTEVDSVVNKVEYADRTSQRKLDSALQG----------TAALRH
SSDH_PANTR      YNLMIQNKDDLARIITAESGKPLKEAHGEILYSAFFLEWFSEEARRVYGDIIY-----TPAKDRRALVLK
ROCA_STAES      -------KEEISAIMVYEAGKPWDEAVGDAAEGIDFIEYYARSMMELAD-----GKPVLDREGEHNRYFY
ROCA_STAEQ      -------KEEISAIMVYEAGKPWDEAVGDAAEGIDFIEYYARSMMELAD-----GKPVLDREGEHNRYFY
BETB_ECO7I      VDILRERNDELAKLETLDTGKAYETSTVDIVTGADVLEYYAGLIPALEGSQIP------LRETSFVYTRH
BETB_ECO45      VDILRERNDELAKLETLDTGKAYETSTVDIVTGADVLEYYAGLIPALEGSQIP------LRETSFVYTRR
BETB_ECO27      VDILRERNDELAKLETLDTGKAYETSTVDIVTGADVLEYYAGLIPALEGCQIP------LRETSFVYTRR
ROCA_BACP2      AANIRRKKHEYSALLVKEAGKPWNEADADTAEAIDFLEYYARQMLELAGKPVNS---REGEHNQYVYT--
AL7A1_HUMAN     GDALREKIQVLGSLVSLEMGKILVEGVGEVQEYVDICDYA------VGLSRMIGGPILPSERSGHALIEQ
ALDH2_HORSE     ADLIERDRTYLAALETLDNGKPVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDG------DFFSYTRH
DMPC_PSEUF      AGITAREAECLDTGKPKSLASHI-----DIPRGAANFKVFADLLKNVATEAFEMATPDGSGAINYAV--R
IOLA2_BACWK     QQLLIENWEGLAKLVTLENGKSYKEAYGEVQRGIECVEFAAGAPTLMMGEQLPATGVESG-------MYR
AMNC_PSESP      ANEMERRQQDFGKPLSMAATIDIPRGIANFRNFADILATAPVDSHRLD---LPDGAYA------LNYAAR
AL221_ARATH     LKYIIEHQELICEVSSRDTGKTVDASLGEIMTTCEKITWLLSEGERWLKPESRSSG--RAMLHKVSRVEF
HPCC_ECOLX      GDLIDQNVPEIAAMETADTGLPIHQTKNVLIRASHNFEFFAE-----VCQQMNGKTYPVDDK-MLNYTLV
AL8A1_DANRE     ADLIEARLEEFVQAESKDQGKTITFARNDIPRSAYNFRFFASSVLHHTNDCSQMDHMGC-----LNYTIR
BADH_ORYSJ      --------------------KPLDEAAGDMEDVAACFEYYADLAEALDGK--QRAPISLPMENFESYVLK
YOSF_SCHPO      KENIIRNQDKYAEIACKDTGKTVDAAFGEILVTLEKINWTLANGEQSLRPTKRPNSLLTSYKG--GYVKY
GABD2_MYCUA     RDLVIENREFLMDLLQAEAGKARWAAQEEVVDLVANANYYA----RVSAGLLKPRTVQALLPGGKTTVGY
ROCA1_BACHD     AAIIRRRKHEFSAWLVHEAGKPWKEADADTAEAIDFLEYYARQMIELNR------GKEILSRNRYFYT--
ABDH_SERP5      ADLIDSHAETFARLESINCGKPYHCVLNELPGVADVFRFFAGASRCLSGLA--AGEYLAGHTS---MIRR
ROCA_STAHJ      -------KEEISAVMVYEAGKPWDEAVGDAAEGIDFIEYYARSMMELADPVLDREG----EHNKYFY---
IOLA_LACCA      QQLLVEHQEELGRIVTEENGKSLDEAVAEVGRGIENVEFAAGVPTLMMGDSLSSVATDVEATNY-----R
SSDH1_SCHPO     YDLIMENADDLATMMTLENGKALGDAKGEVVYAAKFIDWFAGEALRISGDS----SMSSNPQNRIITIK-
MMSA_BOVIN      QQLIKENLKEIARLIMLEQGKTLADAEGDVFRGLQVVEHACSVTSLMLGDTMP-----SITKDMDLYSYR
ROCA_BACSU      AAILRRRKHEFSSYLVKEAGKPWKEADADTAEAIDFLEFYARQMLKLK----EGAPVKSRA-GEVNQYHY
IOLA2_BACSK     LEQLKKNREQLAQLITLENGKTIKDARGEVQRGIECVELATSTPTMMMGDALPASGIDGS-------IWR
GABD_SYNY3      ADILEQRRDEWAALMTLEMGKSIPQAIAEVNKCALVCRFYADKAEEYLADEV------VTTDASQSFIAY
YNEI_ECOLI      GKALRARSEEMAQMITREMGKPINQARAEVAKSANLCDWYAEHGPAMLKAE------PTLVENQQAVIEY
ROCA_STAAW      ----------------------------------------------------------------------
ROCA_STAAT      ----------------------------------------------------------------------
ROCA_STAAS      ----------------------------------------------------------------------
ROCA_STAAR      ----------------------------------------------------------------------
ROCA_STAAN      ----------------------------------------------------------------------
ROCA_STAAM      ----------------------------------------------------------------------
ROCA_STAAE      ----------------------------------------------------------------------
ROCA_STAAC      ----------------------------------------------------------------------
ROCA_STAAB      ----------------------------------------------------------------------
ROCA_STAA9      ----------------------------------------------------------------------
ROCA_STAA8      ----------------------------------------------------------------------
ROCA_STAA3      ----------------------------------------------------------------------
ROCA_STAA2      ----------------------------------------------------------------------
ROCA_STAA1      ----------------------------------------------------------------------
IOLA2_OCEIH     QQLLVEHWEELAKLITLENGKNYAEAYGEVQRGIENVEFATGAPSLMMGEQLASIATELESG-----VYR
MMSA_PSEAE      QALLKEHHDELAKIVSSELGKTFEDAKGDVWRGIEVVEHACNVPSLLMGETVEN-----VARNIDTYSIT
IOLA_BACP2      QQLLVDKWDELAELVTMENGKSITEAKGEVQRGIECVEFAAGAPTLMMGKQLPASGLESG-------MYR
AL7A1_BOVIN     GDALREKIQVLGSLVSLEMGKILVEGVGEVQEYVDVCDYA------VGLSRMIGGPILPSERPGHALIEQ
MMSA_MOUSE      QQLIKENLKEIARLITLEQGKTLADAEGDVFRGLQVVEHACSVTSLMLGETMP-----SITKDMDLYSYR
ASTD_VIBHB      AEKVKENSEKIAEVIAKETGKPIWETRTEAAAMAGKIAISIRAYHDRTGEATR----EAAGNQ--IVLRH
BETB_XANCB      VALLRERNDALAELETLNTGKPLSETRSDIVTGADVLEYYAGVAQALQGVQVEGSFF---------YTRH
BETB_XANC8      VALLRERNDALAELETLNTGKPLSETRSDIVTGADVLEYYAGVAQALQGVQVEGSFF---------YTRH
MMSA_RAT        QQLIKENLKEIARLITLEQGKTLADAEGDVFRGLQVVEHACSVTSLMLGETMP-----SITKDMDLYSYR
MMSA_HUMAN      QQLIKENLKEIAKLITLEQGKTLADAEGDVFRGLQVVEHACSVTSLMMGETMP-----SITKDMDLYSYR
BETB_XANCP      VALLRERNDALAELETLNTGKPLSETRSDIVTGADVLEYYAGVAQALQGVQVEGSFF---------YTRH
GABD2_MYCTU     RDLVIENREFLMDLLQAEAGKARWAAQEEIVDLIANANYYARVCVDLLKPRKAQPLLPGIGKTTVCY---
GABD2_MYCTA     RDLVIENREFLMDLLQAEAGKARWAAQEEIVDLIANANYYARVCVDLLKPRKAQPLLPGIGKTTVCY---
GABD2_MYCBP     RDLVIENREFLMDLLQAEAGKARWAAQEEIVDLIANANYYARVCVDLLKPRKAQPLLPGIGKTTVCY---
GABD2_MYCBO     RDLVIENREFLMDLLQAEAGKARWAAQEEIVDLIANANYYARVCVDLLKPRKAQPLLPGIGKTTVCY---
ASTD_VIBPA      AEKVKENSEKIAEVIAKETGKPIWETRTEAAAMAGKIAISIRAYHDRTGEATR----EAAGNQ--IVLRH
AL7A1_MOUSE     GDAFREKIQLLGRLVSLEMGKILVEGIGEVQEYVDVCDYAAGLSRMIGGPTLP-----SERPGHALIEMW
BADH_HORVU      -------------------------------------------------------------------VLK
ASTD_CHRSD      RECLETHREHLATAIAQETGKPLWEARTEVGAMIGKVAISITAYHERTGERARDIG------DARAVLRH
ASTD_IDILO      SELLEENKEHLARTMAKETGKPVRTEVGAMMGKVAISERAYHERTGTVENDMPGAK---------AFIRH
ASTD_BURM1      AALLNERKEALAAAIGRETGKPLWEARTEVAAMAAKVGISIQAYQERTGEKRQD------MADGVAVLRH
IOLA1_BACLD     -------------IITTENGKTLKDARGEVQRGIEVVELATATPTLMMGESLPAGGIDGS-------IWR
ASTD_VIBSL      AEKVKENSEEIAQIIAKETGKPIWETRTEAGAMAGKIAISIRAYHERTGEASR----EAAGNQ--IVLRH
ABDH_SALTY      ADSIEQNALEFARLESQNCGKPLHCVINEIPAIVDVFRFFAGAARCLSGLAA-GEYLEGHT----SMIRR
ABDH_ECOLU      ADVIEENGQVFAELESRNCGKPLHSAFNEIPAIVDVFRFFAGAARCLNGLAA-GEYLEGHT----SMIRR
ABDH_SHIF8      ADVIEENGQVFAELESRNCGKPLHSAFNEIPAIVDVFRFFAGAARCLNGLAA-GEYLEGHT----SMIRR
AL7A1_MALDO     GDALREKLQHLGKLVSLEMGKILAEGIGEVQEVIYMCDFAVGLSRQLNGSIIP-----SERPDHMMFEVW
