[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for spne4:ACF55996.1

[Show Plain Result]


## Summary of Sequence Search
    1::798
    1::805       0.0  45%  805 aa  PRIA_BACSU RecName: Full=Primosomal protein N';       
   25::798     e-138  42%  831 aa  PRIA_SYNY3 RecName: Full=Primosomal protein N';       
  207::712     e-118  46%  749 aa  PRIA_CHLPN RecName: Full=Primosomal protein N';       
  211::748     e-108  42%  753 aa  PRIA_CHLMU RecName: Full=Primosomal protein N';       
  211::748     e-108  42%  753 aa  PRIA_CHLTR RecName: Full=Primosomal protein N';       
   16::86      e-108  41%  732 aa  PRIA_ECOLI RecName: Full=Primosomal protein N';       
    1::74      e-104  38%  730 aa  PRIA_HAEIN RecName: Full=Primosomal protein N';       
  117::621     e-103  42%  657 aa  PRIA_TREPA RecName: Full=Primosomal protein N';       
  121::647     1e-96  39%  648 aa  PRIA_RICBR RecName: Full=Primosomal protein N';       
  121::647     3e-96  38%  648 aa  PRIA_RICCN RecName: Full=Primosomal protein N';       
  121::643     5e-96  38%  648 aa  PRIA_RICTY RecName: Full=Primosomal protein N';       
  121::647     5e-94  38%  648 aa  PRIA_RICPR RecName: Full=Primosomal protein N';       
  121::647     8e-94  38%  648 aa  PRIA_RICFE RecName: Full=Primosomal protein N';       
  132::622     9e-88  36%  660 aa  PRIA_BORBU RecName: Full=Primosomal protein N';       
  240::718     8e-81  36%  736 aa  PRIA_THEMA RecName: Full=Primosomal protein N';       
  129::586     4e-76  37%  619 aa  PRIA_HELPY RecName: Full=Primosomal protein N';       
  126::586     5e-75  37%  619 aa  PRIA_HELPJ RecName: Full=Primosomal protein N';       
  219::760     2e-69  35%  811 aa  PRIA_RHORU RecName: Full=Primosomal protein N';       
  226::703     2e-28  23%  726 aa  PRIA_BUCAI RecName: Full=Primosomal protein N';       
  219::626     5e-28  23%  720 aa  PRIA_BUCAP RecName: Full=Primosomal protein N';       
  201::416     3e-18  29%  651 aa  PRIA_MYCLE RecName: Full=Putative primosomal protein N';       
  147::552     6e-17  24%  655 aa  PRIA_MYCTU RecName: Full=Putative primosomal protein N';       
  147::552     6e-17  24%  655 aa  PRIA_MYCBO RecName: Full=Putative primosomal protein N';       
  462::620     5e-13  34% 1001 aa  MFD_HELPJ RecName: Full=Transcription-repair-coupling factor;      
  462::618     1e-11  34%  999 aa  MFD_HELPY RecName: Full=Transcription-repair-coupling factor;      
  596::758     7e-11  34% 1148 aa  MFD_ECOLI RecName: Full=Transcription-repair-coupling factor;      
  358::684     1e-10  33%  792 aa  RECG_AQUAE RecName: Full=ATP-dependent DNA helicase recG;       
  245::408     2e-10  31%  671 aa  RECG_STRPN RecName: Full=ATP-dependent DNA helicase recG;       
  613::837     3e-10  29% 1169 aa  MFD_STAHJ RecName: Full=Transcription-repair-coupling factor;      
  576::819     3e-10  30% 1146 aa  MFD_HAEIN RecName: Full=Transcription-repair-coupling factor;      
  638::798     7e-10  32% 1199 aa  MFD_SYNY3 RecName: Full=Transcription-repair-coupling factor;      
  285::642     9e-10  33%  743 aa  RECG_MYCLE RecName: Full=ATP-dependent DNA helicase recG;       
  612::776     3e-09  31% 1168 aa  MFD_STAAW RecName: Full=Transcription-repair-coupling factor;      
  612::776     3e-09  31% 1168 aa  MFD_STAAS RecName: Full=Transcription-repair-coupling factor;      
  612::776     3e-09  31% 1168 aa  MFD_STAAR RecName: Full=Transcription-repair-coupling factor;      
  612::776     3e-09  31% 1168 aa  MFD_STAAN RecName: Full=Transcription-repair-coupling factor;      
  612::776     3e-09  31% 1168 aa  MFD_STAAM RecName: Full=Transcription-repair-coupling factor;      
  612::776     3e-09  31% 1168 aa  MFD_STAAC RecName: Full=Transcription-repair-coupling factor;      
  612::776     3e-09  31% 1168 aa  MFD_STAAB RecName: Full=Transcription-repair-coupling factor;      
  612::776     3e-09  31% 1168 aa  MFD_STAA8 RecName: Full=Transcription-repair-coupling factor;      
  612::776     3e-09  31% 1168 aa  MFD_STAA3 RecName: Full=Transcription-repair-coupling factor;      
  120::288     3e-09  26%  463 aa  COMFA_BACSU RecName: Full=ComF operon protein 1;       
  614::838     4e-09  28% 1170 aa  MFD_STAS1 RecName: Full=Transcription-repair-coupling factor;      
  285::639     6e-09  33%  737 aa  RECG_MYCTU RecName: Full=ATP-dependent DNA helicase recG;       
  285::639     6e-09  33%  737 aa  RECG_MYCBO RecName: Full=ATP-dependent DNA helicase recG;       
  451::550     1e-08  36%  661 aa  UVRB_CLOTE RecName: Full=UvrABC system protein B;       
  456::547     1e-08  43%  688 aa  UVRB_CLAMS RecName: Full=UvrABC system protein B;       
  456::547     1e-08  43%  688 aa  UVRB_CLAM3 RecName: Full=UvrABC system protein B;       
  255::395     1e-08  29%  686 aa  RECG_BORBU RecName: Full=ATP-dependent DNA helicase recG;       
  617::837     1e-08  28% 1169 aa  MFD_STAES RecName: Full=Transcription-repair-coupling factor;      
  617::837     1e-08  28% 1169 aa  MFD_STAEQ RecName: Full=Transcription-repair-coupling factor;      
  471::594     2e-08  39%  701 aa  UVRB_PROAC RecName: Full=UvrABC system protein B;       
   17::84      2e-08  37%  677 aa  UVRB_DESVV RecName: Full=UvrABC system protein B;       
   17::84      2e-08  37%  677 aa  UVRB_DESVH RecName: Full=UvrABC system protein B;       
  658::807     2e-08  30% 1201 aa  MFD_MYXXA RecName: Full=Transcription-repair-coupling factor;      
  465::551     3e-08  41%  667 aa  UVRB_PELCD RecName: Full=UvrABC system protein B;       
  457::556     3e-08  34%  684 aa  UVRB_CHLL2 RecName: Full=UvrABC system protein B;       
  451::542     4e-08  40%  677 aa  UVRB_BACTN RecName: Full=UvrABC system protein B;       
  451::542     4e-08  40%  677 aa  UVRB_BACFR RecName: Full=UvrABC system protein B;       
  451::542     4e-08  40%  677 aa  UVRB_BACFN RecName: Full=UvrABC system protein B;       
  452::551     5e-08  39%  663 aa  UVRB_LEGPL RecName: Full=UvrABC system protein B;       
  452::551     5e-08  39%  663 aa  UVRB_LEGPH RecName: Full=UvrABC system protein B;       
  452::551     5e-08  39%  663 aa  UVRB_LEGPC RecName: Full=UvrABC system protein B;       
  452::551     5e-08  39%  663 aa  UVRB_LEGPA RecName: Full=UvrABC system protein B;       
  457::548     5e-08  35%  681 aa  UVRB_CHLCH RecName: Full=UvrABC system protein B;       
  262::421     5e-08  28%  686 aa  RECG_STAAW RecName: Full=ATP-dependent DNA helicase recG;       
  262::421     5e-08  28%  686 aa  RECG_STAAS RecName: Full=ATP-dependent DNA helicase recG;       
  262::421     5e-08  28%  686 aa  RECG_STAAN RecName: Full=ATP-dependent DNA helicase recG;       
  262::421     5e-08  28%  686 aa  RECG_STAAM RecName: Full=ATP-dependent DNA helicase recG;       
  262::421     5e-08  28%  686 aa  RECG_STAAC RecName: Full=ATP-dependent DNA helicase recG;       
  262::421     5e-08  28%  686 aa  RECG_STAA8 RecName: Full=ATP-dependent DNA helicase recG;       
  468::548     7e-08  42%  675 aa  UVRB_THIDA RecName: Full=UvrABC system protein B;       
  453::625     7e-08  29%  673 aa  UVRB_SHIFL RecName: Full=UvrABC system protein B;       
  453::625     7e-08  29%  673 aa  UVRB_SHIF8 RecName: Full=UvrABC system protein B;       
   17::78      7e-08  39%  680 aa  UVRB_DESVM RecName: Full=UvrABC system protein B;       
  457::548     7e-08  35%  690 aa  UVRB_CHLPB RecName: Full=UvrABC system protein B;       
  617::931     7e-08  30% 1177 aa  MFD_BACSU RecName: Full=Transcription-repair-coupling factor;      
  468::556     9e-08  40%  667 aa  UVRB_LACSS RecName: Full=UvrABC system protein B;       
  464::544     1e-07  41%  671 aa  UVRB_YERPY RecName: Full=UvrABC system protein B;       
  464::544     1e-07  41%  671 aa  UVRB_YERPS RecName: Full=UvrABC system protein B;       
  464::544     1e-07  41%  671 aa  UVRB_YERPP RecName: Full=UvrABC system protein B;       
  464::544     1e-07  41%  671 aa  UVRB_YERPN RecName: Full=UvrABC system protein B;       
  464::544     1e-07  41%  671 aa  UVRB_YERPG RecName: Full=UvrABC system protein B;       
  464::544     1e-07  41%  671 aa  UVRB_YERPE RecName: Full=UvrABC system protein B;       
  464::544     1e-07  41%  671 aa  UVRB_YERPB RecName: Full=UvrABC system protein B;       
  464::544     1e-07  41%  671 aa  UVRB_YERPA RecName: Full=UvrABC system protein B;       
  464::544     1e-07  41%  671 aa  UVRB_YERP3 RecName: Full=UvrABC system protein B;       
  457::548     1e-07  39%  671 aa  UVRB_THEYD RecName: Full=UvrABC system protein B;       
  458::557     1e-07  38%  678 aa  UVRB_PASMU RecName: Full=UvrABC system protein B;       
  457::548     1e-07  39%  695 aa  UVRB_NITEU RecName: Full=UvrABC system protein B;       
  466::544     1e-07  42%  671 aa  UVRB_HAMD5 RecName: Full=UvrABC system protein B;       
  451::548     1e-07  35%  661 aa  UVRB_FERNB RecName: Full=UvrABC system protein B;       
  440::545     1e-07  41%  682 aa  UVRB_DESDG RecName: Full=UvrABC system protein B;       
  450::549     2e-07  39%  646 aa  UVRB_METTH RecName: Full=UvrABC system protein B;       
  469::557     2e-07  39%  678 aa  UVRB_MANSM RecName: Full=UvrABC system protein B;       
  576::720     2e-07  29% 1125 aa  MFD_BORBU RecName: Full=Transcription-repair-coupling factor;      
  453::544     2e-07  39%  673 aa  UVRB_SHISS RecName: Full=UvrABC system protein B;       
  453::544     2e-07  39%  673 aa  UVRB_SHIDS RecName: Full=UvrABC system protein B;       
  453::544     2e-07  39%  673 aa  UVRB_SHIBS RecName: Full=UvrABC system protein B;       
  453::544     2e-07  39%  673 aa  UVRB_SHIB3 RecName: Full=UvrABC system protein B;       
  453::544     2e-07  39%  673 aa  UVRB_SALTY RecName: Full=UvrABC system protein B;       
  453::544     2e-07  39%  673 aa  UVRB_SALTI RecName: Full=UvrABC system protein B;       
  453::544     2e-07  39%  673 aa  UVRB_SALSV RecName: Full=UvrABC system protein B;       
  453::544     2e-07  39%  673 aa  UVRB_SALPK RecName: Full=UvrABC system protein B;       
  453::544     2e-07  39%  673 aa  UVRB_SALPC RecName: Full=UvrABC system protein B;       
  453::544     2e-07  39%  673 aa  UVRB_SALPB RecName: Full=UvrABC system protein B;       
  453::544     2e-07  39%  673 aa  UVRB_SALPA RecName: Full=UvrABC system protein B;       
  453::544     2e-07  39%  673 aa  UVRB_SALNS RecName: Full=UvrABC system protein B;       
  453::544     2e-07  39%  673 aa  UVRB_SALHS RecName: Full=UvrABC system protein B;       
  453::544     2e-07  39%  673 aa  UVRB_SALG2 RecName: Full=UvrABC system protein B;       
  453::544     2e-07  39%  673 aa  UVRB_SALEP RecName: Full=UvrABC system protein B;       
  453::544     2e-07  39%  673 aa  UVRB_SALDC RecName: Full=UvrABC system protein B;       
  453::544     2e-07  39%  673 aa  UVRB_SALCH RecName: Full=UvrABC system protein B;       
  453::544     2e-07  39%  673 aa  UVRB_SALAR RecName: Full=UvrABC system protein B;       
  453::544     2e-07  39%  673 aa  UVRB_SALA4 RecName: Full=UvrABC system protein B;       
  453::544     2e-07  39%  673 aa  UVRB_KLEP7 RecName: Full=UvrABC system protein B;       
  453::544     2e-07  39%  673 aa  UVRB_KLEP3 RecName: Full=UvrABC system protein B;       
  453::544     2e-07  39%  673 aa  UVRB_ESCF3 RecName: Full=UvrABC system protein B;       
  453::544     2e-07  39%  673 aa  UVRB_ENT38 RecName: Full=UvrABC system protein B;       
  453::544     2e-07  39%  673 aa  UVRB_ECOUT RecName: Full=UvrABC system protein B;       
  453::544     2e-07  39%  673 aa  UVRB_ECOSM RecName: Full=UvrABC system protein B;       
  453::544     2e-07  39%  673 aa  UVRB_ECOSE RecName: Full=UvrABC system protein B;       
  453::544     2e-07  39%  673 aa  UVRB_ECOLU RecName: Full=UvrABC system protein B;       
  453::544     2e-07  39%  673 aa  UVRB_ECOLI RecName: Full=UvrABC system protein B;       
  453::544     2e-07  39%  673 aa  UVRB_ECOLC RecName: Full=UvrABC system protein B;       
  453::544     2e-07  39%  673 aa  UVRB_ECOL6 RecName: Full=UvrABC system protein B;       
  453::544     2e-07  39%  673 aa  UVRB_ECOL5 RecName: Full=UvrABC system protein B;       
  453::544     2e-07  39%  673 aa  UVRB_ECOK1 RecName: Full=UvrABC system protein B;       
  453::544     2e-07  39%  673 aa  UVRB_ECOHS RecName: Full=UvrABC system protein B;       
  453::544     2e-07  39%  673 aa  UVRB_ECODH RecName: Full=UvrABC system protein B;       
  453::544     2e-07  39%  673 aa  UVRB_ECOBW RecName: Full=UvrABC system protein B;       
  453::544     2e-07  39%  673 aa  UVRB_ECO8A RecName: Full=UvrABC system protein B;       
  453::544     2e-07  39%  673 aa  UVRB_ECO81 RecName: Full=UvrABC system protein B;       
  453::544     2e-07  39%  673 aa  UVRB_ECO7I RecName: Full=UvrABC system protein B;       
  453::544     2e-07  39%  673 aa  UVRB_ECO5E RecName: Full=UvrABC system protein B;       
  453::544     2e-07  39%  673 aa  UVRB_ECO57 RecName: Full=UvrABC system protein B;       
  453::544     2e-07  39%  673 aa  UVRB_ECO55 RecName: Full=UvrABC system protein B;       
  453::544     2e-07  39%  673 aa  UVRB_ECO45 RecName: Full=UvrABC system protein B;       
  453::544     2e-07  39%  673 aa  UVRB_ECO27 RecName: Full=UvrABC system protein B;       
  453::544     2e-07  39%  673 aa  UVRB_ECO24 RecName: Full=UvrABC system protein B;       
  453::544     2e-07  39%  673 aa  UVRB_CITK8 RecName: Full=UvrABC system protein B;       
  256::417     2e-07  29%  682 aa  RECG_STAES RecName: Full=ATP-dependent DNA helicase recG;       
  262::421     2e-07  28%  686 aa  RECG_STAAR RecName: Full=ATP-dependent DNA helicase recG;       
  453::552     3e-07  36%  670 aa  UVRB_PECCP RecName: Full=UvrABC system protein B;       
  453::552     3e-07  36%  670 aa  UVRB_ERWCT RecName: Full=UvrABC system protein B;       
  476::556     3e-07  41%  690 aa  UVRB_DECAR RecName: Full=UvrABC system protein B;       
  471::543     3e-07  42%  673 aa  UVRB_COLP3 RecName: Full=UvrABC system protein B;       
  476::556     3e-07  41%  685 aa  UVRB_AZOSE RecName: Full=UvrABC system protein B;       
  290::423     3e-07  29%  812 aa  MFD_BUCAI RecName: Full=Transcription-repair-coupling factor;      
  453::544     3e-07  39%  670 aa  UVRB_YERE8 RecName: Full=UvrABC system protein B;       
  454::545     3e-07  39%  676 aa  UVRB_VIBF1 RecName: Full=UvrABC system protein B;       
  453::544     3e-07  39%  670 aa  UVRB_SERP5 RecName: Full=UvrABC system protein B;       
  453::544     3e-07  39%  669 aa  UVRB_PROMH RecName: Full=UvrABC system protein B;       
  453::544     3e-07  39%  669 aa  UVRB_PHOLL RecName: Full=UvrABC system protein B;       
  453::544     3e-07  33%  660 aa  UVRB_MYCA5 RecName: Full=UvrABC system protein B;       
  458::549     3e-07  39%  679 aa  UVRB_HAEIN RecName: Full=UvrABC system protein B;       
  458::549     3e-07  39%  679 aa  UVRB_HAEI8 RecName: Full=UvrABC system protein B;       
  463::543     3e-07  38%  664 aa  UVRB_GEOSL RecName: Full=UvrABC system protein B;       
  453::544     3e-07  33%  660 aa  UVB2_MYCPU RecName: Full=UvrABC system protein B;       
  293::591     3e-07  34%  693 aa  RECG_PASMU RecName: Full=ATP-dependent DNA helicase recG;       
  411::469     3e-07  49%  532 aa  DBP3_YARLI RecName: Full=ATP-dependent RNA helicase DBP3;       
  454::545     4e-07  39%  676 aa  UVRB_VIBVY RecName: Full=UvrABC system protein B;       
  454::545     4e-07  39%  676 aa  UVRB_VIBVU RecName: Full=UvrABC system protein B;       
  454::545     4e-07  39%  676 aa  UVRB_VIBPA RecName: Full=UvrABC system protein B;       
  450::539     4e-07  32%  661 aa  UVRB_THEAB RecName: Full=UvrABC system protein B;       
  454::545     4e-07  38%  677 aa  UVRB_IDILO RecName: Full=UvrABC system protein B;       
  461::541     4e-07  41%  698 aa  UVRB_HERA2 RecName: Full=UvrABC system protein B;       
  452::543     4e-07  39%  672 aa  UVRB_COXBU RecName: Full=UvrABC system protein B;       
  452::543     4e-07  39%  672 aa  UVRB_COXBR RecName: Full=UvrABC system protein B;       
  452::543     4e-07  39%  672 aa  UVRB_COXBN RecName: Full=UvrABC system protein B;       
  452::543     4e-07  39%  672 aa  UVRB_COXB2 RecName: Full=UvrABC system protein B;       
  457::548     4e-07  33%  685 aa  UVRB_CHLPD RecName: Full=UvrABC system protein B;       
  451::542     4e-07  40%  662 aa  UVRB_CARHZ RecName: Full=UvrABC system protein B;       
  472::552     4e-07  41%  675 aa  UVRB_BORPD RecName: Full=UvrABC system protein B;       
  455::546     4e-07  29%  663 aa  UVRB_AQUAE RecName: Full=UvrABC system protein B;       
  355::430     4e-07  36%  489 aa  DBP5_ASPFU RecName: Full=ATP-dependent RNA helicase dbp5;       
  453::556     6e-07  36%  669 aa  UVRB_SYNY3 RecName: Full=UvrABC system protein B;       
  462::542     6e-07  37%  658 aa  UVRB_NATTJ RecName: Full=UvrABC system protein B;       
  454::545     6e-07  38%  663 aa  UVRB_FUSNN RecName: Full=UvrABC system protein B;       
  453::544     6e-07  39%  672 aa  UVRB_EDWI9 RecName: Full=UvrABC system protein B;       
  462::550     6e-07  35%  662 aa  UVRB_CLOBM RecName: Full=UvrABC system protein B;       
  462::550     6e-07  35%  662 aa  UVRB_CLOBL RecName: Full=UvrABC system protein B;       
  462::550     6e-07  35%  662 aa  UVRB_CLOBK RecName: Full=UvrABC system protein B;       
  462::550     6e-07  35%  662 aa  UVRB_CLOBJ RecName: Full=UvrABC system protein B;       
  462::550     6e-07  35%  662 aa  UVRB_CLOB6 RecName: Full=UvrABC system protein B;       
  462::550     6e-07  35%  662 aa  UVRB_CLOB1 RecName: Full=UvrABC system protein B;       
  462::550     6e-07  35%  666 aa  UVRB_CLOAB RecName: Full=UvrABC system protein B;       
  457::548     6e-07  38%  670 aa  UVRB_CHRVO RecName: Full=UvrABC system protein B;       
  455::586     6e-07  35%  658 aa  UVRB_CAMFF RecName: Full=UvrABC system protein B;       
  472::552     6e-07  41%  676 aa  UVRB_BORA1 RecName: Full=UvrABC system protein B;       
  467::545     6e-07  41%  676 aa  UVRB_ALISL RecName: Full=UvrABC system protein B;       
  287::376     6e-07  42%  413 aa  RHLB_ACTSZ RecName: Full=ATP-dependent RNA helicase rhlB;       
  256::417     6e-07  28%  682 aa  RECG_STAEQ RecName: Full=ATP-dependent DNA helicase recG;       
  355::430     6e-07  36%  489 aa  DBP5_NEOFI RecName: Full=ATP-dependent RNA helicase dbp5;       
  462::542     8e-07  40%  671 aa  UVRB_PSEPK RecName: Full=UvrABC system protein B;       
  462::542     8e-07  40%  671 aa  UVRB_PSEPF RecName: Full=UvrABC system protein B;       
  462::542     8e-07  40%  671 aa  UVRB_PSEF5 RecName: Full=UvrABC system protein B;       
  454::545     8e-07  39%  674 aa  UVRB_PHOPR RecName: Full=UvrABC system protein B;       
  468::627     8e-07  36%  673 aa  UVRB_PARUW RecName: Full=UvrABC system protein B;       
  452::553     8e-07  35%  649 aa  UVRB_METST RecName: Full=UvrABC system protein B;       
  465::564     8e-07  38%  680 aa  UVRB_GLOVI RecName: Full=UvrABC system protein B;       
  452::543     8e-07  39%  672 aa  UVRB_COXB1 RecName: Full=UvrABC system protein B;       
  464::550     8e-07  34%  659 aa  UVRB_CLOPS RecName: Full=UvrABC system protein B;       
  464::550     8e-07  34%  659 aa  UVRB_CLOPE RecName: Full=UvrABC system protein B;       
  464::550     8e-07  34%  659 aa  UVRB_CLOP1 RecName: Full=UvrABC system protein B;       
  271::406     8e-07  30%  693 aa  RECG_HAEIN RecName: Full=ATP-dependent DNA helicase recG;       
  452::551     1e-06  33%  668 aa  UVRB_THEEB RecName: Full=UvrABC system protein B;       
  455::546     1e-06  40%  658 aa  UVRB_HELHP RecName: Full=UvrABC system protein B;       
  456::549     1e-06  36%  668 aa  UVRB_DEHE1 RecName: Full=UvrABC system protein B;       
  451::554     1e-06  32%  665 aa  UVRB_CYAP7 RecName: Full=UvrABC system protein B;       
  452::551     1e-06  36%  678 aa  UVRB_THICR RecName: Full=UvrABC system protein B;       
  464::584     1e-06  35%  670 aa  UVRB_PSYIN RecName: Full=UvrABC system protein B;       
  454::543     1e-06  37%  687 aa  UVRB_NITOC RecName: Full=UvrABC system protein B;       
  461::549     1e-06  36%  655 aa  UVRB_METS3 RecName: Full=UvrABC system protein B;       
  466::544     1e-06  39%  674 aa  UVRB_ERWT9 RecName: Full=UvrABC system protein B;       
  457::548     1e-06  36%  665 aa  UVRB_ENTFA RecName: Full=UvrABC system protein B;       
  472::552     1e-06  40%  678 aa  UVRB_BORPE RecName: Full=UvrABC system protein B;       
  472::552     1e-06  40%  675 aa  UVRB_BORPA RecName: Full=UvrABC system protein B;       
  472::552     1e-06  40%  675 aa  UVRB_BORBR RecName: Full=UvrABC system protein B;       
  467::547     1e-06  40%  673 aa  UVRB_ACTP2 RecName: Full=UvrABC system protein B;       
  268::435     1e-06  27%  686 aa  RECG_TREPA RecName: Full=ATP-dependent DNA helicase recG;       
  462::542     2e-06  38%  670 aa  UVRB_PSEAE RecName: Full=UvrABC system protein B;       
  458::559     2e-06  31%  656 aa  UVRB_MYCGE RecName: Full=UvrABC system protein B;       
  463::612     2e-06  32%  667 aa  UVRB_KOSOT RecName: Full=UvrABC system protein B;       
  451::554     2e-06  34%  665 aa  UVRB_CYAP4 RecName: Full=UvrABC system protein B;       
  469::555     2e-06  37%  675 aa  UVRB_ACIAD RecName: Full=UvrABC system protein B;       
  456::547     2e-06  38%  677 aa  UVRB_TROW8 RecName: Full=UvrABC system protein B;       
  471::557     2e-06  41%  712 aa  UVRB_STRCO RecName: Full=UvrABC system protein B;       
  469::549     2e-06  38%  675 aa  UVRB_NEIMB RecName: Full=UvrABC system protein B;       
  469::549     2e-06  38%  675 aa  UVRB_NEIMA RecName: Full=UvrABC system protein B;       
  469::549     2e-06  38%  675 aa  UVRB_NEIGO RecName: Full=UvrABC system protein B;       
  469::549     2e-06  38%  675 aa  UVRB_NEIG1 RecName: Full=UvrABC system protein B;       
  457::556     2e-06  33%  667 aa  UVRB_LACPL RecName: Full=UvrABC system protein B;       
  464::550     2e-06  34%  657 aa  UVRB_CLOBB RecName: Full=UvrABC system protein B;       
  464::550     2e-06  34%  657 aa  UVRB_CLOBA RecName: Full=UvrABC system protein B;       
  459::550     2e-06  32%  684 aa  UVRB_CHLTE RecName: Full=UvrABC system protein B;       
  289::374     2e-06  38%  437 aa  RHLB_VIBHB RecName: Full=ATP-dependent RNA helicase rhlB;       
  466::538     3e-06  42%  665 aa  UVRB_THET8 RecName: Full=UvrABC system protein B;       
  471::557     3e-06  41%  713 aa  UVRB_STRAW RecName: Full=UvrABC system protein B;       
  472::563     3e-06  36%  696 aa  UVRB_RALSO RecName: Full=UvrABC system protein B;       
  471::562     3e-06  36%  695 aa  UVRB_RALEJ RecName: Full=UvrABC system protein B;       
  450::549     3e-06  36%  646 aa  UVRB_METMP RecName: Full=UvrABC system protein B;       
  451::542     3e-06  35%  666 aa  UVRB_LEPBL RecName: Full=UvrABC system protein B;       
  451::542     3e-06  35%  666 aa  UVRB_LEPBJ RecName: Full=UvrABC system protein B;       
  468::548     3e-06  36%  683 aa  UVRB_LACAC RecName: Full=UvrABC system protein B;       
  451::565     3e-06  32%  664 aa  UVRB_BORGA RecName: Full=UvrABC system protein B;       
  342::565     3e-06  27%  664 aa  UVRB_BORAP RecName: Full=UvrABC system protein B;       
  451::567     3e-06  30%  665 aa  UVRB_ANASP RecName: Full=UvrABC system protein B;       
  289::374     3e-06  37%  434 aa  RHLB_ALISL RecName: Full=ATP-dependent RNA helicase rhlB;       
  259::408     3e-06  25%  682 aa  RECG_BACSU RecName: Full=ATP-dependent DNA helicase recG;       
  458::547     3e-06  32%  671 aa  DED1_MAGGR RecName: Full=ATP-dependent RNA helicase DED1;       
  425::514     3e-06  34%  627 aa  DED1_KLULA RecName: Full=ATP-dependent RNA helicase DED1;       
  461::549     4e-06  33%  662 aa  UVRB_TREDE RecName: Full=UvrABC system protein B;       
  512::593     4e-06  35%  695 aa  UVRB_SYNJB RecName: Full=UvrABC system protein B;       
  462::542     4e-06  37%  671 aa  UVRB_PSEU2 RecName: Full=UvrABC system protein B;       
  462::542     4e-06  37%  671 aa  UVRB_PSESM RecName: Full=UvrABC system protein B;       
  464::544     4e-06  37%  664 aa  UVRB_PSEHT RecName: Full=UvrABC system protein B;       
  462::542     4e-06  37%  671 aa  UVRB_PSE14 RecName: Full=UvrABC system protein B;       
  466::544     4e-06  37%  660 aa  UVRB_METBU RecName: Full=UvrABC system protein B;       
  451::542     4e-06  34%  666 aa  UVRB_LEPIN RecName: Full=UvrABC system protein B;       
  451::542     4e-06  34%  666 aa  UVRB_LEPIC RecName: Full=UvrABC system protein B;       
  463::543     4e-06  36%  700 aa  UVRB_GEMAT RecName: Full=UvrABC system protein B;       
  463::541     4e-06  42%  660 aa  UVRB_EUBR3 RecName: Full=UvrABC system protein B;       
  464::550     4e-06  34%  657 aa  UVRB_CLOB8 RecName: Full=UvrABC system protein B;       
  451::565     4e-06  32%  668 aa  UVRB_BORBZ RecName: Full=UvrABC system protein B;       
  456::570     4e-06  32%  673 aa  UVRB_BORBU RecName: Full=UvrABC system protein B;       
  451::554     4e-06  34%  668 aa  UVRB_ACAM1 RecName: Full=UvrABC system protein B;       
  462::542     5e-06  37%  662 aa  UVRB_THETN RecName: Full=UvrABC system protein B;       
  452::543     5e-06  34%  658 aa  UVRB_GEOKA RecName: Full=UvrABC system protein B;       
  485::563     5e-06  38%  696 aa  UVRB_BURPS RecName: Full=UvrABC system protein B;       
  485::563     5e-06  38%  696 aa  UVRB_BURMA RecName: Full=UvrABC system protein B;       
  452::543     5e-06  34%  658 aa  UVRB_BACCA RecName: Full=UvrABC system protein B;       
  289::374     5e-06  37%  437 aa  RHLB_VIBPA RecName: Full=ATP-dependent RNA helicase rhlB;       
  457::554     6e-06  37%  658 aa  UVRB_WOLSU RecName: Full=UvrABC system protein B;       
  450::539     6e-06  31%  656 aa  UVRB_THELT RecName: Full=UvrABC system protein B;       
  466::544     6e-06  38%  659 aa  UVRB_SYMTH RecName: Full=UvrABC system protein B;       
  465::545     6e-06  40%  701 aa  UVRB_MYCUA RecName: Full=UvrABC system protein B;       
  450::548     6e-06  29%  657 aa  UVRB_MYCPU RecName: Full=UvrABC system protein B;       
  470::558     6e-06  34%  671 aa  UVRB_LACCB RecName: Full=UvrABC system protein B;       
  470::558     6e-06  34%  671 aa  UVRB_LACC3 RecName: Full=UvrABC system protein B;       
  451::542     6e-06  36%  661 aa  UVRB_CALS8 RecName: Full=UvrABC system protein B;       
  452::551     6e-06  33%  658 aa  UVRB_BACCR RecName: Full=UvrABC system protein B;       
  451::542     6e-06  36%  661 aa  UVRB_ANATD RecName: Full=UvrABC system protein B;       
  289::374     6e-06  36%  436 aa  RHLB_VIBSL RecName: Full=ATP-dependent RNA helicase rhlB;       
  528::632     6e-06  33%  674 aa  PRP28_MAGGR RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
  466::552     8e-06  33%  669 aa  UVRB_XYLFT RecName: Full=UvrABC system protein B;       
