[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for spne4:ACF55940.1

[Show Plain Result]


## Summary of Sequence Search
    1::203
  122::258     1e-07  24%  261 aa  YVDC_LACLA RecName: Full=UPF0177 protein yvdC;
  129::197     3e-04  37%  201 aa  YAJF_LACLA RecName: Full=UPF0177 protein yajF;
  265::326     6e-04  32%  347 aa  YIPF1_DICDI RecName: Full=Protein YIPF1 homolog;
   81::211     6e-04  27%  226 aa  YBDJ_LACLA RecName: Full=UPF0177 protein ybdJ;
   97::179     6e-04  29%  181 aa  YBDI_LACLA RecName: Full=UPF0177 protein ybdI;
  124::216     0.001  28%  217 aa  YPRA_ECOLX RecName: Full=Uncharacterized 24.3 kDa protein;AltName:
    1::203

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKQL
YVDC_LACLA      -------------------------------------------------------------------KII
YAJF_LACLA      ----------------------------------------------------------------------
YIPF1_DICDI     ----------------------------------------------------------------------
YBDJ_LACLA      ----------------------------------------------------------------------
YBDI_LACLA      ----------------------------------------------------------------------
YPRA_ECOLX      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           LLFIAIFLLSVLETLVYIHFFAVSSGSGVQHLAEVSRGISLSLILTTSVFGPIQEELIFRGLLQGAVFDN
YVDC_LACLA      IGFALLFLVSILTGIFAQIINQSPTTSNQDSLNELQKVIPIAVFATQTLAAGFLEELVYRVGIFEVIFKN
YAJF_LACLA      -------------------------------------------ILGVALLAPILEESIFRASIY-KIFSN
YIPF1_DICDI     ----------------------------VQWIIVAIASIVSGLFLVTNIFTPLKEDFTKRGLIICAVIGA
YBDJ_LACLA      LLFILFFIVNIFIALAHHLYFQMTPALEAEHSIDLANYFARTPFWTHSVIGPISEELIYREYLY-RLFDK
YBDI_LACLA      ------------------------------------------------VIAPIYEELMFREYFY-RFFSH
YPRA_ECOLX      -------------------------------------------LLTIFILAPLNEETLFRGIMLNVFRST


                         +         .         .         .         .         *         .:210
query           SWLGLVLTSSLFSFMHGPSNVPSFIFYXXXXXXXXFAYKKSQNLWVSTLVHMLYNSWPLLYYL
YVDC_LACLA      QYXXXXXXXXXXXYMHGPTDLYSWLTYGLMSLVLTSLYAKYRNFYLNMSVHLLWNLFGLVIAL
YAJF_LACLA      NKIAFVFSSLLFTFMHGYSWV--FLIYLPMSLAVTFIYHRRSDV-------------------
YIPF1_DICDI     LHIGLALVLKLYFFANSTEN-------------------------------------------
YBDJ_LACLA      KCLACFVSVTMFAWVH-TGFTYSFFLYLPISLVVTLAYHRRKAIGESIALHSSIN--------
YBDI_LACLA      KWLAYILSILLFTLIH-TRLTWSFFEYLPMSVIVTSTFHRYKRVSDSIIVHGGYNLMVLIFHI
YPRA_ECOLX      MWLGALITSLLFVAAHSQQNLLTLAELFLVGLITSVARIRSGGLLLPVLLHMEATTLGLLF--