ABDH_SHIFL      ADVIEENGQVFAELESRNCGKPLHSAFNEIPAIVDVFRFFAGAARCLNGLAA-GEYLEGHT----SMIRR
BETB_XANC5      VALLRERNDALAELETLNTGKPLSETRSDVVTGADVLEYXXXXXXXXXXPLREGSFF---------YTRH
ABDH_ESCF3      ADVIEENGQVFAELESRNCGKPLHSAFNEIPAIVDVFRFFAGAARCLNGLAA-GEYLEGHT----SMIRR
ABDH_ECOUT      ADVIEENGQVFAELESRNCGKPLHSAFNEIPAIVDVFRFFAGAARCLNGLAA-GEYLEGHT----SMIRR
ABDH_ECOSE      ADVIEENGQVFAELESRNCGKPLHSAFNEIPAIVDVFRFFAGAARCLNGLAA-GEYLEGHT----SMIRR
ABDH_ECOLI      ADVIEENGQVFAELESRNCGKPLHSAFNEIPAIVDVFRFFAGAARCLNGLAA-GEYLEGHT----SMIRR
ABDH_ECOL6      ADVIEENGQVFAELESRNCGKPLHSAFNEIPAIVDVFRFFAGAARCLNGLAA-GEYLEGHT----SMIRR
ABDH_ECOL5      ADVIEENGQVFAELESRNCGKPLHSAFNEIPAIVDVFRFFAGAARCLNGLAA-GEYLEGHT----SMIRR
ABDH_ECOK1      ADVIEENGQVFAELESRNCGKPLHSAFNEIPAIVDVFRFFAGAARCLNGLAA-GEYLEGHT----SMIRR
ABDH_ECODH      ADVIEENGQVFAELESRNCGKPLHSAFNEIPAIVDVFRFFAGAARCLNGLAA-GEYLEGHT----SMIRR
ABDH_ECOBW      ADVIEENGQVFAELESRNCGKPLHSAFNEIPAIVDVFRFFAGAARCLNGLAA-GEYLEGHT----SMIRR
ABDH_ECO8A      ADVIEENGQVFAELESRNCGKPLHSAFNEIPAIVDVFRFFAGAARCLNGLAA-GEYLEGHT----SMIRR
ABDH_ECO81      ADVIEENGQVFAELESRNCGKPLHSAFNEIPAIVDVFRFFAGAARCLNGLAA-GEYLEGHT----SMIRR
ABDH_ECO45      ADVIEENGQVFAELESRNCGKPLHSAFNEIPAIVDVFRFFAGAARCLNGLAA-GEYLEGHT----SMIRR
ABDH_ECO27      ADVIEENGQVFAELESRNCGKPLHSAFNEIPAIVDVFRFFAGAARCLNGLAA-GEYLEGHT----SMIRR
ABDH_ECO24      ADVIEENGQVFAELESRNCGKPLHSAFNEIPAIVDVFRFFAGAARCLNGLAA-GEYLEGHT----SMIRR
ASTD_BURCH      AALLTERKEAIATAIGRETGKPLWEARTEVASMAAKVGISIQAYQERTGEKRQD------MADGVAVLRH
ASTD_BURCA      AALLTERKEAIATAIGRETGKPLWEARTEVASMAAKVGISIQAYQERTGEKRQD------MADGVAVLRH
ABDH_SHISS      ADVIEENGQVFAELESRNCGKPLHSAFNEIPAIVDVFRFFAGAARCLNGLAA-GEYLEGHT----SMIRR
ABDH_ECOSM      ADVIEENGQVFAELESRNCGKPLHSAFNEIPAIVDVFRFFAGAARCLNGLAA-GEYLEGHT----SMIRR
ABDH_ECOLC      ADVIEENGQVFAELESRNCGKPLHSAFNEIPAIVDVFRFFAGAARCLNGLAA-GEYLEGHT----SMIRR
ABDH_ECOHS      ADVIEENGQVFAELESRNCGKPLHSAFNEIPAIVDVFRFFAGAARCLNGLAA-GEYLEGHT----SMIRR
ASTD_BURXL      AALVTERKEALAEAIGRETGKPLWEARTEAASMAAKVEISIQAYNERTGEK------RSAMADGTAVLRH
ASTD_BURCM      AALLTERKEAIATAIGRETGKPLWEARTEVAAMAAKVGISIQAYQERTGEKRQD------MADGVAVLRH
ASTD_VIBVY      AEQVKENSEEIAQVIAKETGKPLWETRTEAAAMAGKIAISIRAYHERTGESQK----EAAGNQ--IVLRH
ASTD_BURCC      AALLTERKEAIATAIGRETGKPLWEARTEVASMAAKVGISIQAYQERTGEKRQD------MADGVAVLRH
ASTD_BURA4      AALLTERKEAIATAIGRETGKPLWEARTEVAAMAAKVGISIQAYQERTGEKRQD------MADGVAVLRH
ABDH_ECO55      ADVIEENGQVFAELESRNCGKPLHSAFNEIPAIVDVFRFFAGAARCLNGLAA-GEYLEGHT----SMIRR
ABDH_CITK8      ADVIEENAQTFAELESQNCGKPLHCALNEIPAIVDVFRFFAGAARCLNGLAA-GEYLEGHT----SMIRR
ASTD_BURS3      AALLNERKEAIAAAIGRETGKPLWEARTEVASMAAKVGISIQAYQERTGEKRQD------MADGVAVLRH
AL7B4_ARATH     GDALRSKLDYLGRLLSLEMGKILAEGIGEVQEVIDMCDFAVGLSRQLNGSVIP-----SERPNHMMLEMW
YHJ9_YEAST      HDYILNNQDLIARVACRDSGKTLDASMGEILVTLEKIQWTIKHGQRALQPSRRPGPTNFFMKYKGAEIRY
GABD1_MYCTU     --------------------------------------------------------------------RY
GABD1_MYCTA     --------------------------------------------------------------------RY
GABD1_MYCBP     --------------------------------------------------------------------RY
GABD1_MYCBO     --------------------------------------------------------------------RY
ASTD_VIBVU      AEQVKENSEEIAQVIAKETGKPLWETRTEAAAMAGKIAISIRAYHERTGESQK----EAAGNQ--IVLRH
ASTD_PHOLL      AALLNEEKETLARVISQETSKPLWETRTEIQSMIGKAAISIEAWEQRTGES------ETIMPDGRALLRH
ABDH_ECO5E      ADVIEENGQVFAELESRNCGKPLHSAFNEIPAIVDVFRFFAGAARCLNGLAA-GEYLEGHT----SMIRR
ABDH_ECO57      ADVIEENGQVFAELESRNCGKPLHSAFNEIPAIVDVFRFFAGAARCLNGLAA-GEYLEGHT----SMIRR
XYLG_PSEPU      ---------------------------------ADLLKNVANEA------------FEMATPDGAGALNR
MMSA_DICDI      KNLINKNMDKIAAIITEEQGKTLPDAKGDVFRGLEVVEHSVNVASLMMGETVEN-----VSKNVDIYSYV
ABDH_SHIDS      ADVIEENGQVFAELESRNCGKPLHSAFNEIPAIVDVFRFFAGAARCLNGLAV-GEYLEGHT----SMIRR
ASTD_MARAV      GELLEANKEELAHQIGLETGKPLWESRTEVAAMMGKIPISVKAYNERTGHT------ESDVAGGHAVLRH
ABDH_SALAR      ADSIKQNALQLAKLESQNCGKPLHCVINEIPAIIDVFRFFAGAARCLNGLAA-GEYLEGYT----SMIRR
MMSA_ARATH      QELIRKNMDKLAMNITTEQGKTLKDSHGDIFRGLEVVEHACGMATLQMGEYLPN-----VSNGVDTYSIR
BETB_XANAC      VALLRERNDALAQLETLNTGKPLSETRSDVVTGADVLEYXXXXXXXXXXPLREGSFF---------YTRH
AL7A1_BRANA     GDALRSKLDYLGRLLSLEMGKILAEGIGEVQEVIDMCDFAVGLSRQLNGSVIP-----SERPNHMMLEMW
ABDH_SALTI      ADSIEQNALEFARLESQNCGKPLHCVINEIPAIVDVFRFFAGAARCLSGLAA-GEYLEGHT----SMIRR
ASTD_ALISL      AALVKENTDKIAEVISKETGKPFKTEAGAMVGKIAISIRAYHE--RTPHKEREAAG------NKI-VLRH
ABDH_SALPC      ADSIEQNALEFARLESQNCGKPLHCVINEIPAIVDVFRFFAGAARCLSGLAA-GEYLEGHT----SMIRR
ABDH_SALCH      ADSIEQNALEFARLESQNCGKPLHCVINEIPAIVDVFRFFAGAARCLSGLAA-GEYLEGHT----SMIRR
AL7A1_CAEEL     GDKLRTQLQNLGKLVSLEMGKISAEGVGEVQEYVDICDYATG-----LSRSLEGKIFPSERPGHALLEQW
MMSA_DROME      QALIKENMGELAKNITKEQGKTLADAEGDVLRGLQVVEHCCSIPSLQMGETVAN---VARDMDTYSLVL-
ASTD_BURVG      AALLTERKEALAAAIGRETGKPLWEARTEVAAMAAKVAISIQAYHERTGEKRQD------MADGVAVLRH
ABDH_SALPA      ADSIEQNALEFARLESQNCGKPLHCVINEIPAIVDVFRFFAGAARCLSGLAA-GEYLEGHT----SMIRR
MMSA_DROPS      QALIKENMGELAKNITKEQGKTLADAEGDVLRGLQVVEHCCSIPSLQMGETVAN---VARDMDTYSLVM-
ABDH_SALPB      ADSIEQNALEFARLESQNCGKPLHCVINEIPAIVDVFRFFAGAARCLSGLAA-GEYLEGHT----SMIRR
ASTD_SPHAL      ADRVKAESEAFADLIARETGKPLWEARTEVESVANKVDISVKAAERTPNRRIEGAGLRSA-------VRH
ASTD_BURCJ      AALLTERKEAIATAIGRETGKPLWEARTEVASMAAKVGISIQAYQERTGEKRQD------MADGVAVLRH
ROCA2_BACHD     -------KHEFSAWLVKEAGKPWKEADADTAEAIDFLEYYARQ--MITLKDGKPVNSREGEHNRYFYT--
ASTD_VIBCM      AELVKANSEQIAQVIAKETGKPLWETRTEXXXXXXXXXXXXXXYHERTGETVR-----EAAGNQL-VLRH
ASTD_ENT38      ATLLEANKAELTRVIARETGKPRWEATTEITAMINKITISVKAYHTRTGEQ------HTAMADGAATLRH
ASTD_SHEHH      RDQLEANKAEMAEVIAQETGKPQWETATEAGAMIGKI------GLSVAAYHKRTGTSESETPAGRAVLRH
ASTD_ECO5E      AGLLERNKGELTAIIARETGKPRWEAATELTAMINKIAISIKAYHVRTGEQRSEMPDGAAS------LRH
ASTD_ECO57      AGLLERNKGELTAIIARETGKPRWEAATELTAMINKIAISIKAYHVRTGEQRSEMPDGAAS------LRH
ASTD_KLEP7      AALLEASKAELTAVIGAETGKPRWEAAGEVTAMINKVAISVKAYHVRTGEQ------HSDLPDGAATLRH
MMSA_ANOGA      QHIIRNNMSELAKNITKEQGKTLIDAEGDVLRGLQVVEHCCS----ITSLQM-GETVPNIAKDMDTYSYH
ASTD_ECOLC      AGLLERNKGELTAIIARETGKPRWEAATEVTAMINKIAISIKAYHVRTGEQRSEMPDGAAS------LRH
ASTD_CITK8      AALLEVHKAELTAIIARETGKPCWEAATEVTAMINKIAISVKAYHARTGEQ------QSELPDGAATLRH