  466::552     8e-06  33%  669 aa  UVRB_XYLFM RecName: Full=UvrABC system protein B;       
  466::552     8e-06  33%  669 aa  UVRB_XYLFA RecName: Full=UvrABC system protein B;       
  466::552     8e-06  33%  669 aa  UVRB_XYLF2 RecName: Full=UvrABC system protein B;       
  427::607     8e-06  28%  668 aa  UVRB_TREPS RecName: Full=UvrABC system protein B;       
  427::607     8e-06  28%  668 aa  UVRB_TREPA RecName: Full=UvrABC system protein B;       
  462::542     8e-06  35%  666 aa  UVRB_SYNP6 RecName: Full=UvrABC system protein B;       
  513::568     8e-06  45%  695 aa  UVRB_SYNJA RecName: Full=UvrABC system protein B;       
  462::542     8e-06  35%  666 aa  UVRB_SYNE7 RecName: Full=UvrABC system protein B;       
  494::551     8e-06  47%  660 aa  UVRB_OCEIH RecName: Full=UvrABC system protein B;       
  469::570     8e-06  37%  681 aa  UVRB_CORDI RecName: Full=UvrABC system protein B;       
  452::568     8e-06  32%  661 aa  UVRB_BACLD RecName: Full=UvrABC system protein B;       
  494::551     8e-06  47%  658 aa  UVRB_BACHK RecName: Full=UvrABC system protein B;       
  494::551     8e-06  47%  658 aa  UVRB_BACCZ RecName: Full=UvrABC system protein B;       
  494::551     8e-06  47%  658 aa  UVRB_BACC1 RecName: Full=UvrABC system protein B;       
  494::551     8e-06  47%  658 aa  UVRB_BACAN RecName: Full=UvrABC system protein B;       
  452::568     8e-06  32%  661 aa  UVRB_BACA2 RecName: Full=UvrABC system protein B;       
  428::530     8e-06  31%  664 aa  DED1_LODEL RecName: Full=ATP-dependent RNA helicase DED1;       
  373::469     8e-06  26%  562 aa  DBP2_CHAGB RecName: Full=ATP-dependent RNA helicase DBP2;       
  420::522     8e-06  32%  617 aa  DBP1_YEAST RecName: Full=ATP-dependent RNA helicase DBP1;       
  420::522     8e-06  32%  617 aa  DBP1_YEAS7 RecName: Full=ATP-dependent RNA helicase DBP1;       
  472::558     1e-05  39%  701 aa  UVRB_THEFY RecName: Full=UvrABC system protein B;       
  457::612     1e-05  28%  662 aa  UVRB_STRZT RecName: Full=UvrABC system protein B;       
  463::562     1e-05  35%  683 aa  UVRB_NATPD RecName: Full=UvrABC system protein B;       
  447::538     1e-05  36%  664 aa  UVRB_METCA RecName: Full=UvrABC system protein B;       
  465::556     1e-05  35%  686 aa  UVRB_HALMA RecName: Full=UvrABC system protein B;       
  456::549     1e-05  35%  664 aa  UVRB_DEHSC RecName: Full=UvrABC system protein B;       
  451::593     1e-05  30%  673 aa  UVRB_CYTH3 RecName: Full=UvrABC system protein B;       
  462::550     1e-05  31%  657 aa  UVRB_CLONN RecName: Full=UvrABC system protein B;       
  451::540     1e-05  30%  656 aa  UVRB_CHLAB RecName: Full=UvrABC system protein B;       
  345::545     1e-05  26%  667 aa  UVRB_AYWBP RecName: Full=UvrABC system protein B;       
  289::374     1e-05  37%  438 aa  RHLB_VIBCM RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::374     1e-05  37%  438 aa  RHLB_VIBCH RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::374     1e-05  37%  438 aa  RHLB_VIBC3 RecName: Full=ATP-dependent RNA helicase rhlB;       
  285::374     1e-05  40%  417 aa  RHLB_MANSM RecName: Full=ATP-dependent RNA helicase rhlB;       
  455::544     1e-05  33%  668 aa  DED1_EMENI RecName: Full=ATP-dependent RNA helicase ded1;       
  457::546     1e-05  32%  675 aa  DED1_ASPOR RecName: Full=ATP-dependent RNA helicase ded1;       
  458::547     1e-05  32%  678 aa  DED1_ASPNC RecName: Full=ATP-dependent RNA helicase ded1;       
  363::431     1e-05  37%  487 aa  DBP5_ASPTN RecName: Full=ATP-dependent RNA helicase dbp5;       
  404::501     1e-05  33%  604 aa  DBP1_CANGA RecName: Full=ATP-dependent RNA helicase DBP1;       
  457::612     1e-05  28%  662 aa  UVRB_STRZP RecName: Full=UvrABC system protein B;       
  457::612     1e-05  28%  662 aa  UVRB_STRZJ RecName: Full=UvrABC system protein B;       
  457::612     1e-05  28%  662 aa  UVRB_STRR6 RecName: Full=UvrABC system protein B;       
  457::612     1e-05  28%  662 aa  UVRB_STRPS RecName: Full=UvrABC system protein B;       
  457::612     1e-05  28%  662 aa  UVRB_STRPN RecName: Full=UvrABC system protein B;       
  457::612     1e-05  28%  662 aa  UVRB_STRPJ RecName: Full=UvrABC system protein B;       
  457::612     1e-05  28%  662 aa  UVRB_STRPI RecName: Full=UvrABC system protein B;       
  457::612     1e-05  28%  662 aa  UVRB_STRP7 RecName: Full=UvrABC system protein B;       
  457::612     1e-05  28%  662 aa  UVRB_STRP4 RecName: Full=UvrABC system protein B;       
  457::612     1e-05  28%  662 aa  UVRB_STRP2 RecName: Full=UvrABC system protein B;       
  465::545     1e-05  38%  698 aa  UVRB_MYCTU RecName: Full=UvrABC system protein B;       
  459::548     1e-05  32%  657 aa  UVRB_MYCPN RecName: Full=UvrABC system protein B;       
  465::545     1e-05  38%  698 aa  UVRB_MYCLE RecName: Full=UvrABC system protein B;       
  465::545     1e-05  38%  698 aa  UVRB_MYCBO RecName: Full=UvrABC system protein B;       
  514::571     1e-05  41%  670 aa  UVRB_METAC RecName: Full=UvrABC system protein B;       
  452::551     1e-05  31%  658 aa  UVRB_LISMO RecName: Full=UvrABC system protein B;       
  452::551     1e-05  31%  658 aa  UVRB_LISMF RecName: Full=UvrABC system protein B;       
  452::551     1e-05  31%  658 aa  UVRB_LISIN RecName: Full=UvrABC system protein B;       
  455::554     1e-05  36%  658 aa  UVRB_HELPY RecName: Full=UvrABC system protein B;       
  467::547     1e-05  38%  675 aa  UVRB_HAEDU RecName: Full=UvrABC system protein B;       
  460::540     1e-05  36%  664 aa  UVRB_CHLAD RecName: Full=UvrABC system protein B;       
  469::572     1e-05  35%  703 aa  UVRB_BIFLI RecName: Full=UvrABC system protein B;       
  274::543     1e-05  25%  678 aa  DED1_SCLS1 RecName: Full=ATP-dependent RNA helicase ded1;       
  461::550     1e-05  32%  676 aa  DED1_NEOFI RecName: Full=ATP-dependent RNA helicase ded1;       
  411::500     1e-05  32%  617 aa  DED1_CANGA RecName: Full=ATP-dependent RNA helicase DED1;       
  459::548     1e-05  32%  674 aa  DED1_ASPFU RecName: Full=ATP-dependent RNA helicase ded1;       
  291::559     1e-05  28%  694 aa  DED1_AJECN RecName: Full=ATP-dependent RNA helicase DED1;       
  359::427     1e-05  35%  482 aa  DBP5_ASPNC RecName: Full=ATP-dependent RNA helicase dbp5;       
  487::567     2e-05  35%  688 aa  UVRB_XANOR RecName: Full=UvrABC system protein B;       
  472::552     2e-05  35%  673 aa  UVRB_XANOP RecName: Full=UvrABC system protein B;       
  472::552     2e-05  35%  673 aa  UVRB_XANOM RecName: Full=UvrABC system protein B;       
  472::552     2e-05  35%  673 aa  UVRB_XANCP RecName: Full=UvrABC system protein B;       
  472::552     2e-05  35%  673 aa  UVRB_XANCB RecName: Full=UvrABC system protein B;       
  472::552     2e-05  35%  673 aa  UVRB_XANC8 RecName: Full=UvrABC system protein B;       
  472::552     2e-05  35%  673 aa  UVRB_XANAC RecName: Full=UvrABC system protein B;       
  493::542     2e-05  48%  677 aa  UVRB_SYNPX RecName: Full=UvrABC system protein B;       
  493::542     2e-05  48%  678 aa  UVRB_SYNPW RecName: Full=UvrABC system protein B;       
  454::566     2e-05  32%  661 aa  UVRB_STAHJ RecName: Full=UvrABC system protein B;       
  460::557     2e-05  31%  708 aa  UVRB_RHOBA RecName: Full=UvrABC system protein B;       
  493::542     2e-05  48%  679 aa  UVRB_PROMP RecName: Full=UvrABC system protein B;       
  493::542     2e-05  48%  679 aa  UVRB_PROM0 RecName: Full=UvrABC system protein B;       
  465::556     2e-05  36%  689 aa  UVRB_HALSA RecName: Full=UvrABC system protein B;       
  469::547     2e-05  37%  668 aa  UVRB_CHLTR RecName: Full=UvrABC system protein B;       
  469::547     2e-05  37%  668 aa  UVRB_CHLTA RecName: Full=UvrABC system protein B;       
  451::540     2e-05  30%  656 aa  UVRB_CHLCV RecName: Full=UvrABC system protein B;       
  400::501     2e-05  29%  594 aa  RH25_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 25;   
  549::617     2e-05  36%  662 aa  PRP28_SCHPO RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
  462::551     2e-05  31%  688 aa  DED1_NEUCR RecName: Full=ATP-dependent RNA helicase ded-1;       
  434::534     2e-05  34%  659 aa  DED1_COCIM RecName: Full=ATP-dependent RNA helicase DED1;       
  457::546     2e-05  32%  674 aa  DED1_ASPTN RecName: Full=ATP-dependent RNA helicase ded1;       
  468::621     2e-05  29%  663 aa  UVRB_STRU0 RecName: Full=UvrABC system protein B;       
  473::627     2e-05  28%  668 aa  UVRB_STRTD RecName: Full=UvrABC system protein B;       
  473::627     2e-05  28%  668 aa  UVRB_STRT2 RecName: Full=UvrABC system protein B;       
  473::627     2e-05  28%  668 aa  UVRB_STRT1 RecName: Full=UvrABC system protein B;       
  456::568     2e-05  32%  663 aa  UVRB_STAAW RecName: Full=UvrABC system protein B;       
  456::568     2e-05  32%  663 aa  UVRB_STAAS RecName: Full=UvrABC system protein B;       
  456::568     2e-05  32%  663 aa  UVRB_STAAR RecName: Full=UvrABC system protein B;       
  456::568     2e-05  32%  663 aa  UVRB_STAAN RecName: Full=UvrABC system protein B;       
  456::568     2e-05  32%  663 aa  UVRB_STAAM RecName: Full=UvrABC system protein B;       
  456::568     2e-05  32%  663 aa  UVRB_STAAC RecName: Full=UvrABC system protein B;       
  462::540     2e-05  37%  657 aa  UVRB_CHLPN RecName: Full=UvrABC system protein B;       
  469::549     2e-05  37%  703 aa  UVRB_BIFLO RecName: Full=UvrABC system protein B;       
  452::543     2e-05  33%  661 aa  UVRB_BACSU RecName: Full=UvrABC system protein B;       
  462::542     2e-05  36%  653 aa  UVRB_ANAPZ RecName: Full=UvrABC system protein B;       
  289::374     2e-05  36%  435 aa  RHLB_VIBVY RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::374     2e-05  36%  435 aa  RHLB_VIBVU RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::374     2e-05  36%  432 aa  RHLB_VIBFM RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::374     2e-05  36%  432 aa  RHLB_VIBF1 RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::376     2e-05  38%  421 aa  RHLB_SHIF8 RecName: Full=ATP-dependent RNA helicase rhlB;       
  282::374     2e-05  35%  437 aa  RHLB_PHOPR RecName: Full=ATP-dependent RNA helicase rhlB;       
  335::440     2e-05  35%  602 aa  RH53_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 53;   
  459::548     2e-05  31%  672 aa  DED1_USTMA RecName: Full=ATP-dependent RNA helicase DED1;       
  289::558     2e-05  27%  696 aa  DED1_PHANO RecName: Full=ATP-dependent RNA helicase DED1;       
  413::468     2e-05  45%  534 aa  DBP3_PICGU RecName: Full=ATP-dependent RNA helicase DBP3;       
  388::465     2e-05  28%  562 aa  DBP2_NEUCR RecName: Full=ATP-dependent RNA helicase dbp-2;       
  454::566     3e-05  32%  661 aa  UVRB_STAES RecName: Full=UvrABC system protein B;       
  454::566     3e-05  32%  661 aa  UVRB_STAEQ RecName: Full=UvrABC system protein B;       
  455::580     3e-05  33%  658 aa  UVRB_HELAH RecName: Full=UvrABC system protein B;       
  463::543     3e-05  37%  660 aa  UVRB_BACHD RecName: Full=UvrABC system protein B;       
  289::376     3e-05  38%  421 aa  RHLB_SALTY RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::376     3e-05  38%  421 aa  RHLB_SALTI RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::376     3e-05  38%  421 aa  RHLB_SALSV RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::376     3e-05  38%  421 aa  RHLB_SALPK RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::376     3e-05  38%  421 aa  RHLB_SALPC RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::376     3e-05  38%  421 aa  RHLB_SALPB RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::376     3e-05  38%  421 aa  RHLB_SALNS RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::376     3e-05  38%  421 aa  RHLB_SALHS RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::376     3e-05  38%  421 aa  RHLB_SALG2 RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::376     3e-05  38%  421 aa  RHLB_SALEP RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::376     3e-05  38%  421 aa  RHLB_SALDC RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::376     3e-05  38%  421 aa  RHLB_SALCH RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::376     3e-05  38%  421 aa  RHLB_SALAR RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::376     3e-05  38%  421 aa  RHLB_SALA4 RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::376     3e-05  40%  430 aa  RHLB_ERWT9 RecName: Full=ATP-dependent RNA helicase rhlB;       
  676::806     3e-05  31% 1234 aa  MFD_MYCTU RecName: Full=Transcription-repair-coupling factor;      
  676::806     3e-05  31% 1234 aa  MFD_MYCBO RecName: Full=Transcription-repair-coupling factor;      
  439::531     3e-05  29%  636 aa  DED1_SCHPO RecName: Full=ATP-dependent RNA helicase ded1;       
  465::554     3e-05  31%  688 aa  DED1_CHAGB RecName: Full=ATP-dependent RNA helicase DED1;       
  355::422     3e-05  36%  477 aa  DBP5_EMENI RecName: Full=ATP-dependent RNA helicase dbp5;       
  363::431     3e-05  35%  487 aa  DBP5_ASPOR RecName: Full=ATP-dependent RNA helicase dbp5;       
  371::465     3e-05  26%  555 aa  DBP2_GIBZE RecName: Full=ATP-dependent RNA helicase DBP2;       
  493::542     4e-05  46%  679 aa  UVRB_SYNS3 RecName: Full=UvrABC system protein B;       
  493::542     4e-05  48%  679 aa  UVRB_PROMM RecName: Full=UvrABC system protein B;       
  493::542     4e-05  48%  677 aa  UVRB_PROMA RecName: Full=UvrABC system protein B;       
  493::542     4e-05  48%  679 aa  UVRB_PROM3 RecName: Full=UvrABC system protein B;       
  458::559     4e-05  31%  692 aa  UVRB_LACLS RecName: Full=UvrABC system protein B;       
  458::559     4e-05  31%  692 aa  UVRB_LACLM RecName: Full=UvrABC system protein B;       
  458::559     4e-05  31%  692 aa  UVRB_LACLA RecName: Full=UvrABC system protein B;       
  468::548     4e-05  35%  668 aa  UVRB_LACBA RecName: Full=UvrABC system protein B;       
  455::580     4e-05  33%  658 aa  UVRB_HELPJ RecName: Full=UvrABC system protein B;       
  455::554     4e-05  35%  658 aa  UVRB_HELPH RecName: Full=UvrABC system protein B;       
  289::376     4e-05  38%  421 aa  RHLB_SHISS RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::376     4e-05  38%  421 aa  RHLB_SHIFL RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::376     4e-05  38%  421 aa  RHLB_SHIDS RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::376     4e-05  38%  421 aa  RHLB_SHIBS RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::376     4e-05  38%  421 aa  RHLB_SHIB3 RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::376     4e-05  38%  421 aa  RHLB_KLEP3 RecName: Full=ATP-dependent RNA helicase rhlB;       
  287::374     4e-05  39%  419 aa  RHLB_HAES1 RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::376     4e-05  38%  421 aa  RHLB_ESCF3 RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::376     4e-05  38%  421 aa  RHLB_ENTS8 RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::376     4e-05  38%  421 aa  RHLB_ECOUT RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::376     4e-05  38%  421 aa  RHLB_ECOSM RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::376     4e-05  38%  421 aa  RHLB_ECOSE RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::376     4e-05  38%  421 aa  RHLB_ECOLU RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::376     4e-05  38%  421 aa  RHLB_ECOLI RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::376     4e-05  38%  421 aa  RHLB_ECOLC RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::376     4e-05  38%  421 aa  RHLB_ECOL6 RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::376     4e-05  38%  421 aa  RHLB_ECOL5 RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::376     4e-05  38%  421 aa  RHLB_ECOK1 RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::376     4e-05  38%  421 aa  RHLB_ECOHS RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::376     4e-05  38%  421 aa  RHLB_ECODH RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::376     4e-05  38%  421 aa  RHLB_ECOBW RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::376     4e-05  38%  421 aa  RHLB_ECO8A RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::376     4e-05  38%  421 aa  RHLB_ECO81 RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::376     4e-05  38%  421 aa  RHLB_ECO7I RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::376     4e-05  38%  421 aa  RHLB_ECO5E RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::376     4e-05  38%  421 aa  RHLB_ECO55 RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::376     4e-05  38%  421 aa  RHLB_ECO45 RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::376     4e-05  38%  421 aa  RHLB_ECO27 RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::376     4e-05  38%  421 aa  RHLB_ECO24 RecName: Full=ATP-dependent RNA helicase rhlB;       
  808::916     4e-05  29% 1184 aa  PRP5_PHANO RecName: Full=Pre-mRNA-processing ATP-dependent RNA
  411::500     4e-05  31%  623 aa  DED1_ASHGO RecName: Full=ATP-dependent RNA helicase DED1;       
  355::430     4e-05  33%  487 aa  DBP5_ASPCL RecName: Full=ATP-dependent RNA helicase dbp5;       
  382::458     4e-05  29%  548 aa  DBP2_MAGGR RecName: Full=ATP-dependent RNA helicase DBP2;       
  468::558     5e-05  35%  663 aa  UVRB_STRMU RecName: Full=UvrABC system protein B;       
  462::553     5e-05  29%  671 aa  UVRB_MYCMS RecName: Full=UvrABC system protein B;       
  514::571     5e-05  40%  670 aa  UVRB_METMA RecName: Full=UvrABC system protein B;       
  457::546     5e-05  34%  657 aa  UVRB_CAMHC RecName: Full=UvrABC system protein B;       
  287::374     5e-05  38%  419 aa  RHLB_HAES2 RecName: Full=ATP-dependent RNA helicase rhlB;       
  288::375     5e-05  40%  415 aa  RHLB_HAEIN RecName: Full=ATP-dependent RNA helicase rhlB;       
  288::375     5e-05  40%  415 aa  RHLB_HAEIG RecName: Full=ATP-dependent RNA helicase rhlB;       
  288::375     5e-05  40%  415 aa  RHLB_HAEIE RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::376     5e-05  38%  421 aa  RHLB_CITK8 RecName: Full=ATP-dependent RNA helicase rhlB;       
  661::760     5e-05  31%  831 aa  RECG_SYNY3 RecName: Full=ATP-dependent DNA helicase recG;       
  427::516     5e-05  31%  618 aa  DED1_YARLI RecName: Full=ATP-dependent RNA helicase DED1;       
  457::548     7e-05  30%  662 aa  UVRB_STRSV RecName: Full=UvrABC system protein B;       
  457::548     7e-05  30%  662 aa  UVRB_STRGC RecName: Full=UvrABC system protein B;       
  456::557     7e-05  28%  659 aa  UVRB_MYCMO RecName: Full=UvrABC system protein B;       
  456::547     7e-05  38%  688 aa  UVRB_LEIXX RecName: Full=UvrABC system protein B;       
  599::664     7e-05  36%  728 aa  PRP28_NEUCR RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
  460::549     7e-05  31%  681 aa  DED1_ASPCL RecName: Full=ATP-dependent RNA helicase ded1;       
  483::582     9e-05  35%  740 aa  UVRB_ZYMMO RecName: Full=UvrABC system protein B;       
  468::548     9e-05  33%  663 aa  UVRB_STRS7 RecName: Full=UvrABC system protein B;       
  468::548     9e-05  33%  661 aa  UVRB_STRS2 RecName: Full=UvrABC system protein B;       
  468::548     9e-05  33%  663 aa  UVRB_STRPZ RecName: Full=UvrABC system protein B;       
  468::548     9e-05  33%  663 aa  UVRB_STRPM RecName: Full=UvrABC system protein B;       
  468::548     9e-05  33%  663 aa  UVRB_STRPG RecName: Full=UvrABC system protein B;       
  468::548     9e-05  33%  663 aa  UVRB_STRPD RecName: Full=UvrABC system protein B;       
  468::548     9e-05  33%  663 aa  UVRB_STRPC RecName: Full=UvrABC system protein B;       
  468::548     9e-05  33%  663 aa  UVRB_STRPB RecName: Full=UvrABC system protein B;       
  468::548     9e-05  33%  663 aa  UVRB_STRP8 RecName: Full=UvrABC system protein B;       
  468::548     9e-05  33%  663 aa  UVRB_STRP6 RecName: Full=UvrABC system protein B;       
  468::548     9e-05  33%  663 aa  UVRB_STRP3 RecName: Full=UvrABC system protein B;       
  468::548     9e-05  33%  663 aa  UVRB_STRP1 RecName: Full=UvrABC system protein B;       
  468::548     9e-05  33%  663 aa  UVRB_STREM RecName: Full=UvrABC system protein B;       
  468::548     9e-05  33%  663 aa  UVRB_STRE4 RecName: Full=UvrABC system protein B;       
  468::548     9e-05  33%  663 aa  UVRB_STRA5 RecName: Full=UvrABC system protein B;       
  468::548     9e-05  33%  663 aa  UVRB_STRA3 RecName: Full=UvrABC system protein B;       
  468::548     9e-05  33%  663 aa  UVRB_STRA1 RecName: Full=UvrABC system protein B;       
  493::542     9e-05  46%  678 aa  UVRB_PROMT RecName: Full=UvrABC system protein B;       
  493::542     9e-05  46%  678 aa  UVRB_PROM1 RecName: Full=UvrABC system protein B;       
  471::551     9e-05  37%  709 aa  UVRB_MICLC RecName: Full=UvrABC system protein B;       
  494::558     9e-05  38%  660 aa  UVRB_BACSK RecName: Full=UvrABC system protein B;       
  289::376     9e-05  38%  421 aa  RHLB_ECO57 RecName: Full=ATP-dependent RNA helicase rhlB;       
  274::543     9e-05  24%  683 aa  DED1_BOTFB RecName: Full=ATP-dependent RNA helicase ded1;       
  468::548     1e-04  33%  663 aa  UVRB_STRPF RecName: Full=UvrABC system protein B;       
  453::565     1e-04  30%  660 aa  UVRB_STAS1 RecName: Full=UvrABC system protein B;       
  452::551     1e-04  38%  661 aa  UVRB_RICAE RecName: Full=UvrABC system protein B;       
  493::542     1e-04  48%  679 aa  UVRB_PROM4 RecName: Full=UvrABC system protein B;       
  459::548     1e-04  31%  662 aa  UVRB_MYCPE RecName: Full=UvrABC system protein B;       
  493::554     1e-04  42%  667 aa  UVRB_MICAN RecName: Full=UvrABC system protein B;       
  451::550     1e-04  31%  668 aa  UVRB_FRATT RecName: Full=UvrABC system protein B;       
  528::621     1e-04  32%  738 aa  ROK1_NEOFI RecName: Full=ATP-dependent RNA helicase rok1;       
  529::622     1e-04  32%  739 aa  ROK1_ASPFU RecName: Full=ATP-dependent RNA helicase rok1;       
  289::376     1e-04  36%  428 aa  RHLB_SERP5 RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::374     1e-04  36%  428 aa  RHLB_PHOLL RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::376     1e-04  36%  421 aa  RHLB_KLEP7 RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::374     1e-04  36%  429 aa  RHLB_AERHH RecName: Full=ATP-dependent RNA helicase rhlB;       
  393::463     1e-04  38%  748 aa  RH3_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 3;     
  656::740     1e-04  31%  803 aa  PRP28_ASPOR RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
  394::488     1e-04  33%  546 aa  DDX47_DICDI RecName: Full=Probable ATP-dependent RNA helicase
  331::430     1e-04  32%  479 aa  DBP5_CHAGB RecName: Full=ATP-dependent RNA helicase DBP5;       
  460::518     1e-04  41%  581 aa  DBP3_GIBZE RecName: Full=ATP-dependent RNA helicase DBP3;       
  489::545     2e-04  42%  672 aa  UVRB_ONYPE RecName: Full=UvrABC system protein B;       
  455::552     2e-04  34%  657 aa  UVRB_CAMJR RecName: Full=UvrABC system protein B;       
  455::552     2e-04  34%  657 aa  UVRB_CAMJE RecName: Full=UvrABC system protein B;       
  451::542     2e-04  32%  651 aa  UVRB_ANAMM RecName: Full=UvrABC system protein B;       
  451::542     2e-04  32%  651 aa  UVRB_ANAMF RecName: Full=UvrABC system protein B;       
  323::400     2e-04  39%  614 aa  SPB4_DEBHA RecName: Full=ATP-dependent rRNA helicase SPB4;       
  289::376     2e-04  36%  421 aa  RHLB_ENT38 RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::374     2e-04  36%  429 aa  RHLB_AERS4 RecName: Full=ATP-dependent RNA helicase rhlB;       
  293::406     2e-04  31%  693 aa  RECG_ECOLI RecName: Full=ATP-dependent DNA helicase recG;       
  666::750     2e-04  31%  817 aa  PRP28_COCIM RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
  290::389     2e-04  32%  415 aa  I4A3A_XENLA RecName: Full=Eukaryotic initiation factor 4A-III-A;   
   38::156     2e-04  32% 1377 aa  DCL2_ASPOR RecName: Full=Dicer-like protein 2;Includes:  RecName:
  369::439     2e-04  33%  504 aa  DBP5_CANGA RecName: Full=ATP-dependent RNA helicase DBP5;       
  403::497     2e-04  26%  572 aa  DBP2_SCLS1 RecName: Full=ATP-dependent RNA helicase dbp2;       
  356::450     2e-04  26%  514 aa  DBP2_BOTFB RecName: Full=ATP-dependent RNA helicase dbp2;       
  487::551     2e-04  40%  661 aa  UVRB_RICRS RecName: Full=UvrABC system protein B;       
  487::551     2e-04  40%  661 aa  UVRB_RICRO RecName: Full=UvrABC system protein B;       
  487::551     2e-04  40%  661 aa  UVRB_RICPU RecName: Full=UvrABC system protein B;       
  487::551     2e-04  40%  661 aa  UVRB_RICCN RecName: Full=UvrABC system protein B;       
  492::542     2e-04  41%  664 aa  UVRB_LEPBP RecName: Full=UvrABC system protein B;       
  492::542     2e-04  41%  664 aa  UVRB_LEPBA RecName: Full=UvrABC system protein B;       
  468::548     2e-04  35%  671 aa  UVRB_LACJO RecName: Full=UvrABC system protein B;       
  468::548     2e-04  35%  671 aa  UVRB_LACGA RecName: Full=UvrABC system protein B;       
  471::557     2e-04  38%  698 aa  UVRB_BEUC1 RecName: Full=UvrABC system protein B;       
  348::428     2e-04  40%  493 aa  RRP3_CHAGB RecName: Full=ATP-dependent rRNA helicase RRP3;       
  543::614     2e-04  33%  729 aa  ROK1_ASPNC RecName: Full=ATP-dependent RNA helicase rok1;       
  289::376     2e-04  35%  428 aa  RHLB_YERPY RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::376     2e-04  35%  428 aa  RHLB_YERPS RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::376     2e-04  35%  428 aa  RHLB_YERPP RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::376     2e-04  35%  428 aa  RHLB_YERPN RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::376     2e-04  35%  428 aa  RHLB_YERPE RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::376     2e-04  35%  428 aa  RHLB_YERPB RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::376     2e-04  35%  428 aa  RHLB_YERPA RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::376     2e-04  35%  428 aa  RHLB_YERP3 RecName: Full=ATP-dependent RNA helicase rhlB;       
  467::571     2e-04  34%  573 aa  RH47A_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 47A; 
  346::454     2e-04  27%  547 aa  RH31_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 31;   
  594::674     2e-04  35%  721 aa  PRP28_GIBZE RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
  290::389     2e-04  32%  415 aa  IF4A3_XENTR RecName: Full=Eukaryotic initiation factor 4A-III;     
  285::384     2e-04  32%  410 aa  IF4A3_TAEGU RecName: Full=Eukaryotic initiation factor 4A-III;     
  281::380     2e-04  32%  406 aa  IF4A3_SALSA RecName: Full=Eukaryotic initiation factor 4A-III;     
  286::385     2e-04  32%  411 aa  IF4A3_RAT RecName: Full=Eukaryotic initiation factor 4A-III;       
  286::385     2e-04  32%  411 aa  IF4A3_PIG RecName: Full=Eukaryotic initiation factor 4A-III;       