ASTD_SHEPW      RDQLEANKAEMAEVIAQETGKPQWETATEAGAMIGKIGLSVAAFHKRTGTS------ENDTPAGRAVLRH
ASTD1_CAUCR     AETVRARREEIATLIARETGKPMWEALTE----ADSV--AAKVAISIRAQDERAGERSEPMADATARLAH
AL7A1_PEA       GDALRAKLDPLGRLVALEMGKILAEGIGEVQEIIDMCDYSVGLSRQLNGSIIP-----SERPEHMMFEVW
MMSA_CAEEL      QALIKRDMKKLAESITIEQGKTLPDAEGDVSRGLQVVEHACSVPSLMMGETLPN-----VSRDMDTHSYR
ASTD_PSEMY      AAALKSHADELARAIGEETGKPLWEAATEVTSMVNKVAISIQSYRERTGE--KSGPLADAT----AVLRH
ASTD_PSEF5      AASLKSRADELARCIGEETGKPLWEAATEVTSMVNKIAISVQSYRERTGEKSGPLG------DATAVLRH
ASTD_ECO8A      AGLLERNKGELTAIIARETGKPRWEAATEVTAMINKIAISIKAYHVRTGEQRSEMPDGAAS------LRH
ASTD_ECO55      AGLLERNKGELTAIIARETGKPRWEAATEVTAMINKIAISIKAYHVRTGEQRSEMPDGAAS------LRH
ASTD_ECO24      AGLLERNKGELTAIIARETGKPRWEAATEVTAMINKIAISIKAYHVRTGEQRSEMPDGAAS------LRH
ASTD_SALA4      AALLEAHKADLTEVIARETGKPRWEAATEVTAMINKIAISIKAYHARTGEQ------KSELVDGAATLRH
ASTD_SHEPC      RSQLEANKAELAETIAQETGKPQWETATEVGAMIGKIALSAAAYHKRTGT--EANDTPAGR----AVIRH
ASTD2_CAUCR     KDILVERAAPYAEALSRETGKALRAELASMAGKVDLSIRAYDERTGVTENAMPFGR---------AVLRH
ASTD_SHESH      RAQLEENKAEIAETIAQETGKPQWETATEAGAMIGKI------GLSVAAYNKRTGTSENDTPAGRAVLRH
ASTD_SALNS      AALLEAHKAELTEVIARETGKPRWEAETEVTAMINKIAISIKAYHARTGEQ------KSELVDGAATLRH
ASTD_CAUSK      KDVLVARTGTFAEALSRETGKALWETKAELGSMAGKVEASIKAYDERTGEHANDMAFGRA------VLRH
ASTD_SORC5      AGVLGEHKARLADVIGLETGKPRWEALTEVQTMIGKIDVSLMAWRERTGER------QAEAGDATAVVRH
ASTD_SHEPA      RDQLEANKAEMAEVIAQETGKPQWETATEAGAMIGKI------GLSVAAYHKRTGTSENDTPAGRAVLRH
ASTD_SALSV      AALLEAHKAELTEVIARETGKPRWEAATEVTAMINKIAISIKAYHARTGEQ------KSELVDGAATLRH
ASTD_SALPB      AALLEAHKADLTEVIARETGKPRWEAATEVTAMINKIAISIKAYHARTG----------AQKSELATLRH
ASTD_SALAR      AVLLEEHKAELTAVIARETGKPRWEAATEVTAMINKIAISIKAYHARTGEQTS----ELA--DGAATLRH
ASTD_ECOSE      AGLLERNKGELTAIIARETGKPRWEAATEVTAMINKIAISIKAYHVRTGEQRSEMPDGAAS------LRH
ASTD_SALG2      AALLEAHKAELTEVIARETGKPRWEAATEVTAMINKIAISIKAYHARTGEQ------KSELVDGAATLRH
ASTD_SALEP      AALLEAHKAELTEVIARETGKPRWEAATEVTAMINKIAISIKAYHARTGEQ------KSELVDGAATLRH
ASTD_ECOHS      AGLLESNKAELTAIIARETGKPRWEAATEVTAMINKIAISIKAYHVRTGEQRSEMPDGAAS------LRH
ASTD_VIBF1      AELVKENADSIAEVIAKETGKPFKTEAGAMVGKIAISIRAYHE--RTPYKEREAAG------NKI-VLRH
ASTD_PSE14      AASLKGRADELAHCIGEETGKPLWESATEVTSMVNKIAISVQSYRERTGEKSGPLG------DATAVLRH
ASTD_VIBCH      AELVKANSEQIAQVIAKETGKPLWETRTEXXXXXXXXXXXXXXYHERTGETVR-----EAAGNQL-VLRH
ASTD_VIBC3      AELVKANSEQIAQVIAKETGKPLWETRTEXXXXXXXXXXXXXXYHERTGETVR-----EAAGNQL-VLRH
ASTD_SALTY      AALLEAHKAELTEVIARETGKPRWEAATEVTAMINKIAISIKAYHARTG----------AQKSELATLRH
ASTD_SALDC      AALLEAHKAELTEVIARETGKPRWEAATEVTAMINKIAISIKAYHARTGEQ------KSELVDGAATLRH
ALDH_VIBCH      ADRIESNLETLAIVESWDNGKPIRETLADLPLTIDHFRYFAA-----CIRSQEGAASELDSRT-LTYHLP
ALDH_VIBC3      ADRIESNLETLAIVESWDNGKPIRETLADLPLTIDHFRYFAA-----CIRSQEGAASELDSRT-LTYHLP
PUTA_ECOLI      AVLMESQMQQLIGILVREAGKTFSNAIAEVREAVDFLHYYA-------GQV----------RDDFANETH
ASTD_ECOLI      AALLESNKAELTAIIARETGKPRWEAATEVTAMINKIAISIKAYHVRTGEQRSEMPDGAAS------LRH
ASTD_ECODH      AALLESNKAELTAIIARETGKPRWEAATEVTAMINKIAISIKAYHVRTGEQRSEMPDGAAS------LRH
ASTD_ECOBW      AALLESNKAELTAIIARETGKPRWEAATEVTAMINKIAISIKAYHVRTGEQRSEMPDGAAS------LRH
ASTD_SHIB3      AGLLESNKAELTAIIARETGKPRWEAATEVTAMINKIAISIKAYHVRTGEQRSEMPDGAAS------LRH
ASTD_SHEWM      KTQLEEHKAEMAEVIAQETGKPQWETATEAGAMIGKI------GLSVAAYNKRTGSSENDTPAGRAVLRH
ASTD_PHOPR      AELVKEHSEHIAHTIAEETGKPLWETRTEAGAMVGKIAISLRAYHERTGEKQKDIAGTAA------VLRH
ASTD_CHRVO      GERLTERKAELARVIAQETGKPLWEATTEVTTMVGKIDISLKALAERTGERA------AAMGDAQAVLRH
ASTD1_SHEDO     AEQLKEHAELFARTIALETGKALWESRTEVGAMTGKIAIS------IKANAERTGTVENPMPGAKAFIRH
GABD1_MYCLE     ADLLEAEANQSAALMTLEMGKTLQSAKDEAMKCAKGFRYYAE---KXXXXXXXXXXXXXXXXXXXXXXRY
ASTD_SALPK      AALLEAHKADLTEVIARETGKPRWEAATEVTAMINKIAISIKAYHARTGEQ------KSELVDGAATLRH
ASTD_SALPC      AVLLEAHKADLTEVIARETGKPRWEAATEVTAMINKIAISIKAYHARTGEQ------KSELVDGAATLRH
ASTD_SALPA      AALLEAHKADLTEVIARETGKPRWEAATEVTAMINKIAISIKAYHARTGEQ------KSELVDGAATLRH
ASTD_YERPS      AALLEQHKQSLARTISLETSKPYWETLTEVQAMIGKVAISLQAYQTRTGHSQTPMG------DSMSVLRH
ASTD_YERPB      AALLEQHKQSLARTISLETSKPYWETLTEVQAMIGKVAISLQAYQTRTGHSQTPMG------DSMSVLRH
PUTA_KLEAE      AVLMESQMPTLMGILVREAGKTFSNAIAEVREAVDFLHYYA-------GQVRDDFDNET----------H
ASTD_SHIBS      AGLLESNKAELTAIIARETGKLRWEAATEVTAMINKIAISIKAYHVRTGEQRSEMPDGAAS------LRH
ASTD_SHESA      RSQLEANKAELAETIAQETGKPQWETATEVAAMIGKIGLSATAYNKRTGT--EANDTPAGR----AVLRH
ASTD_SALHS      AVLLEAHKAELTEVIARETGKPRWEAATEVTAMINKIAISIKAYHARTGEQ------KSELVDGAATLRH
ALDB_ECOLI      ADRMEQNLELLATAETWDNGKPIRTSAADVPLAIDHFRYFAS-----CIRAQEGGISEVDSET-VAYHFH
ASTD_VIBFM      AELVKDNADSIAEVIAKETGKPFKTEAGAMVGKIAISIRAYHE--RTPYKEREAAG------NKI-VLRH
ASTD_PSEA6      GELLAENKDMLALTIAQETGKPLATEVGAMMGKIGISERAYQERTGLVENPMPVGK---------AFIRH
ASTD_YERPY      AALLEQHKQSLARTISLETSKPYWETLTEVQAMIGKVAISLQAYQTRTGHSQTPMG------DSMSVLRH
ASTD_YERPG      AALLEQHKQSLARTISLETSKPYWETLTEVQAMIGKVAISLQAYQTRTGHSQTPMG------DSMSVLRH
ASTD_YERPE      AALLEQHKQSLARTISLETSKPYWETLTEVQAMIGKVAISLQAYQTRTGHSQTPMG------DSMSVLRH
ASTD_YERPA      AALLEQHKQSLARTISLETSKPYWETLTEVQAMIGKVAISLQAYQTRTGHSQTPMG------DSMSVLRH
ASTD_ENTS8      AALLEANKTELTRIIALETSKPRWEAATEVTAMINKVGISLKAYQTRTGEQ------HSPMPDGAATLRH
ASTD_SERP5      AALLEEHKSHLAATISRETSKPVQAMIGKVA--ISLQAYQVRTG--VSQTAMADGA---------SVLRH
MMSA_AEDAE      QHLIRNNMSELAKNITKEQGKTLVDAEGDVLRGLQVVEHCCS----ITSLQM-GETVPNIAKDMDTYSYT
ASTD_SHESW      RSQLEANKAELAETIAQETGKPQWETATEVGAMIGKIALSAAAYHKRTGT--EANDTPAGR----AVIRH
ASTD_SHEFN      RAQLEANKAEIAETIAQETGKPQWETATEVGAMIGKIALSAKAHDKRTGT--ETNDLPAGR----AVLRH
ASTD_ECOUT      AGLLESNKAELTAIIARETGKPRWEAATEVTAMINKIAISIKAYHVRTGEQRSEMPDGAAS------LRH
ASTD_ECO45      AGLLESNKAELTAIIARETGKPRWEAATEVTAMINKIAISIKAYHVRTGEQRSEMPDGAAS------LRH
ASTD_AERHH      ADLLGEHKEALALTIARETGKPLWETRTEVAAMQGKIAISIRAHDERTGTV------ENPMPGAKAFVRH
ALDH_DEIRA      ADRMEQNLEMLAVAETWDNGKPVRETLAADLPLADHFRYFAG-----CIRAQEGG-LSQIDDSTVAYHFH
DHA2_RALEH      ADRIEANLKLLAVAESIDNGKPVRTTAADLPLAVDHFRYFAG-----CIRAQEGGISEIDA-DTIAYHFH
ASTD_YERPP      AALLEQHKQSLARTISLETSKPYWETLTEVQAMIGKVAISLQAYQTRTGHSQTPMG------DSMSVLRH
ASTD_SHIDS      AGLLESNKAELTAIIARETGKPRWEAATEVTAMINKIAISIKAYHVRTGEQRSEMPDGAAS------LRH