  286::385     2e-04  32%  411 aa  IF4A3_MOUSE RecName: Full=Eukaryotic initiation factor 4A-III;     
  286::385     2e-04  32%  411 aa  IF4A3_MACFA RecName: Full=Eukaryotic initiation factor 4A-III;     
  286::385     2e-04  32%  411 aa  IF4A3_HUMAN RecName: Full=Eukaryotic initiation factor 4A-III;     
  287::386     2e-04  32%  412 aa  IF4A3_CHICK RecName: Full=Eukaryotic initiation factor 4A-III;     
  286::385     2e-04  32%  411 aa  IF4A3_BOVIN RecName: Full=Eukaryotic initiation factor 4A-III;     
  289::388     2e-04  32%  414 aa  I4A3B_XENLA RecName: Full=Eukaryotic initiation factor 4A-III-B;   
  433::524     2e-04  33%  637 aa  DED1_PICGU RecName: Full=ATP-dependent RNA helicase DED1;       
  454::543     2e-04  30%  675 aa  DED1_GIBZE RecName: Full=ATP-dependent RNA helicase DED1;       
  420::511     2e-04  32%  630 aa  DED1_DEBHA RecName: Full=ATP-dependent RNA helicase DED1;       
  431::520     2e-04  33%  637 aa  DED1_CRYNE RecName: Full=ATP-dependent RNA helicase ded1;       
  390::475     2e-04  31%  500 aa  DBP5_PICST RecName: Full=ATP-dependent RNA helicase DBP5;       
  458::550     3e-04  31%  645 aa  UVRB_WOLTR RecName: Full=UvrABC system protein B;       
  499::555     3e-04  39%  676 aa  UVRB_CHLMU RecName: Full=UvrABC system protein B;       
  502::557     3e-04  45%  704 aa  UVRB_ARTCA RecName: Full=UvrABC system protein B;       
  514::607     3e-04  32%  725 aa  ROK1_ASPOR RecName: Full=ATP-dependent RNA helicase rok1;       
  298::374     3e-04  36%  432 aa  RHLB_PROMH RecName: Full=ATP-dependent RNA helicase rhlB;       
  298::354     3e-04  44%  422 aa  RHLB_HAMD5 RecName: Full=ATP-dependent RNA helicase rhlB;       
  293::406     3e-04  31%  693 aa  RECG_ECO57 RecName: Full=ATP-dependent DNA helicase recG;       
  636::720     3e-04  29%  783 aa  PRP28_ASPTN RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
  662::746     3e-04  29%  810 aa  PRP28_ASPNC RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
  151::226     3e-04  36%  697 aa  MFD_BUCBP RecName: Full=Transcription-repair-coupling factor;      
  345::411     3e-04  37%  471 aa  DBP5_PHANO RecName: Full=ATP-dependent RNA helicase DBP5;       
  482::540     3e-04  41%  605 aa  DBP3_CRYNE RecName: Full=ATP-dependent RNA helicase DBP3;       
  487::551     3e-04  38%  661 aa  UVRB_RICAH RecName: Full=UvrABC system protein B;       
  502::557     3e-04  45%  693 aa  UVRB_ARTS2 RecName: Full=UvrABC system protein B;       
  502::557     3e-04  45%  699 aa  UVRB_ARTAT RecName: Full=UvrABC system protein B;       
  522::615     3e-04  33%  730 aa  ROK1_COCIM RecName: Full=ATP-dependent RNA helicase ROK1;       
  527::620     3e-04  31%  738 aa  ROK1_ASPCL RecName: Full=ATP-dependent RNA helicase rok1;       
  289::376     3e-04  35%  430 aa  RHLB_PECCP RecName: Full=ATP-dependent RNA helicase rhlB;       
  287::372     3e-04  38%  423 aa  RHLB_PASMU RecName: Full=ATP-dependent RNA helicase rhlB;       
  289::376     3e-04  35%  430 aa  RHLB_ERWCT RecName: Full=ATP-dependent RNA helicase rhlB;       
  635::719     3e-04  29%  782 aa  PRP28_EMENI RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
  455::553     3e-04  30%  581 aa  PRP28_CANAL RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
  669::734     3e-04  33%  798 aa  PRP28_ASPCL RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
    2::230     3e-04  29% 1429 aa  DCL2_EMENI RecName: Full=Dicer-like protein 2;Includes:  RecName:
  347::434     3e-04  31%  482 aa  DBP5_YEAST RecName: Full=ATP-dependent RNA helicase DBP5;       
  347::434     3e-04  31%  482 aa  DBP5_YEAS7 RecName: Full=ATP-dependent RNA helicase DBP5;       
  352::420     3e-04  33%  483 aa  DBP5_NEUCR RecName: Full=ATP-dependent RNA helicase dbp-5;       
  487::551     5e-04  37%  662 aa  UVRB_RICPR RecName: Full=UvrABC system protein B;       
  329::406     5e-04  36%  631 aa  SPB42_CANAL RecName: Full=ATP-dependent rRNA helicase SPB42;       
  329::406     5e-04  36%  631 aa  SPB41_CANAL RecName: Full=ATP-dependent rRNA helicase SPB41;       
  298::376     5e-04  35%  415 aa  RHLB_SODGM RecName: Full=ATP-dependent RNA helicase rhlB;       
  648::732     5e-04  29%  796 aa  PRP28_NEOFI RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
  446::535     5e-04  30%  580 aa  PRP28_DEBHA RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
  648::732     5e-04  29%  796 aa  PRP28_ASPFU RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
  333::395     5e-04  33%  535 aa  MS116_SCHPO RecName: Full=ATP-dependent RNA helicase mss116,
  698::816     5e-04  35%  820 aa  DDX23_PONAB RecName: Full=Probable ATP-dependent RNA helicase
  698::816     5e-04  35%  820 aa  DDX23_HUMAN RecName: Full=Probable ATP-dependent RNA helicase
  452::557     5e-04  30%  578 aa  DBP3_SCHPO RecName: Full=ATP-dependent RNA helicase dbp3;       
  417::472     5e-04  43%  535 aa  DBP3_LODEL RecName: Full=ATP-dependent RNA helicase DBP3;       
  487::551     6e-04  37%  662 aa  UVRB_RICTY RecName: Full=UvrABC system protein B;       
  487::551     6e-04  38%  661 aa  UVRB_RICM5 RecName: Full=UvrABC system protein B;       
  487::551     6e-04  38%  661 aa  UVRB_RICFE RecName: Full=UvrABC system protein B;       
  487::551     6e-04  38%  661 aa  UVRB_RICBR RecName: Full=UvrABC system protein B;       
  487::551     6e-04  38%  661 aa  UVRB_RICB8 RecName: Full=UvrABC system protein B;       
  502::551     6e-04  44%  693 aa  UVRB_RENSM RecName: Full=UvrABC system protein B;       
  336::427     6e-04  36%  486 aa  RRP3_BOTFB RecName: Full=ATP-dependent rRNA helicase rrp3;       
  385::460     6e-04  34%  602 aa  RH52A_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 52A; 
   30::160     6e-04  36%  602 aa  DEAD_BUCBP RecName: Full=Cold-shock DEAD box protein A homolog;    
  547::639     6e-04  26%  724 aa  DDX4_RANLE RecName: Full=Probable ATP-dependent RNA helicase DDX4; 
  146::328     6e-04  28% 1589 aa  DCL4_ARATH RecName: Full=Dicer-like protein 4;         EC=3.1.26.-;
   76::201     6e-04  29% 1485 aa  DCL2_MAGGR RecName: Full=Dicer-like protein 2;Includes:  RecName:
   45::142     6e-04  35% 1362 aa  DCL22_ASPNC RecName: Full=Dicer-like protein 2-2;Includes:
  355::442     6e-04  34%  504 aa  DBP5_MAGGR RecName: Full=ATP-dependent RNA helicase DBP5;       
  429::502     6e-04  36%  546 aa  DBP5_CRYNE RecName: Full=ATP-dependent RNA helicase DBP5;       
  291::367     6e-04  27%  823 aa  DBP4_ASPCL RecName: Full=ATP-dependent RNA helicase dbp4;       
  405::446     6e-04  43%  526 aa  DBP3_PICST RecName: Full=ATP-dependent RNA helicase DBP3;       
  358::452     6e-04  23%  547 aa  DBP2_ASPFU RecName: Full=ATP-dependent RNA helicase dbp2;       
  711::782     8e-04  35% 1287 aa  SKI2_YEAST RecName: Full=Antiviral helicase SKI2;       
  526::619     8e-04  36%  742 aa  ROK1_EMENI RecName: Full=ATP-dependent RNA helicase rok1;       
  467::571     8e-04  33%  573 aa  RH47B_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 47B; 
  342::398     8e-04  26%  536 aa  RH26_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 26;   
  568::626     8e-04  36%  849 aa  PRP5_YEAST RecName: Full=Pre-mRNA-processing ATP-dependent RNA
  568::626     8e-04  36%  849 aa  PRP5_YEAS7 RecName: Full=Pre-mRNA-processing ATP-dependent RNA
  594::705     8e-04  28%  738 aa  PRP28_CRYNE RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
  464::529     8e-04  32%  582 aa  PRP28_CANGA RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
  343::443     8e-04  30%  550 aa  MS116_PHANO RecName: Full=ATP-dependent RNA helicase MSS116,
  280::394     8e-04  27%  405 aa  IF4A_DICDI RecName: Full=Eukaryotic initiation factor 4A;       
  313::402     8e-04  30%  763 aa  DBP4_ASHGO RecName: Full=ATP-dependent RNA helicase DBP4;       
  409::450     8e-04  45%  530 aa  DBP3_VANPO RecName: Full=ATP-dependent RNA helicase DBP3;       
  373::450     8e-04  26%  545 aa  DBP2_NEOFI RecName: Full=ATP-dependent RNA helicase dbp2;       
  384::461     8e-04  26%  554 aa  DBP2_ASPOR RecName: Full=ATP-dependent RNA helicase dbp2;       
  391::468     8e-04  26%  565 aa  DBP2_ASPNC RecName: Full=ATP-dependent RNA helicase dbp2;       
  379::456     8e-04  26%  549 aa  DBP2_ASPCL RecName: Full=ATP-dependent RNA helicase dbp2;       
  395::589     8e-04  29%  656 aa  UVRB_CHLCV RecName: Full=UvrABC system protein B;       (query 261->479)
    1::798

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MALAKIIVDVPLMQTDQPYSYRIPEEFEGMLEVGMRVHVPFGKGNRLIQGIVLGLESQSDGEEMEQDLKD
PRIA_BACSU      MNFAEVIVDVSTKNIDRPFDYKIPDHLKGMIKTGMRVIVPFGP--RKIQGFVTAVKEASDLSG--KSVKE
PRIA_SYNY3      ---AAVLVDLP--QNEGVYTYAIPPGLT--VQDGDIVAVPFG--NQQLGGIVVGCLTKLPPDLPPEKIKP
PRIA_CHLPN      ----------------------------------------------------------------------
PRIA_CHLMU      ----------------------------------------------------------------------
PRIA_CHLTR      ----------------------------------------------------------------------
PRIA_ECOLI      ------------------FDYLLPE---GMVKAGCRVRVPFGKQQERI-GIVV---SVSDASELPNELKA
PRIA_HAEIN      MKIVRVALAVPLPRL---FDYFVPDDVS--LQIGMRVLVPFGTQKRV--AIVADFPTKSD--VPEDKLKA
PRIA_TREPA      ----------------------------------------------------------------------
PRIA_RICBR      ----------------------------------------------------------------------
PRIA_RICCN      ----------------------------------------------------------------------
PRIA_RICTY      ----------------------------------------------------------------------
PRIA_RICPR      ----------------------------------------------------------------------
PRIA_RICFE      ----------------------------------------------------------------------
PRIA_BORBU      ----------------------------------------------------------------------
PRIA_THEMA      ----------------------------------------------------------------------
PRIA_HELPY      ----------------------------------------------------------------------
PRIA_HELPJ      ----------------------------------------------------------------------
PRIA_RHORU      ----------------------------------------------------------------------
PRIA_BUCAI      ----------------------------------------------------------------------
PRIA_BUCAP      ----------------------------------------------------------------------
PRIA_MYCLE      ----------------------------------------------------------------------
PRIA_MYCTU      ----------------------------------------------------------------------
PRIA_MYCBO      ----------------------------------------------------------------------
MFD_HELPJ       ----------------------------------------------------------------------
MFD_HELPY       ----------------------------------------------------------------------
MFD_ECOLI       ----------------------------------------------------------------------
RECG_AQUAE      ----------------------------------------------------------------------
RECG_STRPN      ----------------------------------------------------------------------
MFD_STAHJ       ----------------------------------------------------------------------
MFD_HAEIN       ----------------------------------------------------------------------
MFD_SYNY3       ----------------------------------------------------------------------
RECG_MYCLE      ----------------------------------------------------------------------
MFD_STAAW       ----------------------------------------------------------------------
MFD_STAAS       ----------------------------------------------------------------------
MFD_STAAR       ----------------------------------------------------------------------
MFD_STAAN       ----------------------------------------------------------------------
MFD_STAAM       ----------------------------------------------------------------------
MFD_STAAC       ----------------------------------------------------------------------
MFD_STAAB       ----------------------------------------------------------------------
MFD_STAA8       ----------------------------------------------------------------------
MFD_STAA3       ----------------------------------------------------------------------
COMFA_BACSU     ----------------------------------------------------------------------
MFD_STAS1       ----------------------------------------------------------------------
RECG_MYCTU      ----------------------------------------------------------------------
RECG_MYCBO      ----------------------------------------------------------------------
UVRB_CLOTE      ----------------------------------------------------------------------
UVRB_CLAMS      ----------------------------------------------------------------------
UVRB_CLAM3      ----------------------------------------------------------------------
RECG_BORBU      ----------------------------------------------------------------------
MFD_STAES       ----------------------------------------------------------------------
MFD_STAEQ       ----------------------------------------------------------------------
UVRB_PROAC      ----------------------------------------------------------------------
UVRB_DESVV      ----------------------------------------------------------------------
UVRB_DESVH      ----------------------------------------------------------------------
MFD_MYXXA       ----------------------------------------------------------------------
UVRB_PELCD      ----------------------------------------------------------------------
UVRB_CHLL2      ----------------------------------------------------------------------
UVRB_BACTN      ----------------------------------------------------------------------
UVRB_BACFR      ----------------------------------------------------------------------
UVRB_BACFN      ----------------------------------------------------------------------
UVRB_LEGPL      ----------------------------------------------------------------------
UVRB_LEGPH      ----------------------------------------------------------------------
UVRB_LEGPC      ----------------------------------------------------------------------
UVRB_LEGPA      ----------------------------------------------------------------------
UVRB_CHLCH      ----------------------------------------------------------------------
RECG_STAAW      ----------------------------------------------------------------------
RECG_STAAS      ----------------------------------------------------------------------
RECG_STAAN      ----------------------------------------------------------------------
RECG_STAAM      ----------------------------------------------------------------------
RECG_STAAC      ----------------------------------------------------------------------
RECG_STAA8      ----------------------------------------------------------------------
UVRB_THIDA      ----------------------------------------------------------------------
UVRB_SHIFL      ----------------------------------------------------------------------
UVRB_SHIF8      ----------------------------------------------------------------------
UVRB_DESVM      ----------------------------------------------------------------------
UVRB_CHLPB      ----------------------------------------------------------------------
MFD_BACSU       ----------------------------------------------------------------------
UVRB_LACSS      ----------------------------------------------------------------------
UVRB_YERPY      ----------------------------------------------------------------------
UVRB_YERPS      ----------------------------------------------------------------------
UVRB_YERPP      ----------------------------------------------------------------------
UVRB_YERPN      ----------------------------------------------------------------------
UVRB_YERPG      ----------------------------------------------------------------------
UVRB_YERPE      ----------------------------------------------------------------------
UVRB_YERPB      ----------------------------------------------------------------------
UVRB_YERPA      ----------------------------------------------------------------------
UVRB_YERP3      ----------------------------------------------------------------------
UVRB_THEYD      ----------------------------------------------------------------------
UVRB_PASMU      ----------------------------------------------------------------------
UVRB_NITEU      ----------------------------------------------------------------------
UVRB_HAMD5      ----------------------------------------------------------------------
UVRB_FERNB      ----------------------------------------------------------------------
UVRB_DESDG      ----------------------------------------------------------------------
UVRB_METTH      ----------------------------------------------------------------------
UVRB_MANSM      ----------------------------------------------------------------------
MFD_BORBU       ----------------------------------------------------------------------
UVRB_SHISS      ----------------------------------------------------------------------
UVRB_SHIDS      ----------------------------------------------------------------------
UVRB_SHIBS      ----------------------------------------------------------------------
UVRB_SHIB3      ----------------------------------------------------------------------
UVRB_SALTY      ----------------------------------------------------------------------
UVRB_SALTI      ----------------------------------------------------------------------
UVRB_SALSV      ----------------------------------------------------------------------
UVRB_SALPK      ----------------------------------------------------------------------
UVRB_SALPC      ----------------------------------------------------------------------
UVRB_SALPB      ----------------------------------------------------------------------
UVRB_SALPA      ----------------------------------------------------------------------
UVRB_SALNS      ----------------------------------------------------------------------
UVRB_SALHS      ----------------------------------------------------------------------
UVRB_SALG2      ----------------------------------------------------------------------
UVRB_SALEP      ----------------------------------------------------------------------
UVRB_SALDC      ----------------------------------------------------------------------
UVRB_SALCH      ----------------------------------------------------------------------
UVRB_SALAR      ----------------------------------------------------------------------
UVRB_SALA4      ----------------------------------------------------------------------
UVRB_KLEP7      ----------------------------------------------------------------------
UVRB_KLEP3      ----------------------------------------------------------------------
UVRB_ESCF3      ----------------------------------------------------------------------
UVRB_ENT38      ----------------------------------------------------------------------
UVRB_ECOUT      ----------------------------------------------------------------------
UVRB_ECOSM      ----------------------------------------------------------------------
UVRB_ECOSE      ----------------------------------------------------------------------
UVRB_ECOLU      ----------------------------------------------------------------------
UVRB_ECOLI      ----------------------------------------------------------------------
UVRB_ECOLC      ----------------------------------------------------------------------
UVRB_ECOL6      ----------------------------------------------------------------------
UVRB_ECOL5      ----------------------------------------------------------------------
UVRB_ECOK1      ----------------------------------------------------------------------
UVRB_ECOHS      ----------------------------------------------------------------------
UVRB_ECODH      ----------------------------------------------------------------------
UVRB_ECOBW      ----------------------------------------------------------------------
UVRB_ECO8A      ----------------------------------------------------------------------
UVRB_ECO81      ----------------------------------------------------------------------
UVRB_ECO7I      ----------------------------------------------------------------------
UVRB_ECO5E      ----------------------------------------------------------------------
UVRB_ECO57      ----------------------------------------------------------------------
UVRB_ECO55      ----------------------------------------------------------------------
UVRB_ECO45      ----------------------------------------------------------------------
UVRB_ECO27      ----------------------------------------------------------------------
UVRB_ECO24      ----------------------------------------------------------------------
UVRB_CITK8      ----------------------------------------------------------------------
RECG_STAES      ----------------------------------------------------------------------
RECG_STAAR      ----------------------------------------------------------------------
UVRB_PECCP      ----------------------------------------------------------------------
UVRB_ERWCT      ----------------------------------------------------------------------
UVRB_DECAR      ----------------------------------------------------------------------
UVRB_COLP3      ----------------------------------------------------------------------
UVRB_AZOSE      ----------------------------------------------------------------------
MFD_BUCAI       ----------------------------------------------------------------------
UVRB_YERE8      ----------------------------------------------------------------------
UVRB_VIBF1      ----------------------------------------------------------------------
UVRB_SERP5      ----------------------------------------------------------------------
UVRB_PROMH      ----------------------------------------------------------------------
UVRB_PHOLL      ----------------------------------------------------------------------
UVRB_MYCA5      ----------------------------------------------------------------------
UVRB_HAEIN      ----------------------------------------------------------------------
UVRB_HAEI8      ----------------------------------------------------------------------
UVRB_GEOSL      ----------------------------------------------------------------------
UVB2_MYCPU      ----------------------------------------------------------------------
RECG_PASMU      ----------------------------------------------------------------------
DBP3_YARLI      ----------------------------------------------------------------------
UVRB_VIBVY      ----------------------------------------------------------------------
UVRB_VIBVU      ----------------------------------------------------------------------
UVRB_VIBPA      ----------------------------------------------------------------------
UVRB_THEAB      ----------------------------------------------------------------------
UVRB_IDILO      ----------------------------------------------------------------------
UVRB_HERA2      ----------------------------------------------------------------------
UVRB_COXBU      ----------------------------------------------------------------------
UVRB_COXBR      ----------------------------------------------------------------------
UVRB_COXBN      ----------------------------------------------------------------------
UVRB_COXB2      ----------------------------------------------------------------------
UVRB_CHLPD      ----------------------------------------------------------------------
UVRB_CARHZ      ----------------------------------------------------------------------
UVRB_BORPD      ----------------------------------------------------------------------
UVRB_AQUAE      ----------------------------------------------------------------------
DBP5_ASPFU      ----------------------------------------------------------------------
UVRB_SYNY3      ----------------------------------------------------------------------
UVRB_NATTJ      ----------------------------------------------------------------------
UVRB_FUSNN      ----------------------------------------------------------------------
UVRB_EDWI9      ----------------------------------------------------------------------
UVRB_CLOBM      ----------------------------------------------------------------------
UVRB_CLOBL      ----------------------------------------------------------------------
UVRB_CLOBK      ----------------------------------------------------------------------
UVRB_CLOBJ      ----------------------------------------------------------------------
UVRB_CLOB6      ----------------------------------------------------------------------
UVRB_CLOB1      ----------------------------------------------------------------------
UVRB_CLOAB      ----------------------------------------------------------------------
UVRB_CHRVO      ----------------------------------------------------------------------
UVRB_CAMFF      ----------------------------------------------------------------------
UVRB_BORA1      ----------------------------------------------------------------------
UVRB_ALISL      ----------------------------------------------------------------------
RHLB_ACTSZ      ----------------------------------------------------------------------
RECG_STAEQ      ----------------------------------------------------------------------
DBP5_NEOFI      ----------------------------------------------------------------------
UVRB_PSEPK      ----------------------------------------------------------------------
UVRB_PSEPF      ----------------------------------------------------------------------
UVRB_PSEF5      ----------------------------------------------------------------------
UVRB_PHOPR      ----------------------------------------------------------------------
UVRB_PARUW      ----------------------------------------------------------------------
UVRB_METST      ----------------------------------------------------------------------
UVRB_GLOVI      ----------------------------------------------------------------------
UVRB_COXB1      ----------------------------------------------------------------------
UVRB_CLOPS      ----------------------------------------------------------------------
UVRB_CLOPE      ----------------------------------------------------------------------
UVRB_CLOP1      ----------------------------------------------------------------------
RECG_HAEIN      ----------------------------------------------------------------------
UVRB_THEEB      ----------------------------------------------------------------------
UVRB_HELHP      ----------------------------------------------------------------------
UVRB_DEHE1      ----------------------------------------------------------------------
UVRB_CYAP7      ----------------------------------------------------------------------
UVRB_THICR      ----------------------------------------------------------------------