ASTD_SHEB9      RSQLEANKAELAETIAQETGKPQWETATEVGAMIGKIALSAAAYNKRTGT--EANDTPAGR----AVIRH
ASTD_SHEB5      RSQLEANKAELAETIAQETGKPQWETATEVGAMIGKIALSAAAYNKRTGT--EANDTPAGR----AVIRH
ASTD_SALTI      SVLLEAHKADLTEVIARETGKPRWEAATEVTAMINKIAISIKAYHARTGEQ------KSELVDGAATLRH
ASTD_AERS4      ADLLGEHKEALALTIARETGKPLWETRTEVAAMQGKIAISIRAHDERTGTV------ENPMPGAKAFVRH
ASTD_ECOLU      AGLLESNKAELTAIIARETGKPRWEAATEVTAMINKIAISIKAYHIRTGEQRSEMPDGAAS------LRH
ASTD_ECO27      AGLLESNKAELTAIIARETGKPRWESATEVTAMINKIAISIKAYHVRTGEQRSEMPDGAAS------LRH
ABDH_ENT38      ADVIEEHAETFARLESQNCGKPLHCVISEIPAVVDVFRFFAGAARCLNGLAA-GEYLEGHT----SMIRR
ASTD_SHIF8      AGLLESNKAELTAIIARETGKPRWEAATEVTAMINKIAISIKAYHVRTGEQRSEMPDGAAS------LRH
ASTD_SHEON      ---LEANKAELAETIAQETGKPQWETATEVAAMIGKIGLSASAYNKRTGTETND------TPAGRAVLRH
ASTD_ECO81      AGLLESNKAELTAIIARETGKPRWEAATEVTAMINKIAISIKAYHVRTGEQRSEMPDGAAS------LRH
ASTD_ECOL5      AGLLESNKAELTAIIARETGKPRWEAATEVTAMINKIAISIKAYHVRTGEQRSEMPDGAAS------LRH
ASTD_SHIFL      AGLLESNKAELTAIIARETGKPRWEAATEVTAMINKIAISIKAYHVRTGEQRSEMPDGAAS------LRH
ASTD_PSEU2      AARLKHHADALAQCIGEETGKPLWESATEVTSMVNKIAISVQSYRERTGEKSGPLG------DATAVLRH
ASTD_ECOL6      AGLLESNKAELTAIIARETGKPRWEAATEVTAMINKIAISIKAYHVRTGEQRSEMPDGAAS------LRH
ASTD_PSEAE      AATLKSRADELARVIGEETGKPLWESATEVTSMVNKVAISVQAFRERTGE--KSGPLADAT----AVLRH
ASTD2_SHEDO     ---LEANKAQLAEVIAQETGKPQWETATEVGAMIGKIALSAAAHDKRTGTETN----ELAAGR--AVLRH
ASTD1_PSEHT     AAQLKENSEELAITIAQETGKPLWETRTEAGAMVGKIAISEKAFLERTGDV------ENAMPLGRAMIRH
ASTD_SHEB2      RSQLEANKAELAETIAQETGKPQWETATEVGAMIGKIALSAAAYNKRTGT--EANDTPAGR----AVIRH
ASTD_HAHCH      AELLEEDKERLADVIGKETSKPLWEARTEVASMVAKVGISIQAFNERTGVSEQ----DVAAGH--AVLKH
ASTD_BURTA      AALLVERKEALATMIGRETGKPLWEARTEVASMA------AKVDISITAYHERTGEKRAPMADGVAVLRH
ASTD_PSEPW      AEQLKQHSEALAYCIGEETGKPLWESATEVTSMVNKVAISIQSYRERTGE--KSGPLADAT----AVLRH
ASTD_PSEE4      AGKLKARAEELAHCIGEETGKPLWESATEVTSMVNKVAISVQSYRERTGE--KSGPLADAT----AVLRH
PUTA_SALTY      AVLMEDQMQQLIGLLVREAGKTFSNAIAEVREAVDFLHYYA-------GQVRDDFDNET----------H
ASTD_COLP3      AELLAENKDALATTIALETGKPKWETTGEAGAMVAKVAISLKAYNERTGTV------ENPMPGAKAFIRH
THCA_RHOER      ADRMEENLESIALAESWDNGKPIRETLNADIPLADHFRYFAG-----AIRAQEGSLSEINS-DTVAYHFH
ASTD_SHEB8      RSQLEANKAELAETIAQETGKPQWETATEVGAMIGKIALSAAAYNKRTGT--EANDTPAGR----AVIRH
ASTD_PSEPK      AAQLKVHAEAMAQCIGEETGKPLWESATEVTSMINKVAISVQSYRERTGE--KSGPLADAT----AVLRH
ASTD2_PSEHT     AAQLKEHSEEFAVIIAQETGKPLWETRTEVGAMTGKVAISVKAYNERTGTT------ENPMPGAKAFIRH
ASTD_PSEPG      AAQLKVHAEAMAQCIGEETGKPLWESATEVTSMINKVAISVQSYRERTGE--KSGPLADAT----AVLRH
PUT2_EMENI      ----------------------------------------------------------------------
ASTD_PSEP1      AAQLKVHAEAMAQCIGEETGKPLWESATEVTSMINKVAISVQSYRERTGE--KSGPLADAT----AVLRH
AL3H1_ARATH     MIICDNHEPEIVAALRDDLGKPLESSVYEVSLLRNSIKLALKQLKN--WMAPEKAKTSLTTFPASAEIVS
ASTD_ECOSM      AALLESNKAELTAIIARETGKPRWEAATEVTAMINKIAISIKAYHVRTGEQRSEMPDGAAS------LRH
ASTD_ESCF3      AGLLESNKVELTAIIARETGKPRWEAATEVTAMINKIAISIKAYHVRTGEQRSEMPDGAAS------LRH
ASTD_BURPS      AALLVERKEALATMIGRETGKPLWEARTEVASMAAKVDVSIAAYHERTGER------RSPTADGVAVLRH
ASTD_BURP6      AALLVERKEALATMIGRETGKPLWEARTEVASMAAKVDVSIAAYHERTGER------RSPTADGVAVLRH
ASTD_BURP1      AALLVERKEALATMIGRETGKPLWEARTEVASMAAKVDVSIAAYHERTGER------RSPTADGVAVLRH
ASTD_BURP0      AALLVERKEALATMIGRETGKPLWEARTEVASMAAKVDVSIAAYHERTGER------RSPTADGVAVLRH
ASTD_BURMS      AALLVERKEALATMIGRETGKPLWEARTEVASMAAKVDVSIAAYHERTGER------RSPTADGVAVLRH
ASTD_BURMA      AALLVERKEALATMIGRETGKPLWEARTEVASMAAKVDVSIAAYHERTGER------RSPTADGVAVLRH
ALDH_RHORT      ADRLQDNLETLAYVESIDNGKPIRETLAADIPLADHFRYFAA-----CIRAQEGS-LSQIDETTIAYHFN
ASTD_LEGPH      VEQVEKNREQLARLISLETGKPLWESQTEVSSVIGKVNLSIQAYQERTWPKQT----ETAEAN--ACLRF
ASTD_LEGPC      VEQVEKNREQLARLISLETGKPLWESQTEVSSVIGKVNLSIQAYQERTWPKQT----ETAEAN--ACLRF
ASTD_ERWT9      AALLDTNRVELSEAIARETGKPRWETQTEVQAMINKVAISLRAWHVRCPEQVEGE----------SSVRH
ASTD_ACIAD      ALLLEQNKEALAKIISQETSKPLWETLTEVQSMVAKVAISIRAYHQRTGKSITEMADGAAS------LRH
AL3A1_RAT       -------------------------------------------------------------------IHS
CALB_PSEAE      --------------------------LAEIMPSLHGIHYAAKRVKKWMKPARRAVGFQPAS----AQVVY
ASTD_LEGPL      VEQVEKNRDQLARLISLETGKPLWESQTEVSSVIGKVNLSIQAYQERTWPKQT----ETAEAN--ACLRF
CALB_CAUCR      -----------------------------------------------------------------ATVQW
AL7A1_DICDI     GQAMREKIEPLSKLISLEMGKIYIEAKGEVQEFIDVCDYATGLSRSINGQVMP-----SERPNHILMETW
ASTD_PSESM      AVSLKAHADELANCIGEETGKPLWESATEVTSMVNKIAISVQSYRERTGEK------SAPLGDATAVLRH
ASTD_PSEFS      AATLKNRADEIARCIGEETGKPLWESVTEVTSMANKIAISVQSYRERTGEKSGPLG------DATAVLRH
ALDH3_BACSU     ------------------------------------------------------------------ILMY
AL3B1_MOUSE     SHFLRDNKQQLQEALAQDLHKSFEAEVSEIAISQAEVDLALRNLR--SWMKDEKVSKNLATQLDSAFIRK
ALDH_CRAPL      -----------------------------------------------------------------AEIVS
AL3B1_RAT       SHFLRDNKQQLQEALAQDLHK---SAFESEVSEIAISQAEVDLALRNLRSWMKD---EKVSKNLAAFIRK
ASTD_LEGPA      VEQVEKNRDQLARLISLETGKPLWESQTEVSSVIGKVNLSIQAYQERTWPKQT----ETAEAN--ACLRF
ALDH_PSEOL      -----------------------------------------------------------------AGLRY
ALDH2_MACPR     ----------------------------------------------------------------------
AL3A1_HUMAN     -------------------------------------------------------------------IHS
AL3A1_MOUSE     -------------------------------------------------------------------IHS
AL4A1_DICDI     ----------------------------------------------------------------------
ASTD_ECO7I      AGLLESNKAELTAIIARETGKPRWEAATEVTAMINKIAISIKAYHVRTGEQRSEMPDGAAS------LRH
AL3B1_HUMAN     GRFLQENKQLLHDALAQDLHKSFESEVSEVAISQGEVTLALRNLR--AWMKDERVPKNLATQLDSAFIRK
ASTD_PSEPF      AAALKNHADELARTIGEETGKPLWEAATEVTSMVNKIAISVQSYRERTGEKSGPLG------DATAVLRH
ALDH2_BACSU     -----------------------------------------------------------------SIIIP
ALDH9_POLMI     ----------------------------------------------------------------------
PUT2_YEAST      ADLIST-KYRYDMLAATMLGQGYQAEIDCITELSDFFRYYVKYASDLYAQQP----VESADGTWNKAEYR
AL3B1_BOVIN     SRFLRENKQLLQEALAQDLHKSFEAEVSEISISQNEINLALRNLR--TWMKDEKVSKNLATQLDSAFIRK
ALDH_STRCO      ADRMEANLERLAVAESWENGKPVRETLAADIPLADHFRYFAG-----AVRAQEGSLGEI-DDDTVAYHFH
PUT2_AGABI      ----------------------------------------------------------------------
ALDH_PSESP      AGILEAHLDELAQLLTHEQGKPLADARGEL---AGAIAFCQCAGSLPLPEVVH-----EQSATRLSKTVR
CALB_PSEUH      -----------------------------------------------------------------ARVEF
AL3F1_ARATH     ----------------------------------------------------------------------
PUT2_SCHPO      ----------------------------------------------------------------------
AL4A1_HUMAN     ADMLSGPRR--AEILAKTVGQGIQAEIDAAAELIDFFRFNAKYAVELEGQQPI-----SVPPSTNSTVYR
AL3A2_RAT       --------------MVQEREKDILAAIAADLSKSELNAYSHEEIDFMLGNLPELASARPAKKNLLAYVQP
AL3A2_MOUSE     --VQEREKEILAAIAADLSKSELNAYSHEVITILGEIDF-------MLGNLPELASARPAKKNLLAYVQP
AL4A1_DANRE     ADIISGPKR--AEVLAKTIGQGVQAEIDAAPELIDFFRFNAKHAIELEDQQLDSDG----STNTM--LYR
ALDH1_ENTHI     -------------------------------------------------------------------VER
AL3A1_CANFA     -------------------------------------------------------------------IHS
AL3A2_HUMAN     -----------------------------------------------------------------AYIQP
AL4A1_BOVIN     ADLLSRRAEVLAKTMVGQGKTVIQAEIDAAAELIDFFRFNAKFAMELEGEQPL-----SVPPSTNSMLYR
AL3A2_PONAB     -----------------------------------------------------------------AYIQP
PUTA_RHIME      AELMQARMPTLLGLIIREAGKSALNAIAEVREAIDFLRYYAEQTRRTLGPAT------------------
AL3A2_MACFA     --VQEREKDILAAIAADLCKSELNAYSQEVITVLGEIDFMLEN-------LPEWVTAKPVKKNLLAYIQP
AL3I1_ARATH     ARMIDEKEKCITEALYQDLSKPLEAFLAEISNTKSSCMLAIKELKN--WMAPETVKTSVTTFPSSAQIVS
ALDH_MYCTU      ADRIDKNAAALAVAEVWDNGKPVREALADIPLAVDHFRYFA------AAIRAQEGALSQIDEDTVAYHFH
ALDH_MYCBO      ADRIDKNAAALAVAEVWDNGKPVREALADIPLAVDHFRYFA------AAIRAQEGALSQIDEDTVAYHFH
AL3B2_HUMAN     ---------------------------------------------------------------------K
ALDH3_DICDI     -------------------------------------------------------------------ILK
AL4A1_RAT       ADMLSGPRR--AEILAKTVGQGIQAEIDAAAELIDFFRFNAKFAVELEGEQPI-----SVPPSTNHVVYR
AL4A1_MOUSE     ADMLSRRAEVLAKTMVGQGKTVIQAEIDAAAELIDFFRFNAKFAVELEGEQPI-----SVPPSTNHTVYR
A16A1_BOVIN     AKVIQKHQRLLWTL--------------ESLVTGRAVREVRDRDVPLAQQLLQYHAVQAHTQEE-ALAGW
BOXD_AZOEV      AELLQAKRAEYFDISLRNSGATEGDASFDVDGAIFTVKSYARAGKALAGRHLKEGGRVALAKTDVFQGQH
EUTE_SALTY      --------------------------------------------------------------NGLTLIEN
ALDHX_YEAST     ----------------------------------------------------------------------
A16A1_RAT       ----------------------------------------------------------------------
A16A1_HUMAN     AEVIQKHQRLLWTLESLVTGRAVREVRGDVQLAQQLLHYHAIQ----------------ASTQEEALAGW
A16A1_MOUSE     AKVVQKHQRLLWTLESLVTGRAVREVRGDVPLAQQLLQYHAVQ----------------AHAQGDALADW
MAOC_ECOLI      AKHLLSEKERFYALSAQTGATRADSWVDIEGGIGTLFTYASLGSRELPDDTLKEGGFAARH------LLT
EUTE_ECOLI      --------------------------------------------------------------NGLTLIEN
AL3A1_BOVIN     ----------------------------------------------------------------------
HFD1_YEAST      ----------------------------------------------------------------------
AL121_ARATH     -LALPKVADFFARLIQRVAPKSYQQAAGEVFVTRKFLENFCGDQVRFLARSFAIPGNHLGQQSH---GYR
ALDH_LINUS      GHMLSIPKEFFARLIQRVAPKSYHQALGEVQVTQKFFENFTGDQVRFLARSFGVPGNHLGQQSNGF---R
AL7A1_RAT       ----------------------------------------------------------------------
ADHE_CLOAB      ----------------------------------------------------------------------
PROA_POLNA      ---------------------------------------------------------------------R
PROA_LACLS      ADSLVENTDRIISENAKDLAKAKGHGISEIMRISDMLRQVAELPDPI-GQVLQG--FTNLDGLKI-VQKR
PROA_LACLM      ADSLVENTDRIISENAKDLAKAKGHGISEIMRISDMLRQVAELPDPI-GQVLQG--FTNLDGLKI-VQKR
PROA_RHOFD      ---------------------------------------------------------------------R
ALDH_VIBHA      ASELEARSDDIIARAHLETALPEVRLTGEIARTANQLRLFADV---VNSGSYHQAILDTPNPTRAPLIRR
PROA_THICR      ATALEEQAETLKTENAKDLANGLDAAMLDRLALTDKVINGMATGLRQIAALNDPIG-EISDMNYLPSKMR
PROA_PSYCK      ---------------------------------------------------------------------R
PROA_ACIAD      ---------------------------------------------------------------------R
PROA_CAMC5      ADELVRQKEKAANLLDLKAGEGLSAALLDRLELTDARIEAMANGVRVVGEVL--GGWRHPNGMQITKIR-
PROA_POLSJ      ---------------------------------------------------------------------R
PROA_CLOPH      --------------------------------------------------------------------RR
PROA_RALEH      AAFIDR------LTLSDKAIATMAAGLGQIAALADPIGEISNMKFRPTG--IQVGQM------------R
PROA_AZOSE      AAIREQTGELLAANLDEARAAGLEAAIDRLTLTAKGIEAMAEGLEQVAGLPDPIGEITDVKRRPSGIQMR
PROA_HELMI      ---------------------------------------------------------------------R
PROA_DICT6      ---------------------------------------------------------------------R
PROA_CLOBA      --------------------------------------------------------------------QR
PROA_STRPF      AKVLVDDTQTLLAANQKDLANAKEHGISDIMMTSERIKAIAQGVQQVAGQVIKG----YTNLNGLKILKR
PROA_RALEJ      ---------------------------------------------------------------------R
PROA_DICTD      ---------------------------------------------------------------------R
PROA_SCHPO      ----------------------------------------------------------------------
PROA_ACISJ      ---------------------------------------------------------------------R
PROA_KOSOT      ---------------------------------------------------------------------R
PROA_DIAST      ---------------------------------------------------------------------R
PROA_DESDA      ---------------------------------------------------------------------R
PROA_TERTT      ---------------------------------------------------------------------R
PROA_METPP      ---------------------------------------------------------------------R
PROA_CLOPE      NAMLDRLK------LDEERVKSIANAVADVVKLDDPI-------GEVTSMFKRPNGLRIG-------VQR
PROA_CLONN      ---------------------------------------------------------------------R
PROA_PSESM      ---------------------------------------------------------------------R
PROA_FRAP2      ---------------------------------------------------------------------R
PROA_STRP1      --------------------------------------------------------------------KR
PROA_CARHZ      AQYLEENMEKILTENQKDLAEAKKGGLSRILDMAEGVRQVA----KLPDPVGEVLGMTRRPNGLVIGQVR