UVRB_PSYIN      ----------------------------------------------------------------------
UVRB_NITOC      ----------------------------------------------------------------------
UVRB_METS3      ----------------------------------------------------------------------
UVRB_ERWT9      ----------------------------------------------------------------------
UVRB_ENTFA      ----------------------------------------------------------------------
UVRB_BORPE      ----------------------------------------------------------------------
UVRB_BORPA      ----------------------------------------------------------------------
UVRB_BORBR      ----------------------------------------------------------------------
UVRB_ACTP2      ----------------------------------------------------------------------
RECG_TREPA      ----------------------------------------------------------------------
UVRB_PSEAE      ----------------------------------------------------------------------
UVRB_MYCGE      ----------------------------------------------------------------------
UVRB_KOSOT      ----------------------------------------------------------------------
UVRB_CYAP4      ----------------------------------------------------------------------
UVRB_ACIAD      ----------------------------------------------------------------------
UVRB_TROW8      ----------------------------------------------------------------------
UVRB_STRCO      ----------------------------------------------------------------------
UVRB_NEIMB      ----------------------------------------------------------------------
UVRB_NEIMA      ----------------------------------------------------------------------
UVRB_NEIGO      ----------------------------------------------------------------------
UVRB_NEIG1      ----------------------------------------------------------------------
UVRB_LACPL      ----------------------------------------------------------------------
UVRB_CLOBB      ----------------------------------------------------------------------
UVRB_CLOBA      ----------------------------------------------------------------------
UVRB_CHLTE      ----------------------------------------------------------------------
RHLB_VIBHB      ----------------------------------------------------------------------
UVRB_THET8      ----------------------------------------------------------------------
UVRB_STRAW      ----------------------------------------------------------------------
UVRB_RALSO      ----------------------------------------------------------------------
UVRB_RALEJ      ----------------------------------------------------------------------
UVRB_METMP      ----------------------------------------------------------------------
UVRB_LEPBL      ----------------------------------------------------------------------
UVRB_LEPBJ      ----------------------------------------------------------------------
UVRB_LACAC      ----------------------------------------------------------------------
UVRB_BORGA      ----------------------------------------------------------------------
UVRB_BORAP      ----------------------------------------------------------------------
UVRB_ANASP      ----------------------------------------------------------------------
RHLB_ALISL      ----------------------------------------------------------------------
RECG_BACSU      ----------------------------------------------------------------------
DED1_MAGGR      ----------------------------------------------------------------------
DED1_KLULA      ----------------------------------------------------------------------
UVRB_TREDE      ----------------------------------------------------------------------
UVRB_SYNJB      ----------------------------------------------------------------------
UVRB_PSEU2      ----------------------------------------------------------------------
UVRB_PSESM      ----------------------------------------------------------------------
UVRB_PSEHT      ----------------------------------------------------------------------
UVRB_PSE14      ----------------------------------------------------------------------
UVRB_METBU      ----------------------------------------------------------------------
UVRB_LEPIN      ----------------------------------------------------------------------
UVRB_LEPIC      ----------------------------------------------------------------------
UVRB_GEMAT      ----------------------------------------------------------------------
UVRB_EUBR3      ----------------------------------------------------------------------
UVRB_CLOB8      ----------------------------------------------------------------------
UVRB_BORBZ      ----------------------------------------------------------------------
UVRB_BORBU      ----------------------------------------------------------------------
UVRB_ACAM1      ----------------------------------------------------------------------
UVRB_THETN      ----------------------------------------------------------------------
UVRB_GEOKA      ----------------------------------------------------------------------
UVRB_BURPS      ----------------------------------------------------------------------
UVRB_BURMA      ----------------------------------------------------------------------
UVRB_BACCA      ----------------------------------------------------------------------
RHLB_VIBPA      ----------------------------------------------------------------------
UVRB_WOLSU      ----------------------------------------------------------------------
UVRB_THELT      ----------------------------------------------------------------------
UVRB_SYMTH      ----------------------------------------------------------------------
UVRB_MYCUA      ----------------------------------------------------------------------
UVRB_MYCPU      ----------------------------------------------------------------------
UVRB_LACCB      ----------------------------------------------------------------------
UVRB_LACC3      ----------------------------------------------------------------------
UVRB_CALS8      ----------------------------------------------------------------------
UVRB_BACCR      ----------------------------------------------------------------------
UVRB_ANATD      ----------------------------------------------------------------------
RHLB_VIBSL      ----------------------------------------------------------------------
PRP28_MAGGR     ----------------------------------------------------------------------
UVRB_XYLFT      ----------------------------------------------------------------------
UVRB_XYLFM      ----------------------------------------------------------------------
UVRB_XYLFA      ----------------------------------------------------------------------
UVRB_XYLF2      ----------------------------------------------------------------------
UVRB_TREPS      ----------------------------------------------------------------------
UVRB_TREPA      ----------------------------------------------------------------------
UVRB_SYNP6      ----------------------------------------------------------------------
UVRB_SYNJA      ----------------------------------------------------------------------
UVRB_SYNE7      ----------------------------------------------------------------------
UVRB_OCEIH      ----------------------------------------------------------------------
UVRB_CORDI      ----------------------------------------------------------------------
UVRB_BACLD      ----------------------------------------------------------------------
UVRB_BACHK      ----------------------------------------------------------------------
UVRB_BACCZ      ----------------------------------------------------------------------
UVRB_BACC1      ----------------------------------------------------------------------
UVRB_BACAN      ----------------------------------------------------------------------
UVRB_BACA2      ----------------------------------------------------------------------
DED1_LODEL      ----------------------------------------------------------------------
DBP2_CHAGB      ----------------------------------------------------------------------
DBP1_YEAST      ----------------------------------------------------------------------
DBP1_YEAS7      ----------------------------------------------------------------------
UVRB_THEFY      ----------------------------------------------------------------------
UVRB_STRZT      ----------------------------------------------------------------------
UVRB_NATPD      ----------------------------------------------------------------------
UVRB_METCA      ----------------------------------------------------------------------
UVRB_HALMA      ----------------------------------------------------------------------
UVRB_DEHSC      ----------------------------------------------------------------------
UVRB_CYTH3      ----------------------------------------------------------------------
UVRB_CLONN      ----------------------------------------------------------------------
UVRB_CHLAB      ----------------------------------------------------------------------
UVRB_AYWBP      ----------------------------------------------------------------------
RHLB_VIBCM      ----------------------------------------------------------------------
RHLB_VIBCH      ----------------------------------------------------------------------
RHLB_VIBC3      ----------------------------------------------------------------------
RHLB_MANSM      ----------------------------------------------------------------------
DED1_EMENI      ----------------------------------------------------------------------
DED1_ASPOR      ----------------------------------------------------------------------
DED1_ASPNC      ----------------------------------------------------------------------
DBP5_ASPTN      ----------------------------------------------------------------------
DBP1_CANGA      ----------------------------------------------------------------------
UVRB_STRZP      ----------------------------------------------------------------------
UVRB_STRZJ      ----------------------------------------------------------------------
UVRB_STRR6      ----------------------------------------------------------------------
UVRB_STRPS      ----------------------------------------------------------------------
UVRB_STRPN      ----------------------------------------------------------------------
UVRB_STRPJ      ----------------------------------------------------------------------
UVRB_STRPI      ----------------------------------------------------------------------
UVRB_STRP7      ----------------------------------------------------------------------
UVRB_STRP4      ----------------------------------------------------------------------
UVRB_STRP2      ----------------------------------------------------------------------
UVRB_MYCTU      ----------------------------------------------------------------------
UVRB_MYCPN      ----------------------------------------------------------------------
UVRB_MYCLE      ----------------------------------------------------------------------
UVRB_MYCBO      ----------------------------------------------------------------------
UVRB_METAC      ----------------------------------------------------------------------
UVRB_LISMO      ----------------------------------------------------------------------
UVRB_LISMF      ----------------------------------------------------------------------
UVRB_LISIN      ----------------------------------------------------------------------
UVRB_HELPY      ----------------------------------------------------------------------
UVRB_HAEDU      ----------------------------------------------------------------------
UVRB_CHLAD      ----------------------------------------------------------------------
UVRB_BIFLI      ----------------------------------------------------------------------
DED1_SCLS1      ----------------------------------------------------------------------
DED1_NEOFI      ----------------------------------------------------------------------
DED1_CANGA      ----------------------------------------------------------------------
DED1_ASPFU      ----------------------------------------------------------------------
DED1_AJECN      ----------------------------------------------------------------------
DBP5_ASPNC      ----------------------------------------------------------------------
UVRB_XANOR      ----------------------------------------------------------------------
UVRB_XANOP      ----------------------------------------------------------------------
UVRB_XANOM      ----------------------------------------------------------------------
UVRB_XANCP      ----------------------------------------------------------------------
UVRB_XANCB      ----------------------------------------------------------------------
UVRB_XANC8      ----------------------------------------------------------------------
UVRB_XANAC      ----------------------------------------------------------------------
UVRB_SYNPX      ----------------------------------------------------------------------
UVRB_SYNPW      ----------------------------------------------------------------------
UVRB_STAHJ      ----------------------------------------------------------------------
UVRB_RHOBA      ----------------------------------------------------------------------
UVRB_PROMP      ----------------------------------------------------------------------
UVRB_PROM0      ----------------------------------------------------------------------
UVRB_HALSA      ----------------------------------------------------------------------
UVRB_CHLTR      ----------------------------------------------------------------------
UVRB_CHLTA      ----------------------------------------------------------------------
UVRB_CHLCV      ----------------------------------------------------------------------
RH25_ORYSJ      ----------------------------------------------------------------------
PRP28_SCHPO     ----------------------------------------------------------------------
DED1_NEUCR      ----------------------------------------------------------------------
DED1_COCIM      ----------------------------------------------------------------------
DED1_ASPTN      ----------------------------------------------------------------------
UVRB_STRU0      ----------------------------------------------------------------------
UVRB_STRTD      ----------------------------------------------------------------------
UVRB_STRT2      ----------------------------------------------------------------------
UVRB_STRT1      ----------------------------------------------------------------------
UVRB_STAAW      ----------------------------------------------------------------------
UVRB_STAAS      ----------------------------------------------------------------------
UVRB_STAAR      ----------------------------------------------------------------------
UVRB_STAAN      ----------------------------------------------------------------------
UVRB_STAAM      ----------------------------------------------------------------------
UVRB_STAAC      ----------------------------------------------------------------------
UVRB_CHLPN      ----------------------------------------------------------------------
UVRB_BIFLO      ----------------------------------------------------------------------
UVRB_BACSU      ----------------------------------------------------------------------
UVRB_ANAPZ      ----------------------------------------------------------------------
RHLB_VIBVY      ----------------------------------------------------------------------
RHLB_VIBVU      ----------------------------------------------------------------------
RHLB_VIBFM      ----------------------------------------------------------------------
RHLB_VIBF1      ----------------------------------------------------------------------
RHLB_SHIF8      ----------------------------------------------------------------------
RHLB_PHOPR      ----------------------------------------------------------------------
RH53_ORYSJ      ----------------------------------------------------------------------
DED1_USTMA      ----------------------------------------------------------------------
DED1_PHANO      ----------------------------------------------------------------------
DBP3_PICGU      ----------------------------------------------------------------------
DBP2_NEUCR      ----------------------------------------------------------------------
UVRB_STAES      ----------------------------------------------------------------------
UVRB_STAEQ      ----------------------------------------------------------------------
UVRB_HELAH      ----------------------------------------------------------------------
UVRB_BACHD      ----------------------------------------------------------------------
RHLB_SALTY      ----------------------------------------------------------------------
RHLB_SALTI      ----------------------------------------------------------------------
RHLB_SALSV      ----------------------------------------------------------------------
RHLB_SALPK      ----------------------------------------------------------------------
RHLB_SALPC      ----------------------------------------------------------------------
RHLB_SALPB      ----------------------------------------------------------------------
RHLB_SALNS      ----------------------------------------------------------------------
RHLB_SALHS      ----------------------------------------------------------------------
RHLB_SALG2      ----------------------------------------------------------------------
RHLB_SALEP      ----------------------------------------------------------------------
RHLB_SALDC      ----------------------------------------------------------------------
RHLB_SALCH      ----------------------------------------------------------------------
RHLB_SALAR      ----------------------------------------------------------------------
RHLB_SALA4      ----------------------------------------------------------------------
RHLB_ERWT9      ----------------------------------------------------------------------
MFD_MYCTU       ----------------------------------------------------------------------
MFD_MYCBO       ----------------------------------------------------------------------
DED1_SCHPO      ----------------------------------------------------------------------
DED1_CHAGB      ----------------------------------------------------------------------
DBP5_EMENI      ----------------------------------------------------------------------
DBP5_ASPOR      ----------------------------------------------------------------------
DBP2_GIBZE      ----------------------------------------------------------------------
UVRB_SYNS3      ----------------------------------------------------------------------
UVRB_PROMM      ----------------------------------------------------------------------
UVRB_PROMA      ----------------------------------------------------------------------
UVRB_PROM3      ----------------------------------------------------------------------
UVRB_LACLS      ----------------------------------------------------------------------
UVRB_LACLM      ----------------------------------------------------------------------
UVRB_LACLA      ----------------------------------------------------------------------
UVRB_LACBA      ----------------------------------------------------------------------
UVRB_HELPJ      ----------------------------------------------------------------------
UVRB_HELPH      ----------------------------------------------------------------------
RHLB_SHISS      ----------------------------------------------------------------------
RHLB_SHIFL      ----------------------------------------------------------------------
RHLB_SHIDS      ----------------------------------------------------------------------
RHLB_SHIBS      ----------------------------------------------------------------------
RHLB_SHIB3      ----------------------------------------------------------------------
RHLB_KLEP3      ----------------------------------------------------------------------
RHLB_HAES1      ----------------------------------------------------------------------
RHLB_ESCF3      ----------------------------------------------------------------------
RHLB_ENTS8      ----------------------------------------------------------------------
RHLB_ECOUT      ----------------------------------------------------------------------
RHLB_ECOSM      ----------------------------------------------------------------------
RHLB_ECOSE      ----------------------------------------------------------------------
RHLB_ECOLU      ----------------------------------------------------------------------
RHLB_ECOLI      ----------------------------------------------------------------------
RHLB_ECOLC      ----------------------------------------------------------------------
RHLB_ECOL6      ----------------------------------------------------------------------
RHLB_ECOL5      ----------------------------------------------------------------------
RHLB_ECOK1      ----------------------------------------------------------------------
RHLB_ECOHS      ----------------------------------------------------------------------
RHLB_ECODH      ----------------------------------------------------------------------
RHLB_ECOBW      ----------------------------------------------------------------------
RHLB_ECO8A      ----------------------------------------------------------------------
RHLB_ECO81      ----------------------------------------------------------------------
RHLB_ECO7I      ----------------------------------------------------------------------
RHLB_ECO5E      ----------------------------------------------------------------------
RHLB_ECO55      ----------------------------------------------------------------------
RHLB_ECO45      ----------------------------------------------------------------------
RHLB_ECO27      ----------------------------------------------------------------------
RHLB_ECO24      ----------------------------------------------------------------------
PRP5_PHANO      ----------------------------------------------------------------------
DED1_ASHGO      ----------------------------------------------------------------------
DBP5_ASPCL      ----------------------------------------------------------------------
DBP2_MAGGR      ----------------------------------------------------------------------
UVRB_STRMU      ----------------------------------------------------------------------
UVRB_MYCMS      ----------------------------------------------------------------------
UVRB_METMA      ----------------------------------------------------------------------
UVRB_CAMHC      ----------------------------------------------------------------------
RHLB_HAES2      ----------------------------------------------------------------------
RHLB_HAEIN      ----------------------------------------------------------------------
RHLB_HAEIG      ----------------------------------------------------------------------
RHLB_HAEIE      ----------------------------------------------------------------------
RHLB_CITK8      ----------------------------------------------------------------------
RECG_SYNY3      ----------------------------------------------------------------------
DED1_YARLI      ----------------------------------------------------------------------
UVRB_STRSV      ----------------------------------------------------------------------
UVRB_STRGC      ----------------------------------------------------------------------
UVRB_MYCMO      ----------------------------------------------------------------------
UVRB_LEIXX      ----------------------------------------------------------------------
PRP28_NEUCR     ----------------------------------------------------------------------
DED1_ASPCL      ----------------------------------------------------------------------
UVRB_ZYMMO      ----------------------------------------------------------------------
UVRB_STRS7      ----------------------------------------------------------------------
UVRB_STRS2      ----------------------------------------------------------------------
UVRB_STRPZ      ----------------------------------------------------------------------
UVRB_STRPM      ----------------------------------------------------------------------
UVRB_STRPG      ----------------------------------------------------------------------
UVRB_STRPD      ----------------------------------------------------------------------
UVRB_STRPC      ----------------------------------------------------------------------
UVRB_STRPB      ----------------------------------------------------------------------
UVRB_STRP8      ----------------------------------------------------------------------
UVRB_STRP6      ----------------------------------------------------------------------
UVRB_STRP3      ----------------------------------------------------------------------
UVRB_STRP1      ----------------------------------------------------------------------
UVRB_STREM      ----------------------------------------------------------------------
UVRB_STRE4      ----------------------------------------------------------------------
UVRB_STRA5      ----------------------------------------------------------------------
UVRB_STRA3      ----------------------------------------------------------------------
UVRB_STRA1      ----------------------------------------------------------------------
UVRB_PROMT      ----------------------------------------------------------------------
UVRB_PROM1      ----------------------------------------------------------------------
UVRB_MICLC      ----------------------------------------------------------------------
UVRB_BACSK      ----------------------------------------------------------------------
RHLB_ECO57      ----------------------------------------------------------------------
DED1_BOTFB      ----------------------------------------------------------------------
UVRB_STRPF      ----------------------------------------------------------------------
UVRB_STAS1      ----------------------------------------------------------------------
UVRB_RICAE      ----------------------------------------------------------------------
UVRB_PROM4      ----------------------------------------------------------------------
UVRB_MYCPE      ----------------------------------------------------------------------
UVRB_MICAN      ----------------------------------------------------------------------
UVRB_FRATT      ----------------------------------------------------------------------
ROK1_NEOFI      ----------------------------------------------------------------------
ROK1_ASPFU      ----------------------------------------------------------------------
RHLB_SERP5      ----------------------------------------------------------------------