PROA_ENT38      ADYLEGQSEQILLALAEARANGLSDAMARLKSIADDVRQVCNLADPV-GQVIDGGLLDSGLRLER---RR
PROA_AZOSB      ---------------------------------------------------------------------R
PROA_STRPM      --------------------------------------------------------------------KR
PROA_STRPG      --------------------------------------------------------------------KR
PROA_STRPC      --------------------------------------------------------------------KR
PROA_STRPB      --------------------------------------------------------------------KR
PROA_STRP8      --------------------------------------------------------------------KR
PROA_STRP6      --------------------------------------------------------------------KR
PROA_LISW6      ----------------------------------------------------------------------
PROA_LACLA      ADSLIENTDRIISENEKDLANALEHGISEIMRISDMLRQVAELPDPIR-QVLQG--FTNLDGLKI-LQKR
PROA_CLOK5      --------------------------------------------------------------NELNIGRR
PROA_CLOK1      --------------------------------------------------------------NELNIGRR
PROA_VIBCH      ---LEAQSASILAANAKDIALGREAGLSDAMLDRLLLNQAIANDVRNVIKLNDPVGSEIDSRNGMSLARR
PROA_VIBC3      ---LEAQSASILAANAKDIALGREAGLSDAMLDRLLLNQAIANDVRNVIKLNDPVGSEIDSRNGMSLARR
PROA_STRTD      AKALVAESDYIITENAKDIANASENGISKIMQTEDRIAGIAEGVRQVAGQVVRG----YTNLDGLKIVKR
PROA_CLOTE      -------------------------------------------------------------------VKR
PROA_STRTR      AKALVAESDYIFTENAKDMANASENGISKIMQTEDRIAGIAEGVRQVAGQVVRG----YTNLDGLKIVKR
PROA_LISMO      ----------------------------------------------------------------------
PROA_LISIN      ----------------------------------------------------------------------
PROA_EUBR3      ----------------------------------------------------------------------
PROA_DELAS      ----------------------------------------------------------------------
PROA_STREM      ---------------AKDLAKAAEHGISEIMLTADRIHAMAHGVRQVADLADPIGGYTNLDGLKITQ-KR
PROA_PHOPR      --------------------------------------------------------------------RR


                         +         .         .         .         .         *         .:210
query           EPVGIVLAIAPFNYPVNLSASKIAPALIAGNVVMFKPPTQGSISGLLLAKAFEEAGIPAGVFNTITGRGS
GAPN_STRMU      EPVGLVLAISPFNYPVNLAGSKIAPALIAGNVIAFKPPTQGSISXXXXXXXXXXXXXXXXVFNTITGRGS
GAPN_STREI      EPVGLVLAISPFNYPINLAGSKIAPALISGNVVALKPPTQGSISXXXXXXXXXXXXXXXXVFNTITGRGS
GAPN_NICPL      IPLGVILAIPPFNYPVNLAVSKIAPALIAGNSLVLKPPTQGAVACLHMVHCFHLAGFPKGLISCVTGKGS
GAPN_WHEAT      VPLGVVLAIPPFNYPVNLAVSKIGPALIAGNSLVLKPPTQGAVAALHMVHCFHLAGFPKGLISCVTGKGS
GAPN_APIGR      IPLGVILAIPPFNYPVNLAVSKIGPALIAGNALVLKPPTQGAVACLHMVHCFHLAGFPKGLISCITGKGS
GAPN_MAIZE      IPLGVVLAIPPFNYPANLAGSKIGPALIAGNALVLKPPTQGAVAALHMVHCFHLAGFPKGLISCVTGKGS
GAPN_PEA        IPLGVILAIPPFNYPVNLAVSKIAPALIAGNSIVLKPPTQGAVAALHMVHCFHLAGFPKGLISCVTGKGS
GAPN_ARATH      IPLGVVLAIPPFNYPVNLAVSKIAPALIAGNSLVLKPPTQGAVSCLHMVHCFHLAGFPKGLISCITGKGS
LADH_META3      EPVGLVGAITPFNFPLNLFAHKIAPAIAMGNSIVAHPSSKAPMITIELTKIIEKVKIPLGVFNLLTGEGH
GAPN_SCEVA      ------LAIPPFNYPVNLAVSKLAPALMAGNTVVLKPPSQGVVAGIHMIKCFQAAGLPAGTVNLVTGKGS
LADH_METJA      EPVGIVGAITPFNFPLNLSAHKIAPAIATGNVIVHHPSSKAPLVCIELAKIIENANVPLGVYNLLTGAGE
LADH_METVS      EPVGVVGAITPFNFPLNLITHKIGPAIATGNAVVLHPSSKAPITAIYLTKVIEHVNIERGVFNLTTGNGE
LADH_METM7      EPLGVVGAITPFNFPLNLITHKIGPAIATGNSVILHPSSKAPIAAIYLTKIIEQMDIPRGVFNLATGNGD
LADH_METM5      EPLGVVGAITPFNFPLNLITHKIGPAIATGNSVVLHPSSKAPIVAIYLTKIIEQMDVPRGIFNLATGNGD
LADH_METMP      EPLGVIGAITPFNFPLNLATHKIGPAIATGNSVVLHPSSKAPIVAIYLTKIIEQMDIPRGVFNLATGNGE
GABD_ECOLI      QPIGVTAAITPWNFPAAMITRKAGPALAAGCTMVLKPASQTPFSALALAELAIRAGVPAGVFNVVTGSAG
ALDH1_BACSU     VPLGVVGVISPWNFPVAIPIWKMAPALVYGNTVVIKPATETAVTCAKIIACFEEAGLPAGVINLVTGPGS
ALDH5_BACSU     VPAGVVGVISPFNFPFFLSMKSVAPALGAGNGVVLKPHEETPIGGTLIAKIFENAGIPAGLLNVVVTDIA
SSDH_ARATH      QPVGVVGAITPWNFPLAMITRKVGPALASGCTVVVKPSXXXXXXXXXXXXXXXQAGVPPGALNVVMGNAP
ALDH_BACST      VPLGVVGVISPWNFPVAIPIWKMAPALVYGNTVVLKPASETAVTAAKVIECFHEAGFPKGVVNMVCGSGS
YLX7_SCHPO      TPIGVCGQIVPWNYPLNMAGWKIAPALAAGNCIIIKSAETTPLSLLYFATLVEEAGFPKGVVNIISGLGT
ALDY_BACSU      LPLGVISSISPFNFPMNLSMRSIAPAIALGNSVVHKPDIQTAISGTIIAKAFEHAGLPAGVLNVMLTDVK
AL1A3_HUMAN     EPIGVCGAITPWNFPLLMLVWKLAPALCCGNTMVLKPAEQTPLTALYLGSLIKEAGFPPGVVNIVPGFGP
AL1A3_RAT       EPIGVCGAITPWNFPLLMLAWKLAPALCCGNTVVLKPAEQTPLTALYLASLIKEVGFPPGVVNIVPGFGP
Y4UC_RHISN      DPLGIITAITPYNDPLNLVAHKLGPAIAGGNAVMLKPSNLTPFSAIKLVGALREAGLPEEVI-TISHGDR
AL1A2_CHICK     EPIGVCGQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVVNILPGFGP
GABD_BACSU      QPVGPVAAITPWNFPNAMITRKAAPALAAGCTFIIKPAPDTPLSAYELARLAYEAGIPKDVLQVVIGDGE
BETB_PSEMY      EPLGVVAGIGAWNYPIQIALWKSAPALAAGNAMIFKPSEVTSLTALKLAEIYTEAGLPAGVFNVLTGSGR
ALDH_ASPNG      EPIGVCGQIIPWNFPLLMWAWKIGPAIATGNTVVIKTAEQTPLSGLYAANVIKEAGIPAGVVNVISGFGR
AL1A2_HUMAN     EPIGVCGQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVINILPGYGP
ALDH5_YEAS7     EPLGVCGQIIPWNFPLLMWSWKIGPALATGNTVVLKPAETTPLSALFASQLCQEAGIPAGVVNILPGSGR
A9A1B_DANRE     EPFGVCVGIGAWNYPFQIAAWKSAPAIACGNSMVFKPSPLTPVTAVLLAEIYRQAGAPEGLFNVVQG-GQ
ALDH5_YEAST     EPLGVCGQIIPWNFPLLMWSWKIGPALATGNTVVLKPAETTPLSALFASQLCQEAGIPAGVVNILPGSGR
PUUC_ECOLI      EPVGVIAAIVPWNFPLLLTCWKLGPALAAGNSVILKPSEKSPLSAIRLAGLAKEAGLPDGVLNVVTGFGH
BETB_PSEFS      EPLGVVAGIGAWNYPIQIALWKSAPALAAGNAMIFKPSEVTSLTTLKLAEIYTEAGVPAGVFNVLTGSGR
AL9A1_MOUSE     EPLGVCVGIGAWNYPFQIACWKSAPALACGNAMIFKPSPFTPVSALLLAEIYTKAGAPPGLFNVVQG-GA
AL1A2_RAT       EPIGVCGQIIPWNFPLLMFTWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVVNILPGYGP
AL1A2_MOUSE     EPIGVCGQIIPWNFPLLMFTWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVVNILPGYGP
BETB_BURPP      EPLGVCAGIGAWNYPIQIACWKSAPALAAGNAMIFKPSEITPLSALKLAEIFTEAGVPAGVFNVVQGDG-
ALDH_EMENI      EPVGVCGQIIPWNFPLLMWSWKIGPAVAAGNTVVLKTAEQTPLSALYAAKLIKEAGFPAGVINVISGFGR
FEAB_ECOLI      EPVGVVAGIVPWNFPLMIGMWKVMPALAAGCSIVIKPSETTPLTMLRVAELASEAGIPDGVFNVVTGSGA
ALDH_AGABI      EPIGVVGQIIPWNFPLLMLAWKIGPALATGNCIVLKPSEFTPLSALRMCALIQEAGFPPGVVNVVTGYGS
ALDH4_YEAST     QPLGVCGQIIPWNFPLLMWAWKIAPALVTGNTVVLKTAESTPLSALYVSKYIPQAGIPPGVINIVSGFGK
AL1A1_MACFA     EPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGP
BETB_BURXL      EPLGVCAGIGAWNYPIQIACWKSAPALAAGNAMIFKPSEITPLSALKLAEIYTEAGVPAGVFNVVQGDG-
AL1A3_MOUSE     EPIGVCGAITPWNFPLLMLAWKLAPALCCGNTVVLKPAEQTPLTALYLASLIKEVGFPPGVVNIVPGFGP
AL1A2_TAEGU     EPIGVCGQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVVNILPGFGP
AL9A1_RAT       EPLGVCLGIGAWNYPFQIACWKSAPALACGNAMIFKPSPFTPVSALLLAEIYTKAGAPNGLFNVVQG-GA
AL1A1_SHEEP     EPVGVCGQIIPWNFPLLMFLWKIGPALSCGNTVVVKPAEQTPLTALHMGSLIKEAGFPPGVVNIVPGYGP
BETB_ACIAD      EPLGVVAGIGAWNYPIQIALWKSAPALAAGNAMIFKPSEVTPLTAFKLAEIYSEAGLPAGVFNVVQGAGR
AL1A1_RABIT     EPVGVCGQIIPWNFPLVMLIWKIGPALSCGNTVIVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGP
AL1A1_HUMAN     EPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGP
AL1A1_BOVIN     EPVGVCGQIIPWNFPLLMFLWKIGPALSCGNTVVVKPAEQTPLTALHMGSLIKEAGFPPGVVNIVPGYGP
FTHFD_XENTR     EPIGVCGIVIPWNYPLMMLAWKTAACLAAGNTVVLKPAQVTPLTALKFAELSVKAGIPKGVINILPGAGS
BETB_VIBPA      EPLGICAGIGAWNYPIQIAMWKSAPALAAGNAMIFKPSEETPLTALKLAEIYSEAGLPDGVFNVVQG-DY
AL1A7_MOUSE     EPIGVCGQIIPWNGPLIIFTWKLGPALSCGNTVVVKPAEQTPLTALHMASLIKEAGFPPGVVNIVPGYGP
BETB_BURCM      EPLGVCAGIGAWNYPIQIACWKTAPALAAGNAMVFKPSEVTPLTALKLAEIYTEAGVPAGVFNVVQGDGS
ALDH_CLAHE      EPIGVCGQIIPWNFPLLMWAWKIGPAIACGNTVVLKTAEQTPLGGLVAASLVKEAGFPPGVINVISGFGK
BETB_BURA4      EPLGVCAGIGAWNYPIQIACWKTAPALAAGNAMVFKPSEVTPLTALKLAEIYTEAGVPAGVFNVVQGDGS
BETB2_RHIME     EPLGVCLGIGAWNYPIQIAAWKAAPALACGNAMIFKPSEVTPLSALKLAEILTEAGLPPGVFNIVQGAG-
BETB_PSEAE      EPLGVVAGIGAWNYPVQIALWKSAPALAAGNAMIFKPSEVTPLTALKLAEIYTEAGVPDGVFNVLTGSGR
BETB_PSEA8      EPLGVVAGIGAWNYPVQIALWKSAPALAAGNAMIFKPSEVTPLTALKLAEIYTEAGVPDGVFNVLTGSGR
BETB_PSEA7      EPLGVVAGIGAWNYPVQIALWKSAPALAAGNAMIFKPSEVTPLTALKLAEIYTEAGVPDGVFNVLTGSGR
ALD1_STAHJ      EAIGVSGLVTPWNFPTNQTSLKLAAAFAAGSPVVLKPSEETPFAAVILAEIFDKVGVPKGVFNLVNGDGE
BETB_PSEAB      EPLGVVAGIGAWNYPVQIALWKSAPALAAGNAMIFKPSEVTPLTTLKLAEIYTEAGVPDGVFNVLTGSGR
SSDH_RAT        QPVGVASIITPWNFPSAMITRKVGAALAAGCTVVVKPAEDTPYSXXXXXXXXXXXGIPPGVYNVIPTKAK
ROCA_BACWK      -PLGVGVIISPWNFPFAIMAGMTTAAVVSGNTVLLKPASTTPVVAAKFMEVLEEAGLPAGVVNFVPGNGS
AL1A1_MOUSE     EPIGVCGQIIPWNFPMLMFIWKIGPALSCGNTVVVKPAEQTPLTALHLASLIKEAGFPPGVVNIVPGYGP
ROCA_GEOSW      -PLGVGVVISPWNFPFAIMAGTTVASLVTGNTVLLKPASATPVVAYKFAEVLEEAGLPAGVLNYIPGSGA
AL1B1_RAT       EPVGVCGQIIPWNFPLVMQGWKLAPALATGNTVVMKVAEQTPLSALYLASLIKEAGFPPGVVNIITGYGP
AL1A1_RAT       EPIGVCGQIIPWNFPLLMFIWKIGPALSCGNTVVVKPAEQTPLTALHMASLIKEAGFPPGVVNIVPGYGP
YF19_SCHPO      EPIGVCGQIIPWNFPFLMCAWKIAPAVACGNTIILKTAELTPLSALCLTKFVPECGFPPGVINVLSGDGR
ROCA_BACCN      -PLGVGVIISPWNFPFAIMAGMTTAALVSGNTVLLKPASTTPVVAAKFMEVLEEAGLPAGVVNFIPGSGS
BETB_ACIBT      EPLGVVAGIGAWNYPIQIALWKSAPALAAGNAMIFKPSETTPLTALKLAEIYTEAGLPDGVFNVVQGAGR
BETB_PECCP      EPLGVVAGIGAWNYPIQIALWKSAPALAAGNAMIFKPSEVTSLTALKLAEVYTEAGLPAGVFNVLTGTGQ
NAHF_PSEU8      QPVGPILSIVPWNGTAVLAARAIAYPLVCGNTVVFKGSEFSPATHALITQCVQEAGLPAGVLNYLNSRSP
NAHF_PSEPU      QPVGPILSIVPWNGTAVLAARAIAYPLVCGNTVVFKGSEFSPATHALITQCVQEAGLPAGVLNYLNSRSP
BETB_BRUSU      EALGICVGIGAWNYPIQIAAWKSAPALAMGNAFIFKPSENTPLSALALAEAYKEAGLPDGLFNVVQGYG-
BETB_BRUSI      EALGICVGIGAWNYPIQIAAWKSAPALAMGNAFIFKPSENTPLSALALAEAYKEAGLPDGLFNVVQGYG-
BETB_BRUO2      EALGICVGIGAWNYPIQIAAWKSAPALAMGNAFIFKPSENTPLSALALAEAYKEAGLPDGLFNVVQGYG-
BETB_BRUME      EALGICVGIGAWNYPIQIAAWKSAPALAMGNAFIFKPSENTPLSALALAEAYKEAGLPDGLFNVVQGYG-
BETB_BRUC2      EALGICVGIGAWNYPIQIAAWKSAPALAMGNAFIFKPSENTPLSALALAEAYKEAGLPDGLFNVVQGYG-
BETB_BRUAB      EALGICVGIGAWNYPIQIAAWKSAPALAMGNAFIFKPSENTPLSALALAEAYKEAGLPDGLFNVVQGYG-
BETB_BRUA2      EALGICVGIGAWNYPIQIAAWKSAPALAMGNAFIFKPSENTPLSALALAEAYKEAGLPDGLFNVVQGYG-
BETB_BRUA1      EALGICVGIGAWNYPIQIAAWKSAPALAMGNAFIFKPSENTPLSALALAEAYKEAGLPDGLFNVVQGYG-
BETB_ACIBY      EPLGVVAGIGAWNYPIQIALWKSAPALAAGNAMIFKPSETTPLTALKLAEIYTEAGLPDGVFNVVQGAGR
BETB_ACIB5      EPLGVVAGIGAWNYPIQIALWKSAPALAAGNAMIFKPSETTPLTALKLAEIYTEAGLPDGVFNVVQGAGR
BETB_ACIB3      EPLGVVAGIGAWNYPIQIALWKSAPALAAGNAMIFKPSETTPLTALKLAEIYTEAGLPDGVFNVVQGAGR
ALD1_STAAW      EAIGVSGLITPWNFPTNQTSLKLAAAFAAGSPVVLKPSEETPFAAVILAEIFDKVGVPKGVFNLVNGDGA
ALD1_STAAS      EAIGVSGLITPWNFPTNQTSLKLAAAFAAGSPVVLKPSEETPFAAVILAEIFDKVGVPKGVFNLVNGDGA
ALD1_STAAN      EAIGVSGLITPWNFPTNQTSLKLAAAFAAGSPVVLKPSEETPFAAVILAEIFDKVGVPKGVFNLVNGDGA
ALD1_STAAM      EAIGVSGLITPWNFPTNQTSLKLAAAFAAGSPVVLKPSEETPFAAVILAEIFDKVGVPKGVFNLVNGDGA
ALD1_STAAC      EAIGVSGLITPWNFPTNQTSLKLAAAFAAGSPVVLKPSEETPFAAVILAEIFDKVGVPKGVFNLVNGDGA
ALD1_STAA8      EAIGVSGLITPWNFPTNQTSLKLAAAFAAGSPVVLKPSEETPFAAVILAEIFDKVGVPKGVFNLVNGDGA
ALD1_STAA3      EAIGVSGLITPWNFPTNQTSLKLAAAFAAGSPVVLKPSEETPFAAVILAEIFDKVGVPKGVFNLVNGDGA
AL1B1_HUMAN     EPVGVCGQIIPWNFPLVMQGWKLAPALATGNTVVMKVAEQTPLSALYLASLIKEAGFPPGVVNIITGYGP
BETB_ACIBC      EPLGVVAGIGAWNYPIQIALWKSAPALAAGNAMIFKPSETTPLTALKLAEIYTEAGLPDGVFNVVQGAGR
BADH_SPIOL      QPLGVVGLISPWNYPLLMATWKIAPALAAGCTAVLKPSELASVTCLEFGEVCNEVGLPPGVLNILTGLGP
ALD1_STAAR      EAIGVSGLITPWNFPTNQTSLKLAAAFAAGSPVVLKPSEETPFAAVILAEIFDKVGVPKGVFNLVNGDGA
AL1A1_CHICK     EPVGVCGQIIPWNFPLVMFIWKIAPALCCGNTVVVKPAEQTPLSALYMGSLIKEAGFPPGVVNIVPGFGP
BETB_ACIBS      EPLGVVAGIGAWNYPIQIALWKSAPALAAGNAMIFKPSETTPLTALKLAEIYTEAGLPDGVFNVVQGAGR
ROCA_GEOTN      -PLGVGVVISPWNFPFAIMAGTTVAALVTGNTVLLKPASATPVVAYKFAEVLEEAGLPAGVLNYIPGSGA
ROCA_BACCR      -PLGVGVIISPWNFPFAIMAGMTTAALVSGNTVLLKPASTTPVVAAKFMEVLEEAGLPAGVVNFVPGNGS
ROCA_BACC4      -PLGVGVIISPWNFPFAIMAGMTTAALVSGNTVLLKPASTTPVVAAKFMEVLEEAGLPAGVVNFVPGNGS
ROCA_BACC2      -PLGVGVIISPWNFPFAIMAGMTTAALVSGNTVLLKPASTTPVVAAKFMEVLEEAGLPAGVVNFVPGNGS
BETB_RHOS5      EPLGLCVGIGAWNYPSQIACWKAAPALALGNAMVFKPSEVTPLGALKLAEILIEAGLPPGLFNVVQGRGA
AL1L2_HUMAN     EPLGVCAIIIPWNYPLMMLAWKSAACLAAGNTLVLKPAQVTPLTALKFAELSVKAGFPKGVINIIPGSGG
BETB_YERPY      EPLGVVAGIGAWNYPIQIALWKSAPALAAGNAMIFKPSEVTSLTALKLAEIYTEAGLPAGVFNVLTGSGD
BADH_GADCA      EPLGVCAGILAWNYPFMIAAWKCAPALACGNAVVFKPSPMTPVTGVILAEIFHEAGVPVGLVNVVQG-GA
ALDH6_YEAST     EPIGVCGQIIPWNFPIMMLAWKIAPALAMGNVCILKPAAVTPLNALYFASLCKKVGIPAGVVNIVPGPGR
ALDH1_MACPR     EPIGVCGQIFPWNAPMILLACKIGPALCCGNTVIVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGP
AL1B1_PONAB     EPIGVCGQIIPWNFPLVMQGWKLAPALATGNTVVMKVAEQTPLSALYLASLIKEAGFPPGVVNIITGYGP
AL1A1_HORSE     EPVGVCGQILPWNFPLLMFLWKIAPALSCGNTVVVKPAEQTPLSALHVATLIKEAGFPPGVVNIVPGYGP
BETB_RHOSK      EPLGLCVGIGAWNYPSQIACWKAAPALALGNAMVFKPSEVTPLGALKLAEILIEAGLPPGLFNVVQGRGG