RHLB_PHOLL      ----------------------------------------------------------------------
RHLB_KLEP7      ----------------------------------------------------------------------
RHLB_AERHH      ----------------------------------------------------------------------
RH3_ARATH       ----------------------------------------------------------------------
PRP28_ASPOR     ----------------------------------------------------------------------
DDX47_DICDI     ----------------------------------------------------------------------
DBP5_CHAGB      ----------------------------------------------------------------------
DBP3_GIBZE      ----------------------------------------------------------------------
UVRB_ONYPE      ----------------------------------------------------------------------
UVRB_CAMJR      ----------------------------------------------------------------------
UVRB_CAMJE      ----------------------------------------------------------------------
UVRB_ANAMM      ----------------------------------------------------------------------
UVRB_ANAMF      ----------------------------------------------------------------------
SPB4_DEBHA      ----------------------------------------------------------------------
RHLB_ENT38      ----------------------------------------------------------------------
RHLB_AERS4      ----------------------------------------------------------------------
RECG_ECOLI      ----------------------------------------------------------------------
PRP28_COCIM     ----------------------------------------------------------------------
I4A3A_XENLA     ----------------------------------------------------------------------
DCL2_ASPOR      ----------------------------------------------------------------------
DBP5_CANGA      ----------------------------------------------------------------------
DBP2_SCLS1      ----------------------------------------------------------------------
DBP2_BOTFB      ----------------------------------------------------------------------
UVRB_RICRS      ----------------------------------------------------------------------
UVRB_RICRO      ----------------------------------------------------------------------
UVRB_RICPU      ----------------------------------------------------------------------
UVRB_RICCN      ----------------------------------------------------------------------
UVRB_LEPBP      ----------------------------------------------------------------------
UVRB_LEPBA      ----------------------------------------------------------------------
UVRB_LACJO      ----------------------------------------------------------------------
UVRB_LACGA      ----------------------------------------------------------------------
UVRB_BEUC1      ----------------------------------------------------------------------
RRP3_CHAGB      ----------------------------------------------------------------------
ROK1_ASPNC      ----------------------------------------------------------------------
RHLB_YERPY      ----------------------------------------------------------------------
RHLB_YERPS      ----------------------------------------------------------------------
RHLB_YERPP      ----------------------------------------------------------------------
RHLB_YERPN      ----------------------------------------------------------------------
RHLB_YERPE      ----------------------------------------------------------------------
RHLB_YERPB      ----------------------------------------------------------------------
RHLB_YERPA      ----------------------------------------------------------------------
RHLB_YERP3      ----------------------------------------------------------------------
RH47A_ORYSJ     ----------------------------------------------------------------------
RH31_ORYSJ      ----------------------------------------------------------------------
PRP28_GIBZE     ----------------------------------------------------------------------
IF4A3_XENTR     ----------------------------------------------------------------------
IF4A3_TAEGU     ----------------------------------------------------------------------
IF4A3_SALSA     ----------------------------------------------------------------------
IF4A3_RAT       ----------------------------------------------------------------------
IF4A3_PIG       ----------------------------------------------------------------------
IF4A3_MOUSE     ----------------------------------------------------------------------
IF4A3_MACFA     ----------------------------------------------------------------------
IF4A3_HUMAN     ----------------------------------------------------------------------
IF4A3_CHICK     ----------------------------------------------------------------------
IF4A3_BOVIN     ----------------------------------------------------------------------
I4A3B_XENLA     ----------------------------------------------------------------------
DED1_PICGU      ----------------------------------------------------------------------
DED1_GIBZE      ----------------------------------------------------------------------
DED1_DEBHA      ----------------------------------------------------------------------
DED1_CRYNE      ----------------------------------------------------------------------
DBP5_PICST      ----------------------------------------------------------------------
UVRB_WOLTR      ----------------------------------------------------------------------
UVRB_CHLMU      ----------------------------------------------------------------------
UVRB_ARTCA      ----------------------------------------------------------------------
ROK1_ASPOR      ----------------------------------------------------------------------
RHLB_PROMH      ----------------------------------------------------------------------
RHLB_HAMD5      ----------------------------------------------------------------------
RECG_ECO57      ----------------------------------------------------------------------
PRP28_ASPTN     ----------------------------------------------------------------------
PRP28_ASPNC     ----------------------------------------------------------------------
MFD_BUCBP       ----------------------------------------------------------------------
DBP5_PHANO      ----------------------------------------------------------------------
DBP3_CRYNE      ----------------------------------------------------------------------
UVRB_RICAH      ----------------------------------------------------------------------
UVRB_ARTS2      ----------------------------------------------------------------------
UVRB_ARTAT      ----------------------------------------------------------------------
ROK1_COCIM      ----------------------------------------------------------------------
ROK1_ASPCL      ----------------------------------------------------------------------
RHLB_PECCP      ----------------------------------------------------------------------
RHLB_PASMU      ----------------------------------------------------------------------
RHLB_ERWCT      ----------------------------------------------------------------------
PRP28_EMENI     ----------------------------------------------------------------------
PRP28_CANAL     ----------------------------------------------------------------------
PRP28_ASPCL     ----------------------------------------------------------------------
DCL2_EMENI      ----------------------------------------------------------------------
DBP5_YEAST      ----------------------------------------------------------------------
DBP5_YEAS7      ----------------------------------------------------------------------
DBP5_NEUCR      ----------------------------------------------------------------------
UVRB_RICPR      ----------------------------------------------------------------------
SPB42_CANAL     ----------------------------------------------------------------------
SPB41_CANAL     ----------------------------------------------------------------------
RHLB_SODGM      ----------------------------------------------------------------------
PRP28_NEOFI     ----------------------------------------------------------------------
PRP28_DEBHA     ----------------------------------------------------------------------
PRP28_ASPFU     ----------------------------------------------------------------------
MS116_SCHPO     ----------------------------------------------------------------------
DDX23_PONAB     ----------------------------------------------------------------------
DDX23_HUMAN     ----------------------------------------------------------------------
DBP3_SCHPO      ----------------------------------------------------------------------
DBP3_LODEL      ----------------------------------------------------------------------
UVRB_RICTY      ----------------------------------------------------------------------
UVRB_RICM5      ----------------------------------------------------------------------
UVRB_RICFE      ----------------------------------------------------------------------
UVRB_RICBR      ----------------------------------------------------------------------
UVRB_RICB8      ----------------------------------------------------------------------
UVRB_RENSM      ----------------------------------------------------------------------
RRP3_BOTFB      ----------------------------------------------------------------------
RH52A_ORYSJ     ----------------------------------------------------------------------
DEAD_BUCBP      ----------------------------------------------------------------------
DDX4_RANLE      ----------------------------------------------------------------------
DCL4_ARATH      ----------------------------------------------------------------------
DCL2_MAGGR      ----------------------------------------------------------------------
DCL22_ASPNC     ----------------------------------------------------------------------
DBP5_MAGGR      ----------------------------------------------------------------------
DBP5_CRYNE      ----------------------------------------------------------------------
DBP4_ASPCL      ----------------------------------------------------------------------
DBP3_PICST      ----------------------------------------------------------------------
DBP2_ASPFU      ----------------------------------------------------------------------
SKI2_YEAST      ----------------------------------------------------------------------
ROK1_EMENI      ----------------------------------------------------------------------
RH47B_ORYSJ     ----------------------------------------------------------------------
RH26_ORYSJ      ----------------------------------------------------------------------
PRP5_YEAST      ----------------------------------------------------------------------
PRP5_YEAS7      ----------------------------------------------------------------------
PRP28_CRYNE     ----------------------------------------------------------------------
PRP28_CANGA     ----------------------------------------------------------------------
MS116_PHANO     ----------------------------------------------------------------------
IF4A_DICDI      ----------------------------------------------------------------------
DBP4_ASHGO      ----------------------------------------------------------------------
DBP3_VANPO      ----------------------------------------------------------------------
DBP2_NEOFI      ----------------------------------------------------------------------
DBP2_ASPOR      ----------------------------------------------------------------------
DBP2_ASPNC      ----------------------------------------------------------------------
DBP2_ASPCL      ----------------------------------------------------------------------
UVRB_CHLCV      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           IAEVLDFSPVLTPEQLWLAEELRKSVFSYKISILKAMLPGFLNSSYDKILYPLEGLSQEERVRLFGSEDS
PRIA_BACSU      VEDLLDLTPVLTEELMILSSWLSDKTLSFKITALQAMLPXXXXXXXXXXXXXXHGADLPPQVRLFSETKT
PRIA_SYNY3      IQDVIVFAPHYWRLLHWLAEYYCTELITV---IRMALPPGLLQRSQRRI--KLNGDRLPSDWPLFLSQPS
PRIA_CHLPN      ----------------------------------------------------------------------
PRIA_CHLMU      ----------------------------------------------------------------------
PRIA_CHLTR      ----------------------------------------------------------------------
PRIA_ECOLI      VVEVLDSEPVFTHSLLWAAD--------------------------------------------------
PRIA_HAEIN      ILQPLDLAPLFTP---------------------------------------------------------
PRIA_TREPA      ----------------------------------------------------------------------
PRIA_RICBR      ----------------------------------------------------------------------
PRIA_RICCN      ----------------------------------------------------------------------
PRIA_RICTY      ----------------------------------------------------------------------
PRIA_RICPR      ----------------------------------------------------------------------
PRIA_RICFE      ----------------------------------------------------------------------
PRIA_BORBU      ----------------------------------------------------------------------
PRIA_THEMA      ----------------------------------------------------------------------
PRIA_HELPY      ----------------------------------------------------------------------
PRIA_HELPJ      ----------------------------------------------------------------------
PRIA_RHORU      ----------------------------------------------------------------------
PRIA_BUCAI      ----------------------------------------------------------------------
PRIA_BUCAP      ----------------------------------------------------------------------
PRIA_MYCLE      ----------------------------------------------------------------------
PRIA_MYCTU      ----------------------------------------------------------------------
PRIA_MYCBO      ----------------------------------------------------------------------
MFD_HELPJ       ----------------------------------------------------------------------
MFD_HELPY       ----------------------------------------------------------------------
MFD_ECOLI       ----------------------------------------------------------------------
RECG_AQUAE      ----------------------------------------------------------------------
RECG_STRPN      ----------------------------------------------------------------------
MFD_STAHJ       ----------------------------------------------------------------------
MFD_HAEIN       ----------------------------------------------------------------------
MFD_SYNY3       ----------------------------------------------------------------------
RECG_MYCLE      ----------------------------------------------------------------------
MFD_STAAW       ----------------------------------------------------------------------
MFD_STAAS       ----------------------------------------------------------------------
MFD_STAAR       ----------------------------------------------------------------------
MFD_STAAN       ----------------------------------------------------------------------
MFD_STAAM       ----------------------------------------------------------------------
MFD_STAAC       ----------------------------------------------------------------------
MFD_STAAB       ----------------------------------------------------------------------
MFD_STAA8       ----------------------------------------------------------------------
MFD_STAA3       ----------------------------------------------------------------------
COMFA_BACSU     ----------------------------------------------------------------------
MFD_STAS1       ----------------------------------------------------------------------
RECG_MYCTU      ----------------------------------------------------------------------
RECG_MYCBO      ----------------------------------------------------------------------
UVRB_CLOTE      ----------------------------------------------------------------------
UVRB_CLAMS      ----------------------------------------------------------------------
UVRB_CLAM3      ----------------------------------------------------------------------
RECG_BORBU      ----------------------------------------------------------------------
MFD_STAES       ----------------------------------------------------------------------
MFD_STAEQ       ----------------------------------------------------------------------
UVRB_PROAC      ----------------------------------------------------------------------
UVRB_DESVV      ----------------------------------------------------------------------
UVRB_DESVH      ----------------------------------------------------------------------
MFD_MYXXA       ----------------------------------------------------------------------
UVRB_PELCD      ----------------------------------------------------------------------
UVRB_CHLL2      ----------------------------------------------------------------------
UVRB_BACTN      ----------------------------------------------------------------------
UVRB_BACFR      ----------------------------------------------------------------------
UVRB_BACFN      ----------------------------------------------------------------------
UVRB_LEGPL      ----------------------------------------------------------------------
UVRB_LEGPH      ----------------------------------------------------------------------
UVRB_LEGPC      ----------------------------------------------------------------------
UVRB_LEGPA      ----------------------------------------------------------------------
UVRB_CHLCH      ----------------------------------------------------------------------
RECG_STAAW      ----------------------------------------------------------------------
RECG_STAAS      ----------------------------------------------------------------------
RECG_STAAN      ----------------------------------------------------------------------
RECG_STAAM      ----------------------------------------------------------------------
RECG_STAAC      ----------------------------------------------------------------------
RECG_STAA8      ----------------------------------------------------------------------
UVRB_THIDA      ----------------------------------------------------------------------
UVRB_SHIFL      ----------------------------------------------------------------------
UVRB_SHIF8      ----------------------------------------------------------------------
UVRB_DESVM      ----------------------------------------------------------------------
UVRB_CHLPB      ----------------------------------------------------------------------
MFD_BACSU       ----------------------------------------------------------------------
UVRB_LACSS      ----------------------------------------------------------------------
UVRB_YERPY      ----------------------------------------------------------------------
UVRB_YERPS      ----------------------------------------------------------------------
UVRB_YERPP      ----------------------------------------------------------------------
UVRB_YERPN      ----------------------------------------------------------------------
UVRB_YERPG      ----------------------------------------------------------------------
UVRB_YERPE      ----------------------------------------------------------------------
UVRB_YERPB      ----------------------------------------------------------------------
UVRB_YERPA      ----------------------------------------------------------------------
UVRB_YERP3      ----------------------------------------------------------------------
UVRB_THEYD      ----------------------------------------------------------------------
UVRB_PASMU      ----------------------------------------------------------------------
UVRB_NITEU      ----------------------------------------------------------------------
UVRB_HAMD5      ----------------------------------------------------------------------
UVRB_FERNB      ----------------------------------------------------------------------
UVRB_DESDG      ----------------------------------------------------------------------
UVRB_METTH      ----------------------------------------------------------------------
UVRB_MANSM      ----------------------------------------------------------------------
MFD_BORBU       ----------------------------------------------------------------------
UVRB_SHISS      ----------------------------------------------------------------------
UVRB_SHIDS      ----------------------------------------------------------------------
UVRB_SHIBS      ----------------------------------------------------------------------
UVRB_SHIB3      ----------------------------------------------------------------------
UVRB_SALTY      ----------------------------------------------------------------------
UVRB_SALTI      ----------------------------------------------------------------------
UVRB_SALSV      ----------------------------------------------------------------------
UVRB_SALPK      ----------------------------------------------------------------------
UVRB_SALPC      ----------------------------------------------------------------------
UVRB_SALPB      ----------------------------------------------------------------------
UVRB_SALPA      ----------------------------------------------------------------------
UVRB_SALNS      ----------------------------------------------------------------------
UVRB_SALHS      ----------------------------------------------------------------------
UVRB_SALG2      ----------------------------------------------------------------------
UVRB_SALEP      ----------------------------------------------------------------------
UVRB_SALDC      ----------------------------------------------------------------------
UVRB_SALCH      ----------------------------------------------------------------------
UVRB_SALAR      ----------------------------------------------------------------------
UVRB_SALA4      ----------------------------------------------------------------------
UVRB_KLEP7      ----------------------------------------------------------------------
UVRB_KLEP3      ----------------------------------------------------------------------
UVRB_ESCF3      ----------------------------------------------------------------------
UVRB_ENT38      ----------------------------------------------------------------------
UVRB_ECOUT      ----------------------------------------------------------------------
UVRB_ECOSM      ----------------------------------------------------------------------
UVRB_ECOSE      ----------------------------------------------------------------------
UVRB_ECOLU      ----------------------------------------------------------------------
UVRB_ECOLI      ----------------------------------------------------------------------
UVRB_ECOLC      ----------------------------------------------------------------------
UVRB_ECOL6      ----------------------------------------------------------------------
UVRB_ECOL5      ----------------------------------------------------------------------
UVRB_ECOK1      ----------------------------------------------------------------------
UVRB_ECOHS      ----------------------------------------------------------------------
UVRB_ECODH      ----------------------------------------------------------------------
UVRB_ECOBW      ----------------------------------------------------------------------
UVRB_ECO8A      ----------------------------------------------------------------------
UVRB_ECO81      ----------------------------------------------------------------------
UVRB_ECO7I      ----------------------------------------------------------------------
UVRB_ECO5E      ----------------------------------------------------------------------
UVRB_ECO57      ----------------------------------------------------------------------
UVRB_ECO55      ----------------------------------------------------------------------
UVRB_ECO45      ----------------------------------------------------------------------
UVRB_ECO27      ----------------------------------------------------------------------
UVRB_ECO24      ----------------------------------------------------------------------
UVRB_CITK8      ----------------------------------------------------------------------
RECG_STAES      ----------------------------------------------------------------------
RECG_STAAR      ----------------------------------------------------------------------
UVRB_PECCP      ----------------------------------------------------------------------
UVRB_ERWCT      ----------------------------------------------------------------------
UVRB_DECAR      ----------------------------------------------------------------------
UVRB_COLP3      ----------------------------------------------------------------------
UVRB_AZOSE      ----------------------------------------------------------------------
MFD_BUCAI       ----------------------------------------------------------------------
UVRB_YERE8      ----------------------------------------------------------------------
UVRB_VIBF1      ----------------------------------------------------------------------
UVRB_SERP5      ----------------------------------------------------------------------
UVRB_PROMH      ----------------------------------------------------------------------
UVRB_PHOLL      ----------------------------------------------------------------------
UVRB_MYCA5      ----------------------------------------------------------------------
UVRB_HAEIN      ----------------------------------------------------------------------
UVRB_HAEI8      ----------------------------------------------------------------------
UVRB_GEOSL      ----------------------------------------------------------------------
UVB2_MYCPU      ----------------------------------------------------------------------
RECG_PASMU      ----------------------------------------------------------------------
DBP3_YARLI      ----------------------------------------------------------------------
UVRB_VIBVY      ----------------------------------------------------------------------
UVRB_VIBVU      ----------------------------------------------------------------------
UVRB_VIBPA      ----------------------------------------------------------------------
UVRB_THEAB      ----------------------------------------------------------------------
UVRB_IDILO      ----------------------------------------------------------------------
UVRB_HERA2      ----------------------------------------------------------------------
UVRB_COXBU      ----------------------------------------------------------------------
UVRB_COXBR      ----------------------------------------------------------------------
UVRB_COXBN      ----------------------------------------------------------------------
UVRB_COXB2      ----------------------------------------------------------------------
UVRB_CHLPD      ----------------------------------------------------------------------
UVRB_CARHZ      ----------------------------------------------------------------------
UVRB_BORPD      ----------------------------------------------------------------------
UVRB_AQUAE      ----------------------------------------------------------------------
DBP5_ASPFU      ----------------------------------------------------------------------
UVRB_SYNY3      ----------------------------------------------------------------------
UVRB_NATTJ      ----------------------------------------------------------------------
UVRB_FUSNN      ----------------------------------------------------------------------
UVRB_EDWI9      ----------------------------------------------------------------------
UVRB_CLOBM      ----------------------------------------------------------------------
UVRB_CLOBL      ----------------------------------------------------------------------
UVRB_CLOBK      ----------------------------------------------------------------------
UVRB_CLOBJ      ----------------------------------------------------------------------
UVRB_CLOB6      ----------------------------------------------------------------------
UVRB_CLOB1      ----------------------------------------------------------------------
UVRB_CLOAB      ----------------------------------------------------------------------
UVRB_CHRVO      ----------------------------------------------------------------------
UVRB_CAMFF      ----------------------------------------------------------------------
UVRB_BORA1      ----------------------------------------------------------------------
UVRB_ALISL      ----------------------------------------------------------------------
RHLB_ACTSZ      ----------------------------------------------------------------------
RECG_STAEQ      ----------------------------------------------------------------------
DBP5_NEOFI      ----------------------------------------------------------------------
UVRB_PSEPK      ----------------------------------------------------------------------
UVRB_PSEPF      ----------------------------------------------------------------------
UVRB_PSEF5      ----------------------------------------------------------------------
UVRB_PHOPR      ----------------------------------------------------------------------
UVRB_PARUW      ----------------------------------------------------------------------
UVRB_METST      ----------------------------------------------------------------------
UVRB_GLOVI      ----------------------------------------------------------------------
UVRB_COXB1      ----------------------------------------------------------------------
UVRB_CLOPS      ----------------------------------------------------------------------
UVRB_CLOPE      ----------------------------------------------------------------------
UVRB_CLOP1      ----------------------------------------------------------------------
RECG_HAEIN      ----------------------------------------------------------------------
UVRB_THEEB      ----------------------------------------------------------------------
UVRB_HELHP      ----------------------------------------------------------------------
UVRB_DEHE1      ----------------------------------------------------------------------
UVRB_CYAP7      ----------------------------------------------------------------------
UVRB_THICR      ----------------------------------------------------------------------
UVRB_PSYIN      ----------------------------------------------------------------------
UVRB_NITOC      ----------------------------------------------------------------------
UVRB_METS3      ----------------------------------------------------------------------
UVRB_ERWT9      ----------------------------------------------------------------------
UVRB_ENTFA      ----------------------------------------------------------------------
UVRB_BORPE      ----------------------------------------------------------------------
UVRB_BORPA      ----------------------------------------------------------------------
UVRB_BORBR      ----------------------------------------------------------------------
UVRB_ACTP2      ----------------------------------------------------------------------
RECG_TREPA      ----------------------------------------------------------------------
UVRB_PSEAE      ----------------------------------------------------------------------
UVRB_MYCGE      ----------------------------------------------------------------------
UVRB_KOSOT      ----------------------------------------------------------------------
UVRB_CYAP4      ----------------------------------------------------------------------
UVRB_ACIAD      ----------------------------------------------------------------------
UVRB_TROW8      ----------------------------------------------------------------------
UVRB_STRCO      ----------------------------------------------------------------------
UVRB_NEIMB      ----------------------------------------------------------------------
UVRB_NEIMA      ----------------------------------------------------------------------
UVRB_NEIGO      ----------------------------------------------------------------------
UVRB_NEIG1      ----------------------------------------------------------------------
UVRB_LACPL      ----------------------------------------------------------------------
UVRB_CLOBB      ----------------------------------------------------------------------
UVRB_CLOBA      ----------------------------------------------------------------------
UVRB_CHLTE      ----------------------------------------------------------------------
RHLB_VIBHB      ----------------------------------------------------------------------
UVRB_THET8      ----------------------------------------------------------------------
UVRB_STRAW      ----------------------------------------------------------------------
UVRB_RALSO      ----------------------------------------------------------------------
UVRB_RALEJ      ----------------------------------------------------------------------
UVRB_METMP      ----------------------------------------------------------------------
UVRB_LEPBL      ----------------------------------------------------------------------
UVRB_LEPBJ      ----------------------------------------------------------------------
UVRB_LACAC      ----------------------------------------------------------------------
UVRB_BORGA      ----------------------------------------------------------------------
UVRB_BORAP      ----------------------------------------------------------------------
UVRB_ANASP      ----------------------------------------------------------------------
RHLB_ALISL      ----------------------------------------------------------------------
RECG_BACSU      ----------------------------------------------------------------------
DED1_MAGGR      ----------------------------------------------------------------------
DED1_KLULA      ----------------------------------------------------------------------
UVRB_TREDE      ----------------------------------------------------------------------
UVRB_SYNJB      ----------------------------------------------------------------------
UVRB_PSEU2      ----------------------------------------------------------------------
UVRB_PSESM      ----------------------------------------------------------------------
UVRB_PSEHT      ----------------------------------------------------------------------
UVRB_PSE14      ----------------------------------------------------------------------
UVRB_METBU      ----------------------------------------------------------------------
UVRB_LEPIN      ----------------------------------------------------------------------
UVRB_LEPIC      ----------------------------------------------------------------------
UVRB_GEMAT      ----------------------------------------------------------------------
UVRB_EUBR3      ----------------------------------------------------------------------
UVRB_CLOB8      ----------------------------------------------------------------------
UVRB_BORBZ      ----------------------------------------------------------------------
UVRB_BORBU      ----------------------------------------------------------------------
UVRB_ACAM1      ----------------------------------------------------------------------
UVRB_THETN      ----------------------------------------------------------------------
UVRB_GEOKA      ----------------------------------------------------------------------
UVRB_BURPS      ----------------------------------------------------------------------
UVRB_BURMA      ----------------------------------------------------------------------
UVRB_BACCA      ----------------------------------------------------------------------
RHLB_VIBPA      ----------------------------------------------------------------------
UVRB_WOLSU      ----------------------------------------------------------------------
UVRB_THELT      ----------------------------------------------------------------------
UVRB_SYMTH      ----------------------------------------------------------------------
UVRB_MYCUA      ----------------------------------------------------------------------
UVRB_MYCPU      ----------------------------------------------------------------------
UVRB_LACCB      ----------------------------------------------------------------------
UVRB_LACC3      ----------------------------------------------------------------------
UVRB_CALS8      ----------------------------------------------------------------------
UVRB_BACCR      ----------------------------------------------------------------------
UVRB_ANATD      ----------------------------------------------------------------------
RHLB_VIBSL      ----------------------------------------------------------------------
PRP28_MAGGR     ----------------------------------------------------------------------
UVRB_XYLFT      ----------------------------------------------------------------------
UVRB_XYLFM      ----------------------------------------------------------------------
UVRB_XYLFA      ----------------------------------------------------------------------
UVRB_XYLF2      ----------------------------------------------------------------------
UVRB_TREPS      ----------------------------------------------------------------------
UVRB_TREPA      ----------------------------------------------------------------------
UVRB_SYNP6      ----------------------------------------------------------------------
UVRB_SYNJA      ----------------------------------------------------------------------
UVRB_SYNE7      ----------------------------------------------------------------------
UVRB_OCEIH      ----------------------------------------------------------------------
UVRB_CORDI      ----------------------------------------------------------------------
UVRB_BACLD      ----------------------------------------------------------------------
UVRB_BACHK      ----------------------------------------------------------------------
UVRB_BACCZ      ----------------------------------------------------------------------
UVRB_BACC1      ----------------------------------------------------------------------
UVRB_BACAN      ----------------------------------------------------------------------
UVRB_BACA2      ----------------------------------------------------------------------
DED1_LODEL      ----------------------------------------------------------------------
DBP2_CHAGB      ----------------------------------------------------------------------
DBP1_YEAST      ----------------------------------------------------------------------
DBP1_YEAS7      ----------------------------------------------------------------------
UVRB_THEFY      ----------------------------------------------------------------------
UVRB_STRZT      ----------------------------------------------------------------------
UVRB_NATPD      ----------------------------------------------------------------------
UVRB_METCA      ----------------------------------------------------------------------
UVRB_HALMA      ----------------------------------------------------------------------
UVRB_DEHSC      ----------------------------------------------------------------------
UVRB_CYTH3      ----------------------------------------------------------------------
UVRB_CLONN      ----------------------------------------------------------------------
UVRB_CHLAB      ----------------------------------------------------------------------
UVRB_AYWBP      ----------------------------------------------------------------------
RHLB_VIBCM      ----------------------------------------------------------------------
RHLB_VIBCH      ----------------------------------------------------------------------
RHLB_VIBC3      ----------------------------------------------------------------------
RHLB_MANSM      ----------------------------------------------------------------------
DED1_EMENI      ----------------------------------------------------------------------
DED1_ASPOR      ----------------------------------------------------------------------
DED1_ASPNC      ----------------------------------------------------------------------
DBP5_ASPTN      ----------------------------------------------------------------------
DBP1_CANGA      ----------------------------------------------------------------------
UVRB_STRZP      ----------------------------------------------------------------------
UVRB_STRZJ      ----------------------------------------------------------------------
UVRB_STRR6      ----------------------------------------------------------------------
UVRB_STRPS      ----------------------------------------------------------------------
UVRB_STRPN      ----------------------------------------------------------------------
UVRB_STRPJ      ----------------------------------------------------------------------
UVRB_STRPI      ----------------------------------------------------------------------
UVRB_STRP7      ----------------------------------------------------------------------
UVRB_STRP4      ----------------------------------------------------------------------
UVRB_STRP2      ----------------------------------------------------------------------
UVRB_MYCTU      ----------------------------------------------------------------------
UVRB_MYCPN      ----------------------------------------------------------------------
UVRB_MYCLE      ----------------------------------------------------------------------
UVRB_MYCBO      ----------------------------------------------------------------------
UVRB_METAC      ----------------------------------------------------------------------
UVRB_LISMO      ----------------------------------------------------------------------
UVRB_LISMF      ----------------------------------------------------------------------
UVRB_LISIN      ----------------------------------------------------------------------
UVRB_HELPY      ----------------------------------------------------------------------
UVRB_HAEDU      ----------------------------------------------------------------------
UVRB_CHLAD      ----------------------------------------------------------------------
UVRB_BIFLI      ----------------------------------------------------------------------
DED1_SCLS1      ----------------------------------------------------------------------
DED1_NEOFI      ----------------------------------------------------------------------
DED1_CANGA      ----------------------------------------------------------------------
DED1_ASPFU      ----------------------------------------------------------------------
DED1_AJECN      ----------------------------------------------------------------------
DBP5_ASPNC      ----------------------------------------------------------------------
UVRB_XANOR      ----------------------------------------------------------------------
UVRB_XANOP      ----------------------------------------------------------------------
UVRB_XANOM      ----------------------------------------------------------------------
UVRB_XANCP      ----------------------------------------------------------------------
UVRB_XANCB      ----------------------------------------------------------------------
UVRB_XANC8      ----------------------------------------------------------------------
UVRB_XANAC      ----------------------------------------------------------------------
UVRB_SYNPX      ----------------------------------------------------------------------
UVRB_SYNPW      ----------------------------------------------------------------------
UVRB_STAHJ      ----------------------------------------------------------------------
UVRB_RHOBA      ----------------------------------------------------------------------
UVRB_PROMP      ----------------------------------------------------------------------
UVRB_PROM0      ----------------------------------------------------------------------
UVRB_HALSA      ----------------------------------------------------------------------
UVRB_CHLTR      ----------------------------------------------------------------------
UVRB_CHLTA      ----------------------------------------------------------------------
UVRB_CHLCV      ----------------------------------------------------------------------
RH25_ORYSJ      ----------------------------------------------------------------------
PRP28_SCHPO     ----------------------------------------------------------------------
DED1_NEUCR      ----------------------------------------------------------------------
DED1_COCIM      ----------------------------------------------------------------------
DED1_ASPTN      ----------------------------------------------------------------------
UVRB_STRU0      ----------------------------------------------------------------------
UVRB_STRTD      ----------------------------------------------------------------------
UVRB_STRT2      ----------------------------------------------------------------------
UVRB_STRT1      ----------------------------------------------------------------------
UVRB_STAAW      ----------------------------------------------------------------------
UVRB_STAAS      ----------------------------------------------------------------------
UVRB_STAAR      ----------------------------------------------------------------------
UVRB_STAAN      ----------------------------------------------------------------------
UVRB_STAAM      ----------------------------------------------------------------------
UVRB_STAAC      ----------------------------------------------------------------------
UVRB_CHLPN      ----------------------------------------------------------------------
UVRB_BIFLO      ----------------------------------------------------------------------
UVRB_BACSU      ----------------------------------------------------------------------
UVRB_ANAPZ      ----------------------------------------------------------------------
RHLB_VIBVY      ----------------------------------------------------------------------
RHLB_VIBVU      ----------------------------------------------------------------------
RHLB_VIBFM      ----------------------------------------------------------------------
RHLB_VIBF1      ----------------------------------------------------------------------
RHLB_SHIF8      ----------------------------------------------------------------------
RHLB_PHOPR      ----------------------------------------------------------------------
RH53_ORYSJ      ----------------------------------------------------------------------
DED1_USTMA      ----------------------------------------------------------------------
DED1_PHANO      ----------------------------------------------------------------------
DBP3_PICGU      ----------------------------------------------------------------------
DBP2_NEUCR      ----------------------------------------------------------------------
UVRB_STAES      ----------------------------------------------------------------------
UVRB_STAEQ      ----------------------------------------------------------------------
UVRB_HELAH      ----------------------------------------------------------------------
UVRB_BACHD      ----------------------------------------------------------------------
RHLB_SALTY      ----------------------------------------------------------------------
RHLB_SALTI      ----------------------------------------------------------------------
RHLB_SALSV      ----------------------------------------------------------------------
RHLB_SALPK      ----------------------------------------------------------------------
RHLB_SALPC      ----------------------------------------------------------------------
RHLB_SALPB      ----------------------------------------------------------------------
RHLB_SALNS      ----------------------------------------------------------------------
RHLB_SALHS      ----------------------------------------------------------------------
RHLB_SALG2      ----------------------------------------------------------------------
RHLB_SALEP      ----------------------------------------------------------------------
RHLB_SALDC      ----------------------------------------------------------------------
RHLB_SALCH      ----------------------------------------------------------------------
RHLB_SALAR      ----------------------------------------------------------------------
RHLB_SALA4      ----------------------------------------------------------------------
RHLB_ERWT9      ----------------------------------------------------------------------
MFD_MYCTU       ----------------------------------------------------------------------
MFD_MYCBO       ----------------------------------------------------------------------
DED1_SCHPO      ----------------------------------------------------------------------
DED1_CHAGB      ----------------------------------------------------------------------
DBP5_EMENI      ----------------------------------------------------------------------
DBP5_ASPOR      ----------------------------------------------------------------------
DBP2_GIBZE      ----------------------------------------------------------------------
UVRB_SYNS3      ----------------------------------------------------------------------
UVRB_PROMM      ----------------------------------------------------------------------
UVRB_PROMA      ----------------------------------------------------------------------
UVRB_PROM3      ----------------------------------------------------------------------
UVRB_LACLS      ----------------------------------------------------------------------
UVRB_LACLM      ----------------------------------------------------------------------
UVRB_LACLA      ----------------------------------------------------------------------
UVRB_LACBA      ----------------------------------------------------------------------
UVRB_HELPJ      ----------------------------------------------------------------------
UVRB_HELPH      ----------------------------------------------------------------------
RHLB_SHISS      ----------------------------------------------------------------------
RHLB_SHIFL      ----------------------------------------------------------------------
RHLB_SHIDS      ----------------------------------------------------------------------
RHLB_SHIBS      ----------------------------------------------------------------------
RHLB_SHIB3      ----------------------------------------------------------------------
RHLB_KLEP3      ----------------------------------------------------------------------
RHLB_HAES1      ----------------------------------------------------------------------
RHLB_ESCF3      ----------------------------------------------------------------------
RHLB_ENTS8      ----------------------------------------------------------------------
RHLB_ECOUT      ----------------------------------------------------------------------
RHLB_ECOSM      ----------------------------------------------------------------------
RHLB_ECOSE      ----------------------------------------------------------------------
RHLB_ECOLU      ----------------------------------------------------------------------
RHLB_ECOLI      ----------------------------------------------------------------------
RHLB_ECOLC      ----------------------------------------------------------------------
RHLB_ECOL6      ----------------------------------------------------------------------
RHLB_ECOL5      ----------------------------------------------------------------------
RHLB_ECOK1      ----------------------------------------------------------------------
RHLB_ECOHS      ----------------------------------------------------------------------
RHLB_ECODH      ----------------------------------------------------------------------
RHLB_ECOBW      ----------------------------------------------------------------------
RHLB_ECO8A      ----------------------------------------------------------------------
RHLB_ECO81      ----------------------------------------------------------------------
RHLB_ECO7I      ----------------------------------------------------------------------
RHLB_ECO5E      ----------------------------------------------------------------------
RHLB_ECO55      ----------------------------------------------------------------------
RHLB_ECO45      ----------------------------------------------------------------------
RHLB_ECO27      ----------------------------------------------------------------------
RHLB_ECO24      ----------------------------------------------------------------------
PRP5_PHANO      ----------------------------------------------------------------------
DED1_ASHGO      ----------------------------------------------------------------------
DBP5_ASPCL      ----------------------------------------------------------------------
DBP2_MAGGR      ----------------------------------------------------------------------
UVRB_STRMU      ----------------------------------------------------------------------
UVRB_MYCMS      ----------------------------------------------------------------------
UVRB_METMA      ----------------------------------------------------------------------
UVRB_CAMHC      ----------------------------------------------------------------------
RHLB_HAES2      ----------------------------------------------------------------------
RHLB_HAEIN      ----------------------------------------------------------------------
RHLB_HAEIG      ----------------------------------------------------------------------
RHLB_HAEIE      ----------------------------------------------------------------------
RHLB_CITK8      ----------------------------------------------------------------------
RECG_SYNY3      ----------------------------------------------------------------------
DED1_YARLI      ----------------------------------------------------------------------
UVRB_STRSV      ----------------------------------------------------------------------
UVRB_STRGC      ----------------------------------------------------------------------
UVRB_MYCMO      ----------------------------------------------------------------------
UVRB_LEIXX      ----------------------------------------------------------------------