BETB_RHOS1      EPLGLCVGIGAWNYPSQIACWKAAPALALGNAMVFKPSEVTPLGALKLAEILIEAGLPPGLFNVVQGRGA
BETB_BRUMB      EALGICVGIGAWNYPIQIAAWKSAPALAMGNAFIFKPSENTPLSALALAEAYKEAGLPDGLFNVVQGYG-
ALDA_STAAW      EPIGVVGAVVAWNFPMLLXXXXXXXXXXXGNTIVIQPSSSTPLSLLEVAKIFQEV-LPKGVVNILTGKGS
ALDA_STAAS      EPIGVVGAVVAWNFPMLLXXXXXXXXXXXGNTIVIQPSSSTPLSLLEVAKIFQEV-LPKGVVNILTGKGS
ALDA_STAAN      EPIGVVGAVVAWNFPMLLXXXXXXXXXXXGNTIVIQPSSSTPLSLLEVAKIFQEV-LPKGVVNILTGKGS
ALDA_STAAM      EPIGVVGAVVAWNFPMLLXXXXXXXXXXXGNTIVIQPSSSTPLSLLEVAKIFQEV-LPKGVVNILTGKGS
ROCA_BACHK      -PLGVGVIISPWNFPFAIMAGMTTAALVSGNTVLLKPASTTPVVAAKFMEVLEEAGLPAGVVNFVPGNGS
ROCA_BACCZ      -PLGVGVIISPWNFPFAIMAGMTTAALVSGNTVLLKPASTTPVVAAKFMEVLEEAGLPAGVVNFVPGNGS
ROCA_BACCQ      -PLGVGVIISPWNFPFAIMAGMTTAALVSGNTVLLKPASTTPVVAAKFMEVLEEAGLPAGVVNFVPGNGS
ROCA_BACC7      -PLGVGVIISPWNFPFAIMAGMTTAALVSGNTVLLKPASTTPVVAAKFMEVLEEAGLPAGVVNFVPGNGS
ROCA_BACC3      -PLGVGVIISPWNFPFAIMAGMTTAALVSGNTVLLKPASTTPVVAAKFMEVLEEAGLPAGVVNFVPGNGS
ROCA_BACC0      -PLGVGVIISPWNFPFAIMAGMTTAALVSGNTVLLKPASTTPVVAAKFMEVLEEAGLPAGVVNFVPGNGS
ROCA_BACAN      -PLGVGVIISPWNFPFAIMAGMTTAALVSGNTVLLKPASTTPVVAAKFMEVLEEAGLPAGVVNFVPGNGS
ROCA_BACAH      -PLGVGVIISPWNFPFAIMAGMTTAALVSGNTVLLKPASTTPVVAAKFMEVLEEAGLPAGVVNFVPGNGS
ROCA_BACAC      -PLGVGVIISPWNFPFAIMAGMTTAALVSGNTVLLKPASTTPVVAAKFMEVLEEAGLPAGVVNFVPGNGS
ROCA_BACAA      -PLGVGVIISPWNFPFAIMAGMTTAALVSGNTVLLKPASTTPVVAAKFMEVLEEAGLPAGVVNFVPGNGS
GABD_DEIRA      APLGVLLGIEPWNYPLYQVVRFAAPNLVVGNTVLLKHSELCPQSALALEQLFHDAGVPQGAYTNLFLRIA
ALDH_ENCBU      EPVGVVGAITPWNFPLHLXXXXXXXXXXXGCTLVLKPAEQTPLTALYLASLVKQAGFPAGVINIVPGLGH
ALDH2_YEAST     VPFGVVAQIVPWNYPLAMACWKLQGALAAGNTVIIKPAENTSLSLLYFATLIKKAGFPPGVVNIVPGYGS
ALDH1_ELEED     EPIGVCGLIFPWNAPMILLACKIGPALCCGNTVIVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGP
ALDA_STAAR      EPIGVVGAVVAWNFPMLLXXXXXXXXXXXGNTIVIQPSSSTPLSLLEVAKIFQEV-LPNGVVNILTGKGS
ROCA_BACC1      -PLGVGVIISPWNFPFAIMAGMTTAALVSGNTVLLKPASTTPVVAAKFMEVLEEAGLPAGVVNFVPGSGS
ALD1_STAAB      EAIGVSGLITPWNFPTNQTSLKLAAAFATGSPVVLKPSEETPFAAVILAEIFDKVGVPKGVFNLVNGDGA
BETB_RHOS4      EPLGLCVGIGAWNYPSQIACWKAAPALALGNAMVFKPSEVTPLGALKLAEILIEAGLPPGLFNVVQGRGA
ALD1_STAES      EAIGVAGLVTPWNFPTNQTSLKLAAAFAAGSPVVLKPSEETPFAAIILAEIFDKVGVPKGVFNLVNGDGS
ALD1_STAEQ      EAIGVAGLVTPWNFPTNQTSLKLAAAFAAGSPVVLKPSEETPFAAIILAEIFDKVGVPKGVFNLVNGDGS
AL9A1_HUMAN     EPLGVCVGIGAWNYPFQIASWKSAPALACGNAMVFKPSPFTPVSALLLAEIYSEAGVPPGLFNVVQG-GA
ROCA_ANOFW      -PLGVGVVISPWNFPFAIMAGTTVAALVTGNTVLLKPASATPVVAYKFVEVLEEAGLPAGVLNYIPGSGA
FTHFD_MOUSE     EPVGVCGIVIPWNYPLMMLSWKTAACLAAGNTVVIKPAQVTPLTALKFAELTLKAGIPKGVVNILPGSGS
BETB_SINMW      VPLGVCVGIGAWNYPQQIACWKGAPALVAGNSMVFKPSENTPLGALKIAEILIEAGLPKGLYNVVQGDRS
ALDH2_RAT       EPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGP
ALDH2_MESAU     EPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGP
ALDA_STAAC      EPIGVVGAVVAWNFPMLLXXXXXXXXXXXGNTIVIQPSSSTPLSLLEVAKIFQEV-LPKGVVNILTGKGS
ALDA_STAAB      EPIGVVGAVVAWNFPMLLXXXXXXXXXXXGNTIVIQPSSSTPLSLLEVAKIFQEV-LPKGVVNILTGKGS
ALDA_STAA8      EPIGVVGAVVAWNFPMLLXXXXXXXXXXXGNTIVIQPSSSTPLSLLEVAKIFQEV-LPKGVVNILTGKGS
ALDA_STAA3      EPIGVVGAVVAWNFPMLLXXXXXXXXXXXGNTIVIQPSSSTPLSLLEVAKIFQEV-LPKGVVNILTGKGS
AL9A1_PONAB     EPLGVCVGIGAWNYPFQITSWKSAPALACGNAMVFKPSPFTPVSALLLAEIYTEAGVPPGLFNVVQG-GA
UGA2_YEAST      QPVGVCGIICPWNFPSAMITRKAAAALAVGCTVVIKPDSQTPLSALAMAYLAEKAGFPKGSFNVILSHAN
ROCA_BACLD      -PTGVTVVIPPWNFLFAIMAGTTVAPIVTGNTVVLKPASAAPVIAAKFVEVLEESGLPKGVVNFVPGSGA
ALDH2_MOUSE     EPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGP
AL1B1_MOUSE     EPVGVCGQIIPWNFPLVMQGWKLAPALATGNTVVMKVAEQTPLSALYLASLIKEAGFPPGVVNIITGYGP
BETB_BURP8      EPLGVTAGIGAWNYPIQIACWKSAPALAAGNAMIFKPSEVTPLSASKLAEIYLEAGVPAGVFNVVQGDG-
ALDA_STAHJ      EPXXXXXXXXXWNFPILLASWKLAPALAAGNTIVIQPSSSTPLSLIELAKIFQEV-LPKGVVNVLTGKGS
ALDH3_YEAST     VPFGVVAQIVPWNYPLAMACRKMQGALAAGNTVIIKPAENTSLSLLYFATLIKKAGFPPGVVNVIPGYGS
ALDH2_PONAB     EPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGP
A9A1A_DANRE     EPLGVCVGIGAWNYPFQIAAWKSAPALACGNAMVFKPSPMTPVTAVMLAEIYKEAGVPDGLFNVVQG-GA
ALDH2_HUMAN     EPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGP
BETB_VIBHB      EPLGICAGIGAWNYPIQIAMWKSAPALAAGNAMIFKPSEETPLTALKLAEIYSEAGLPDGVFNVIQG-DY
ALDA_STAES      EPXXXXXXXXXWNFPILLASWKLGPALAAGNTVVIQPSSSTPLSLIELAKIFQEV-LPKGVVNVLTGKGS
ALDA_STAEQ      EPXXXXXXXXXWNFPILLASWKLGPALAAGNTVVIQPSSSTPLSLIELAKIFQEV-LPKGVVNVLTGKGS
IOLA_BACSU      YPIGVVGGIAPFNFPMMVPCWMFPMAIALGNTFILKPSERTPLLTEKLVELFEKAGLPKGVFNVVYG-AH
IOLA_BACNA      YPIGVVGGIAPFNFPMMVPCWMFPMAIALGNTFILKPSERTPLLTEKLVELFEKAGLPKGVFNVVYG-AH
FTHFD_XENLA     EPIGVCGIVIPWNYPLMMLAWKTAACLTAGNTVVLKPAQVTPLTALKFAELSVKAGIPKGVINILPGAGS
AL9A1_ORYLA     EPLGVCVGIGAWNYPFQIAACKSAPALACGNAMVFKPSPFTPVTAVILAEIYKEAGVPDGLFCVVQG-GA
BETB_OCHA4      EALGICVGIGAWNYPIQIAAWKSAPALAMGNAFIFKPSENTPLSALALAEAYKEAGLPDGLFNVVQGFG-
BADH1_ARATH     QPLGVVGLITPWNYPLLMAVWKVAPSLAAGCTAILKPSELASVTCLELADICREVGLPPGVLNVLTGFGS
ROCA_GEOKA      -PLGVGVVISPWNFPFAIMAGTTVASLVTGNTVLLKPASATPVVAYKFVEVLEEAGLPAGVLNYIPGSGA
AL9A1_BOVIN     EPLGVCVGIGAWNYPFQIACWKSAPALACGNAMVFKPSPFTPVSVLLLAEIYTEAGVPPGLFNVVQG-GA
FTHFD_PONAB     EPVGVCGIIIPWNYPLMMLSWKTAACLAAGNTVVIKPAQVTPLTALKFAELTLKAGIPKGVVNVLPGSGS
BETB_PSEPK      EPLGVTVGIGAWNYPIQIALWKSAPALAAGNAMIFKPSEVTSLTTLKLAEIYTEAGLPNGVFNVLTGSGR
BETB_PSEP1      EPLGVTVGIGAWNYPIQIALWKSAPALAAGNAMIFKPSEVTSLTTLKLAEIYTEAGLPNGVFNVLTGSGR
ALDH_ALTAL      EPIGVCGQIIPWNFPILMWSWKIGPAIATGNTVVLKTAEQTPLSAYIACKLIQEAGFPPGVINVITGFGK
AL2C4_ARATH     EPIGVVGNIIPWNFPSIMFATKVAPAMAAGCTMVVKPAEQTSLSALFYAHLSKEAGIPDGVLNIVTGFGS
IOLA_BACA2      YPIGVVGGIAPFNFPMMVPCWMFPMAISLGNTFILKPSERTPLLTEKLAELFEQAGLPKGVFNVVHG-AH
BETB_RHISN      VPLGVCVGIGAWNYPQQIACWKGAPALAAGNSMVFKPSENTPLGALKIAEILIEAGLPKGLYNVIQGDRS
BETB_RHILW      VPLGVCVGIGAWNYPQQIACWKAAPALISGNAMVFKPSENTPLGALKIAEILHEAGLPKGLFNVIQG-DR
BETB_PSEPW      EPLGVTVGIGAWNYPIQIALWKSAPALAAGNAMIFKPSEVTSLTTLKLAEIYTEAGLPDGVFNVLTGSGR
BADH_ATRHO      QPIGVVGLISPWNYPLLMDTWKIAPALAAGCTTVLKPSELASVTCLEFGEVCNEVGLPPGVLNILTGLGP
AL1L2_MOUSE     EPLGACAIIIPWNYPLMMLAWKSAACLAAGNTLVLKPAQVTPLTALKFAELTVKAGFPKGVINIIPGSGG
BETB_RHIL3      VPLGVCVGIGAWNYPQQIACWKAAPALVCGNAMVFKPSENTPLGALKIAEILHEAGLPKGLFNVIQG-DR
BETB_PSEPG      EPLGVTVGIGAWNY