PRP28_NEUCR     ----------------------------------------------------------------------
DED1_ASPCL      ----------------------------------------------------------------------
UVRB_ZYMMO      ----------------------------------------------------------------------
UVRB_STRS7      ----------------------------------------------------------------------
UVRB_STRS2      ----------------------------------------------------------------------
UVRB_STRPZ      ----------------------------------------------------------------------
UVRB_STRPM      ----------------------------------------------------------------------
UVRB_STRPG      ----------------------------------------------------------------------
UVRB_STRPD      ----------------------------------------------------------------------
UVRB_STRPC      ----------------------------------------------------------------------
UVRB_STRPB      ----------------------------------------------------------------------
UVRB_STRP8      ----------------------------------------------------------------------
UVRB_STRP6      ----------------------------------------------------------------------
UVRB_STRP3      ----------------------------------------------------------------------
UVRB_STRP1      ----------------------------------------------------------------------
UVRB_STREM      ----------------------------------------------------------------------
UVRB_STRE4      ----------------------------------------------------------------------
UVRB_STRA5      ----------------------------------------------------------------------
UVRB_STRA3      ----------------------------------------------------------------------
UVRB_STRA1      ----------------------------------------------------------------------
UVRB_PROMT      ----------------------------------------------------------------------
UVRB_PROM1      ----------------------------------------------------------------------
UVRB_MICLC      ----------------------------------------------------------------------
UVRB_BACSK      ----------------------------------------------------------------------
RHLB_ECO57      ----------------------------------------------------------------------
DED1_BOTFB      ----------------------------------------------------------------------
UVRB_STRPF      ----------------------------------------------------------------------
UVRB_STAS1      ----------------------------------------------------------------------
UVRB_RICAE      ----------------------------------------------------------------------
UVRB_PROM4      ----------------------------------------------------------------------
UVRB_MYCPE      ----------------------------------------------------------------------
UVRB_MICAN      ----------------------------------------------------------------------
UVRB_FRATT      ----------------------------------------------------------------------
ROK1_NEOFI      ----------------------------------------------------------------------
ROK1_ASPFU      ----------------------------------------------------------------------
RHLB_SERP5      ----------------------------------------------------------------------
RHLB_PHOLL      ----------------------------------------------------------------------
RHLB_KLEP7      ----------------------------------------------------------------------
RHLB_AERHH      ----------------------------------------------------------------------
RH3_ARATH       ----------------------------------------------------------------------
PRP28_ASPOR     ----------------------------------------------------------------------
DDX47_DICDI     ----------------------------------------------------------------------
DBP5_CHAGB      ----------------------------------------------------------------------
DBP3_GIBZE      ----------------------------------------------------------------------
UVRB_ONYPE      ----------------------------------------------------------------------
UVRB_CAMJR      ----------------------------------------------------------------------
UVRB_CAMJE      ----------------------------------------------------------------------
UVRB_ANAMM      ----------------------------------------------------------------------
UVRB_ANAMF      ----------------------------------------------------------------------
SPB4_DEBHA      ----------------------------------------------------------------------
RHLB_ENT38      ----------------------------------------------------------------------
RHLB_AERS4      ----------------------------------------------------------------------
RECG_ECOLI      ----------------------------------------------------------------------
PRP28_COCIM     ----------------------------------------------------------------------
I4A3A_XENLA     ----------------------------------------------------------------------
DCL2_ASPOR      ----------------------------------------------------------------------
DBP5_CANGA      ----------------------------------------------------------------------
DBP2_SCLS1      ----------------------------------------------------------------------
DBP2_BOTFB      ----------------------------------------------------------------------
UVRB_RICRS      ----------------------------------------------------------------------
UVRB_RICRO      ----------------------------------------------------------------------
UVRB_RICPU      ----------------------------------------------------------------------
UVRB_RICCN      ----------------------------------------------------------------------
UVRB_LEPBP      ----------------------------------------------------------------------
UVRB_LEPBA      ----------------------------------------------------------------------
UVRB_LACJO      ----------------------------------------------------------------------
UVRB_LACGA      ----------------------------------------------------------------------
UVRB_BEUC1      ----------------------------------------------------------------------
RRP3_CHAGB      ----------------------------------------------------------------------
ROK1_ASPNC      ----------------------------------------------------------------------
RHLB_YERPY      ----------------------------------------------------------------------
RHLB_YERPS      ----------------------------------------------------------------------
RHLB_YERPP      ----------------------------------------------------------------------
RHLB_YERPN      ----------------------------------------------------------------------
RHLB_YERPE      ----------------------------------------------------------------------
RHLB_YERPB      ----------------------------------------------------------------------
RHLB_YERPA      ----------------------------------------------------------------------
RHLB_YERP3      ----------------------------------------------------------------------
RH47A_ORYSJ     ----------------------------------------------------------------------
RH31_ORYSJ      ----------------------------------------------------------------------
PRP28_GIBZE     ----------------------------------------------------------------------
IF4A3_XENTR     ----------------------------------------------------------------------
IF4A3_TAEGU     ----------------------------------------------------------------------
IF4A3_SALSA     ----------------------------------------------------------------------
IF4A3_RAT       ----------------------------------------------------------------------
IF4A3_PIG       ----------------------------------------------------------------------
IF4A3_MOUSE     ----------------------------------------------------------------------
IF4A3_MACFA     ----------------------------------------------------------------------
IF4A3_HUMAN     ----------------------------------------------------------------------
IF4A3_CHICK     ----------------------------------------------------------------------
IF4A3_BOVIN     ----------------------------------------------------------------------
I4A3B_XENLA     ----------------------------------------------------------------------
DED1_PICGU      ----------------------------------------------------------------------
DED1_GIBZE      ----------------------------------------------------------------------
DED1_DEBHA      ----------------------------------------------------------------------
DED1_CRYNE      ----------------------------------------------------------------------
DBP5_PICST      ----------------------------------------------------------------------
UVRB_WOLTR      ----------------------------------------------------------------------
UVRB_CHLMU      ----------------------------------------------------------------------
UVRB_ARTCA      ----------------------------------------------------------------------
ROK1_ASPOR      ----------------------------------------------------------------------
RHLB_PROMH      ----------------------------------------------------------------------
RHLB_HAMD5      ----------------------------------------------------------------------
RECG_ECO57      ----------------------------------------------------------------------
PRP28_ASPTN     ----------------------------------------------------------------------
PRP28_ASPNC     ----------------------------------------------------------------------
MFD_BUCBP       ----------------------------------------------------------------------
DBP5_PHANO      ----------------------------------------------------------------------
DBP3_CRYNE      ----------------------------------------------------------------------
UVRB_RICAH      ----------------------------------------------------------------------
UVRB_ARTS2      ----------------------------------------------------------------------
UVRB_ARTAT      ----------------------------------------------------------------------
ROK1_COCIM      ----------------------------------------------------------------------
ROK1_ASPCL      ----------------------------------------------------------------------
RHLB_PECCP      ----------------------------------------------------------------------
RHLB_PASMU      ----------------------------------------------------------------------
RHLB_ERWCT      ----------------------------------------------------------------------
PRP28_EMENI     ----------------------------------------------------------------------
PRP28_CANAL     ----------------------------------------------------------------------
PRP28_ASPCL     ----------------------------------------------------------------------
DCL2_EMENI      ----------------------------------------------------------------------
DBP5_YEAST      ----------------------------------------------------------------------
DBP5_YEAS7      ----------------------------------------------------------------------
DBP5_NEUCR      ----------------------------------------------------------------------
UVRB_RICPR      ----------------------------------------------------------------------
SPB42_CANAL     ----------------------------------------------------------------------
SPB41_CANAL     ----------------------------------------------------------------------
RHLB_SODGM      ----------------------------------------------------------------------
PRP28_NEOFI     ----------------------------------------------------------------------
PRP28_DEBHA     ----------------------------------------------------------------------
PRP28_ASPFU     ----------------------------------------------------------------------
MS116_SCHPO     ----------------------------------------------------------------------
DDX23_PONAB     ----------------------------------------------------------------------
DDX23_HUMAN     ----------------------------------------------------------------------
DBP3_SCHPO      ----------------------------------------------------------------------
DBP3_LODEL      ----------------------------------------------------------------------
UVRB_RICTY      ----------------------------------------------------------------------
UVRB_RICM5      ----------------------------------------------------------------------
UVRB_RICFE      ----------------------------------------------------------------------
UVRB_RICBR      ----------------------------------------------------------------------
UVRB_RICB8      ----------------------------------------------------------------------
UVRB_RENSM      ----------------------------------------------------------------------
RRP3_BOTFB      ----------------------------------------------------------------------
RH52A_ORYSJ     ----------------------------------------------------------------------
DEAD_BUCBP      ----------------------------------------------------------------------
DDX4_RANLE      ----------------------------------------------------------------------
DCL4_ARATH      ----------------------------------------------------------------------
DCL2_MAGGR      ----------------------------------------------------------------------
DCL22_ASPNC     ----------------------------------------------------------------------
DBP5_MAGGR      ----------------------------------------------------------------------
DBP5_CRYNE      ----------------------------------------------------------------------
DBP4_ASPCL      ----------------------------------------------------------------------
DBP3_PICST      ----------------------------------------------------------------------
DBP2_ASPFU      ----------------------------------------------------------------------
SKI2_YEAST      ----------------------------------------------------------------------
ROK1_EMENI      ----------------------------------------------------------------------
RH47B_ORYSJ     ----------------------------------------------------------------------
RH26_ORYSJ      ----------------------------------------------------------------------
PRP5_YEAST      ----------------------------------------------------------------------
PRP5_YEAS7      ----------------------------------------------------------------------
PRP28_CRYNE     ----------------------------------------------------------------------
PRP28_CANGA     ----------------------------------------------------------------------
MS116_PHANO     ----------------------------------------------------------------------
IF4A_DICDI      ----------------------------------------------------------------------
DBP4_ASHGO      ----------------------------------------------------------------------
DBP3_VANPO      ----------------------------------------------------------------------
DBP2_NEOFI      ----------------------------------------------------------------------
DBP2_ASPOR      ----------------------------------------------------------------------
DBP2_ASPNC      ----------------------------------------------------------------------
DBP2_ASPCL      ----------------------------------------------------------------------
UVRB_CHLCV      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LAFSSLDLGKQAEMMRLTRKGLLGLEYQAVDQKKVKTQSWYEVDHAQLEGVEISTRAKKKLELRDYXXXX
PRIA_BACSU      LLYSDIPDHETLKLIRHVQKGDIDVTYKVAQKTNKKMVRHIQANASKEELAKLSRQAAKQQAILHFLISE
PRIA_SYNY3      QILTLLQSSKEGDYSRYLRQKVPGLTKALRDLKRQWVESYLEPPKAQLPKMVTLLNFDPSFKLTELQART
PRIA_CHLPN      ----------------------------------------------------------------------
PRIA_CHLMU      ----------------------------------------------------------------------
PRIA_CHLTR      ----------------------------------------------------------------------
PRIA_ECOLI      ----------------------------------------------------------------------
PRIA_HAEIN      ----------------------------------------------------------------------
PRIA_TREPA      ----------------------------------------------------------------------
PRIA_RICBR      ----------------------------------------------------------------------
PRIA_RICCN      ----------------------------------------------------------------------
PRIA_RICTY      ----------------------------------------------------------------------
PRIA_RICPR      ----------------------------------------------------------------------
PRIA_RICFE      ----------------------------------------------------------------------
PRIA_BORBU      ----------------------------------------------------------------------
PRIA_THEMA      ----------------------------------------------------------------------
PRIA_HELPY      ----------------------------------------------------------------------
PRIA_HELPJ      ----------------------------------------------------------------------
PRIA_RHORU      ----------------------------------------------------------------------
PRIA_BUCAI      ----------------------------------------------------------------------
PRIA_BUCAP      ----------------------------------------------------------------------
PRIA_MYCLE      ----------------------------------------------------------------------
PRIA_MYCTU      ----------------------------------------------------------------------
PRIA_MYCBO      ----------------------------------------------------------------------
MFD_HELPJ       ----------------------------------------------------------------------
MFD_HELPY       ----------------------------------------------------------------------
MFD_ECOLI       ----------------------------------------------------------------------
RECG_AQUAE      ----------------------------------------------------------------------
RECG_STRPN      ----------------------------------------------------------------------
MFD_STAHJ       ----------------------------------------------------------------------
MFD_HAEIN       ----------------------------------------------------------------------
MFD_SYNY3       ----------------------------------------------------------------------
RECG_MYCLE      ----------------------------------------------------------------------
MFD_STAAW       ----------------------------------------------------------------------
MFD_STAAS       ----------------------------------------------------------------------
MFD_STAAR       ----------------------------------------------------------------------
MFD_STAAN       ----------------------------------------------------------------------
MFD_STAAM       ----------------------------------------------------------------------
MFD_STAAC       ----------------------------------------------------------------------
MFD_STAAB       ----------------------------------------------------------------------
MFD_STAA8       ----------------------------------------------------------------------
MFD_STAA3       ----------------------------------------------------------------------
COMFA_BACSU     ----------------------------------------------------------------------
MFD_STAS1       ----------------------------------------------------------------------
RECG_MYCTU      ----------------------------------------------------------------------
RECG_MYCBO      ----------------------------------------------------------------------
UVRB_CLOTE      ----------------------------------------------------------------------
UVRB_CLAMS      ----------------------------------------------------------------------
UVRB_CLAM3      ----------------------------------------------------------------------
RECG_BORBU      ----------------------------------------------------------------------
MFD_STAES       ----------------------------------------------------------------------
MFD_STAEQ       ----------------------------------------------------------------------
UVRB_PROAC      ----------------------------------------------------------------------
UVRB_DESVV      ----------------------------------------------------------------------
UVRB_DESVH      ----------------------------------------------------------------------
MFD_MYXXA       ----------------------------------------------------------------------
UVRB_PELCD      ----------------------------------------------------------------------
UVRB_CHLL2      ----------------------------------------------------------------------
UVRB_BACTN      ----------------------------------------------------------------------
UVRB_BACFR      ----------------------------------------------------------------------
UVRB_BACFN      ----------------------------------------------------------------------
UVRB_LEGPL      ----------------------------------------------------------------------
UVRB_LEGPH      ----------------------------------------------------------------------
UVRB_LEGPC      ----------------------------------------------------------------------
UVRB_LEGPA      ----------------------------------------------------------------------
UVRB_CHLCH      ----------------------------------------------------------------------
RECG_STAAW      ----------------------------------------------------------------------
RECG_STAAS      ----------------------------------------------------------------------
RECG_STAAN      ----------------------------------------------------------------------
RECG_STAAM      ----------------------------------------------------------------------
RECG_STAAC      ----------------------------------------------------------------------
RECG_STAA8      ----------------------------------------------------------------------
UVRB_THIDA      ----------------------------------------------------------------------
UVRB_SHIFL      ----------------------------------------------------------------------
UVRB_SHIF8      ----------------------------------------------------------------------
UVRB_DESVM      ----------------------------------------------------------------------
UVRB_CHLPB      ----------------------------------------------------------------------
MFD_BACSU       ----------------------------------------------------------------------
UVRB_LACSS      ----------------------------------------------------------------------
UVRB_YERPY      ----------------------------------------------------------------------
UVRB_YERPS      ----------------------------------------------------------------------
UVRB_YERPP      ----------------------------------------------------------------------
UVRB_YERPN      ----------------------------------------------------------------------
UVRB_YERPG      ----------------------------------------------------------------------
UVRB_YERPE      ----------------------------------------------------------------------
UVRB_YERPB      ----------------------------------------------------------------------
UVRB_YERPA      ----------------------------------------------------------------------
UVRB_YERP3      ----------------------------------------------------------------------
UVRB_THEYD      ----------------------------------------------------------------------
UVRB_PASMU      ----------------------------------------------------------------------
UVRB_NITEU      ----------------------------------------------------------------------
UVRB_HAMD5      ----------------------------------------------------------------------
UVRB_FERNB      ----------------------------------------------------------------------
UVRB_DESDG      ----------------------------------------------------------------------
UVRB_METTH      ----------------------------------------------------------------------
UVRB_MANSM      ----------------------------------------------------------------------
MFD_BORBU       ----------------------------------------------------------------------
UVRB_SHISS      ----------------------------------------------------------------------
UVRB_SHIDS      ----------------------------------------------------------------------
UVRB_SHIBS      ----------------------------------------------------------------------
UVRB_SHIB3      ----------------------------------------------------------------------
UVRB_SALTY      ----------------------------------------------------------------------
UVRB_SALTI      ----------------------------------------------------------------------
UVRB_SALSV      ----------------------------------------------------------------------
UVRB_SALPK      ----------------------------------------------------------------------
UVRB_SALPC      ----------------------------------------------------------------------
UVRB_SALPB      ----------------------------------------------------------------------
UVRB_SALPA      ----------------------------------------------------------------------
UVRB_SALNS      ----------------------------------------------------------------------
UVRB_SALHS      ----------------------------------------------------------------------
UVRB_SALG2      ----------------------------------------------------------------------
UVRB_SALEP      ----------------------------------------------------------------------
UVRB_SALDC      ----------------------------------------------------------------------
UVRB_SALCH      ----------------------------------------------------------------------
UVRB_SALAR      ----------------------------------------------------------------------
UVRB_SALA4      ----------------------------------------------------------------------
UVRB_KLEP7      ----------------------------------------------------------------------
UVRB_KLEP3      ----------------------------------------------------------------------
UVRB_ESCF3      ----------------------------------------------------------------------
UVRB_ENT38      ----------------------------------------------------------------------
UVRB_ECOUT      ----------------------------------------------------------------------
UVRB_ECOSM      ----------------------------------------------------------------------
UVRB_ECOSE      ----------------------------------------------------------------------
UVRB_ECOLU      ----------------------------------------------------------------------
UVRB_ECOLI      ----------------------------------------------------------------------
UVRB_ECOLC      ----------------------------------------------------------------------
UVRB_ECOL6      ----------------------------------------------------------------------
UVRB_ECOL5      ----------------------------------------------------------------------
UVRB_ECOK1      ----------------------------------------------------------------------
UVRB_ECOHS      ----------------------------------------------------------------------
UVRB_ECODH      ----------------------------------------------------------------------
UVRB_ECOBW      ----------------------------------------------------------------------
UVRB_ECO8A      ----------------------------------------------------------------------
UVRB_ECO81      ----------------------------------------------------------------------
UVRB_ECO7I      ----------------------------------------------------------------------
UVRB_ECO5E      ----------------------------------------------------------------------
UVRB_ECO57      ----------------------------------------------------------------------
UVRB_ECO55      ----------------------------------------------------------------------
UVRB_ECO45      ----------------------------------------------------------------------
UVRB_ECO27      ----------------------------------------------------------------------
UVRB_ECO24      ----------------------------------------------------------------------
UVRB_CITK8      ----------------------------------------------------------------------
RECG_STAES      ----------------------------------------------------------------------
RECG_STAAR      ----------------------------------------------------------------------
UVRB_PECCP      ----------------------------------------------------------------------
UVRB_ERWCT      ----------------------------------------------------------------------
UVRB_DECAR      ----------------------------------------------------------------------
UVRB_COLP3      ----------------------------------------------------------------------
UVRB_AZOSE      ----------------------------------------------------------------------
MFD_BUCAI       ----------------------------------------------------------------------
UVRB_YERE8      ----------------------------------------------------------------------
UVRB_VIBF1      ----------------------------------------------------------------------
UVRB_SERP5      ----------------------------------------------------------------------
UVRB_PROMH      ----------------------------------------------------------------------
UVRB_PHOLL      ----------------------------------------------------------------------
UVRB_MYCA5      ----------------------------------------------------------------------
UVRB_HAEIN      ----------------------------------------------------------------------
UVRB_HAEI8      ----------------------------------------------------------------------
UVRB_GEOSL      ----------------------------------------------------------------------
UVB2_MYCPU      ----------------------------------------------------------------------
RECG_PASMU      ----------------------------------------------------------------------
DBP3_YARLI      ----------------------------------------------------------------------
UVRB_VIBVY      ----------------------------------------------------------------------
UVRB_VIBVU      ----------------------------------------------------------------------
UVRB_VIBPA      ----------------------------------------------------------------------
UVRB_THEAB      ----------------------------------------------------------------------
UVRB_IDILO      ----------------------------------------------------------------------
UVRB_HERA2      ----------------------------------------------------------------------
UVRB_COXBU      ----------------------------------------------------------------------
UVRB_COXBR      ----------------------------------------------------------------------
UVRB_COXBN      ----------------------------------------------------------------------
UVRB_COXB2      ----------------------------------------------------------------------
UVRB_CHLPD      ----------------------------------------------------------------------
UVRB_CARHZ      ----------------------------------------------------------------------
UVRB_BORPD      ----------------------------------------------------------------------
UVRB_AQUAE      ----------------------------------------------------------------------
DBP5_ASPFU      ----------------------------------------------------------------------
UVRB_SYNY3      ----------------------------------------------------------------------
UVRB_NATTJ      ----------------------------------------------------------------------
UVRB_FUSNN      ----------------------------------------------------------------------
UVRB_EDWI9      ----------------------------------------------------------------------
UVRB_CLOBM      ----------------------------------------------------------------------
UVRB_CLOBL      ----------------------------------------------------------------------
UVRB_CLOBK      ----------------------------------------------------------------------
UVRB_CLOBJ      ----------------------------------------------------------------------
UVRB_CLOB6      ----------------------------------------------------------------------
UVRB_CLOB1      ----------------------------------------------------------------------
UVRB_CLOAB      ----------------------------------------------------------------------
UVRB_CHRVO      ----------------------------------------------------------------------
UVRB_CAMFF      ----------------------------------------------------------------------
UVRB_BORA1      ----------------------------------------------------------------------
UVRB_ALISL      ----------------------------------------------------------------------
RHLB_ACTSZ      ----------------------------------------------------------------------
RECG_STAEQ      ----------------------------------------------------------------------
DBP5_NEOFI      ----------------------------------------------------------------------
UVRB_PSEPK      ----------------------------------------------------------------------
UVRB_PSEPF      ----------------------------------------------------------------------
UVRB_PSEF5      ----------------------------------------------------------------------
UVRB_PHOPR      ----------------------------------------------------------------------
UVRB_PARUW      ----------------------------------------------------------------------
UVRB_METST      ----------------------------------------------------------------------
UVRB_GLOVI      ----------------------------------------------------------------------
UVRB_COXB1      ----------------------------------------------------------------------
UVRB_CLOPS      ----------------------------------------------------------------------
UVRB_CLOPE      ----------------------------------------------------------------------
UVRB_CLOP1      ----------------------------------------------------------------------
RECG_HAEIN      ----------------------------------------------------------------------
UVRB_THEEB      ----------------------------------------------------------------------
UVRB_HELHP      ----------------------------------------------------------------------
UVRB_DEHE1      ----------------------------------------------------------------------
UVRB_CYAP7      ----------------------------------------------------------------------
UVRB_THICR      ----------------------------------------------------------------------
UVRB_PSYIN      ----------------------------------------------------------------------
UVRB_NITOC      ----------------------------------------------------------------------
UVRB_METS3      ----------------------------------------------------------------------
UVRB_ERWT9      ----------------------------------------------------------------------
UVRB_ENTFA      ----------------------------------------------------------------------
UVRB_BORPE      ----------------------------------------------------------------------
UVRB_BORPA      ----------------------------------------------------------------------
UVRB_BORBR      ----------------------------------------------------------------------
UVRB_ACTP2      ----------------------------------------------------------------------
RECG_TREPA      ----------------------------------------------------------------------
UVRB_PSEAE      ----------------------------------------------------------------------
UVRB_MYCGE      ----------------------------------------------------------------------
UVRB_KOSOT      ----------------------------------------------------------------------
UVRB_CYAP4      ----------------------------------------------------------------------
UVRB_ACIAD      ----------------------------------------------------------------------
UVRB_TROW8      ----------------------------------------------------------------------
UVRB_STRCO      ----------------------------------------------------------------------
UVRB_NEIMB      ----------------------------------------------------------------------
UVRB_NEIMA      ----------------------------------------------------------------------
UVRB_NEIGO      ----------------------------------------------------------------------
UVRB_NEIG1      ----------------------------------------------------------------------
UVRB_LACPL      ----------------------------------------------------------------------
UVRB_CLOBB      ----------------------------------------------------------------------
UVRB_CLOBA      ----------------------------------------------------------------------
UVRB_CHLTE      ----------------------------------------------------------------------
RHLB_VIBHB      ----------------------------------------------------------------------
UVRB_THET8      ----------------------------------------------------------------------
UVRB_STRAW      ----------------------------------------------------------------------
UVRB_RALSO      ----------------------------------------------------------------------
UVRB_RALEJ      ----------------------------------------------------------------------
UVRB_METMP      ----------------------------------------------------------------------
UVRB_LEPBL      ----------------------------------------------------------------------
UVRB_LEPBJ      ----------------------------------------------------------------------
UVRB_LACAC      ----------------------------------------------------------------------
UVRB_BORGA      ----------------------------------------------------------------------
UVRB_BORAP      ----------------------------------------------------------------------
UVRB_ANASP      ----------------------------------------------------------------------
RHLB_ALISL      ----------------------------------------------------------------------
RECG_BACSU      ----------------------------------------------------------------------
DED1_MAGGR      ----------------------------------------------------------------------
DED1_KLULA      ----------------------------------------------------------------------
UVRB_TREDE      ----------------------------------------------------------------------
UVRB_SYNJB      ----------------------------------------------------------------------
UVRB_PSEU2      ----------------------------------------------------------------------
UVRB_PSESM      ----------------------------------------------------------------------
UVRB_PSEHT      ----------------------------------------------------------------------
UVRB_PSE14      ----------------------------------------------------------------------
UVRB_METBU      ----------------------------------------------------------------------
UVRB_LEPIN      ----------------------------------------------------------------------
UVRB_LEPIC      ----------------------------------------------------------------------
UVRB_GEMAT      ----------------------------------------------------------------------
UVRB_EUBR3      ----------------------------------------------------------------------
UVRB_CLOB8      ----------------------------------------------------------------------
UVRB_BORBZ      ----------------------------------------------------------------------
UVRB_BORBU      ----------------------------------------------------------------------
UVRB_ACAM1      ----------------------------------------------------------------------
UVRB_THETN      ----------------------------------------------------------------------
UVRB_GEOKA      ----------------------------------------------------------------------
UVRB_BURPS      ----------------------------------------------------------------------
UVRB_BURMA      ----------------------------------------------------------------------
UVRB_BACCA      ----------------------------------------------------------------------
RHLB_VIBPA      ----------------------------------------------------------------------
UVRB_WOLSU      ----------------------------------------------------------------------
UVRB_THELT      ----------------------------------------------------------------------
UVRB_SYMTH      ----------------------------------------------------------------------
UVRB_MYCUA      ----------------------------------------------------------------------
UVRB_MYCPU      ----------------------------------------------------------------------
UVRB_LACCB      ----------------------------------------------------------------------
UVRB_LACC3      ----------------------------------------------------------------------
UVRB_CALS8      ----------------------------------------------------------------------
UVRB_BACCR      ----------------------------------------------------------------------
UVRB_ANATD      ----------------------------------------------------------------------
RHLB_VIBSL      ----------------------------------------------------------------------
PRP28_MAGGR     ----------------------------------------------------------------------
UVRB_XYLFT      ----------------------------------------------------------------------
UVRB_XYLFM      ----------------------------------------------------------------------
UVRB_XYLFA      ----------------------------------------------------------------------
UVRB_XYLF2      ----------------------------------------------------------------------
UVRB_TREPS      ----------------------------------------------------------------------
UVRB_TREPA      ----------------------------------------------------------------------
UVRB_SYNP6      ----------------------------------------------------------------------
UVRB_SYNJA      ----------------------------------------------------------------------
UVRB_SYNE7      ----------------------------------------------------------------------
UVRB_OCEIH      ----------------------------------------------------------------------
UVRB_CORDI      ----------------------------------------------------------------------
UVRB_BACLD      ----------------------------------------------------------------------
UVRB_BACHK      ----------------------------------------------------------------------
UVRB_BACCZ      ----------------------------------------------------------------------
UVRB_BACC1      ----------------------------------------------------------------------
UVRB_BACAN      ----------------------------------------------------------------------
UVRB_BACA2      ----------------------------------------------------------------------
DED1_LODEL      ----------------------------------------------------------------------
DBP2_CHAGB      ----------------------------------------------------------------------
DBP1_YEAST      ----------------------------------------------------------------------
DBP1_YEAS7      ----------------------------------------------------------------------
UVRB_THEFY      ----------------------------------------------------------------------
UVRB_STRZT      ----------------------------------------------------------------------
UVRB_NATPD      ----------------------------------------------------------------------
UVRB_METCA      ----------------------------------------------------------------------
UVRB_HALMA      ----------------------------------------------------------------------
UVRB_DEHSC      ----------------------------------------------------------------------
UVRB_CYTH3      ----------------------------------------------------------------------
UVRB_CLONN      ----------------------------------------------------------------------
UVRB_CHLAB      ----------------------------------------------------------------------
UVRB_AYWBP      ----------------------------------------------------------------------
RHLB_VIBCM      ----------------------------------------------------------------------
RHLB_VIBCH      ----------------------------------------------------------------------
RHLB_VIBC3      ----------------------------------------------------------------------
RHLB_MANSM      ----------------------------------------------------------------------
DED1_EMENI      ----------------------------------------------------------------------
DED1_ASPOR      ----------------------------------------------------------------------
DED1_ASPNC      ----------------------------------------------------------------------
DBP5_ASPTN      ----------------------------------------------------------------------
DBP1_CANGA      ----------------------------------------------------------------------
UVRB_STRZP      ----------------------------------------------------------------------
UVRB_STRZJ      ----------------------------------------------------------------------
UVRB_STRR6      ----------------------------------------------------------------------
UVRB_STRPS      ----------------------------------------------------------------------
UVRB_STRPN      ----------------------------------------------------------------------
UVRB_STRPJ      ----------------------------------------------------------------------
UVRB_STRPI      ----------------------------------------------------------------------
UVRB_STRP7      ----------------------------------------------------------------------
UVRB_STRP4      ----------------------------------------------------------------------
UVRB_STRP2      ----------------------------------------------------------------------
UVRB_MYCTU      ----------------------------------------------------------------------
UVRB_MYCPN      ----------------------------------------------------------------------
UVRB_MYCLE      ----------------------------------------------------------------------
UVRB_MYCBO      ----------------------------------------------------------------------
UVRB_METAC      ----------------------------------------------------------------------
UVRB_LISMO      ----------------------------------------------------------------------
UVRB_LISMF      ----------------------------------------------------------------------
UVRB_LISIN      ----------------------------------------------------------------------
UVRB_HELPY      ----------------------------------------------------------------------
UVRB_HAEDU      ----------------------------------------------------------------------
UVRB_CHLAD      ----------------------------------------------------------------------
UVRB_BIFLI      ----------------------------------------------------------------------
DED1_SCLS1      ----------------------------------------------------------------------
DED1_NEOFI      ----------------------------------------------------------------------
DED1_CANGA      ----------------------------------------------------------------------
DED1_ASPFU      ----------------------------------------------------------------------
DED1_AJECN      ----------------------------------------------------------------------
DBP5_ASPNC      ----------------------------------------------------------------------
UVRB_XANOR      ----------------------------------------------------------------------
UVRB_XANOP      ----------------------------------------------------------------------
UVRB_XANOM      ----------------------------------------------------------------------
UVRB_XANCP      ----------------------------------------------------------------------
UVRB_XANCB      ----------------------------------------------------------------------
UVRB_XANC8      ----------------------------------------------------------------------
UVRB_XANAC      ----------------------------------------------------------------------
UVRB_SYNPX      ----------------------------------------------------------------------
UVRB_SYNPW      ----------------------------------------------------------------------
UVRB_STAHJ      ----------------------------------------------------------------------
UVRB_RHOBA      ----------------------------------------------------------------------
UVRB_PROMP      ----------------------------------------------------------------------
UVRB_PROM0      ----------------------------------------------------------------------
UVRB_HALSA      ----------------------------------------------------------------------
UVRB_CHLTR      ----------------------------------------------------------------------
UVRB_CHLTA      ----------------------------------------------------------------------
UVRB_CHLCV      ----------------------------------------------------------------------
RH25_ORYSJ      ----------------------------------------------------------------------
PRP28_SCHPO     ----------------------------------------------------------------------
DED1_NEUCR      ----------------------------------------------------------------------
DED1_COCIM      ----------------------------------------------------------------------
DED1_ASPTN      ----------------------------------------------------------------------
UVRB_STRU0      ----------------------------------------------------------------------
UVRB_STRTD      ----------------------------------------------------------------------
UVRB_STRT2      ----------------------------------------------------------------------
UVRB_STRT1      ----------------------------------------------------------------------
UVRB_STAAW      ----------------------------------------------------------------------
UVRB_STAAS      ----------------------------------------------------------------------
UVRB_STAAR      ----------------------------------------------------------------------
UVRB_STAAN      ----------------------------------------------------------------------
UVRB_STAAM      ----------------------------------------------------------------------
UVRB_STAAC      ----------------------------------------------------------------------
UVRB_CHLPN      ----------------------------------------------------------------------
UVRB_BIFLO      ----------------------------------------------------------------------
UVRB_BACSU      ----------------------------------------------------------------------
UVRB_ANAPZ      ----------------------------------------------------------------------
RHLB_VIBVY      ----------------------------------------------------------------------
RHLB_VIBVU      ----------------------------------------------------------------------
RHLB_VIBFM      ----------------------------------------------------------------------
RHLB_VIBF1      ----------------------------------------------------------------------
RHLB_SHIF8      ----------------------------------------------------------------------
RHLB_PHOPR      ----------------------------------------------------------------------
RH53_ORYSJ      ----------------------------------------------------------------------
DED1_USTMA      ----------------------------------------------------------------------
DED1_PHANO      ----------------------------------------------------------------------
DBP3_PICGU      ----------------------------------------------------------------------
DBP2_NEUCR      ----------------------------------------------------------------------
UVRB_STAES      ----------------------------------------------------------------------
UVRB_STAEQ      ----------------------------------------------------------------------
UVRB_HELAH      ----------------------------------------------------------------------
UVRB_BACHD      ----------------------------------------------------------------------
RHLB_SALTY      ----------------------------------------------------------------------
RHLB_SALTI      ----------------------------------------------------------------------
RHLB_SALSV      ----------------------------------------------------------------------
RHLB_SALPK      ----------------------------------------------------------------------
RHLB_SALPC      ----------------------------------------------------------------------
RHLB_SALPB      ----------------------------------------------------------------------
RHLB_SALNS      ----------------------------------------------------------------------
RHLB_SALHS      ----------------------------------------------------------------------
RHLB_SALG2      ----------------------------------------------------------------------
RHLB_SALEP      ----------------------------------------------------------------------
RHLB_SALDC      ----------------------------------------------------------------------
RHLB_SALCH      ----------------------------------------------------------------------
RHLB_SALAR      ----------------------------------------------------------------------
RHLB_SALA4      ----------------------------------------------------------------------
RHLB_ERWT9      ----------------------------------------------------------------------
MFD_MYCTU       ----------------------------------------------------------------------
MFD_MYCBO       ----------------------------------------------------------------------
DED1_SCHPO      ----------------------------------------------------------------------
DED1_CHAGB      ----------------------------------------------------------------------
DBP5_EMENI      ----------------------------------------------------------------------
DBP5_ASPOR      ----------------------------------------------------------------------
DBP2_GIBZE      ----------------------------------------------------------------------
UVRB_SYNS3      ----------------------------------------------------------------------
UVRB_PROMM      ----------------------------------------------------------------------
UVRB_PROMA      ----------------------------------------------------------------------
UVRB_PROM3      ----------------------------------------------------------------------
UVRB_LACLS      ----------------------------------------------------------------------
UVRB_LACLM      ----------------------------------------------------------------------
UVRB_LACLA      ----------------------------------------------------------------------
UVRB_LACBA      ----------------------------------------------------------------------
UVRB_HELPJ      ----------------------------------------------------------------------
UVRB_HELPH      ----------------------------------------------------------------------
RHLB_SHISS      ----------------------------------------------------------------------
RHLB_SHIFL      ----------------------------------------------------------------------
RHLB_SHIDS      ----------------------------------------------------------------------
RHLB_SHIBS      ----------------------------------------------------------------------
RHLB_SHIB3      ----------------------------------------------------------------------
RHLB_KLEP3      ----------------------------------------------------------------------
RHLB_HAES1      ----------------------------------------------------------------------
RHLB_ESCF3      ----------------------------------------------------------------------
RHLB_ENTS8      ----------------------------------------------------------------------
RHLB_ECOUT      ----------------------------------------------------------------------
RHLB_ECOSM      ----------------------------------------------------------------------
RHLB_ECOSE      ----------------------------------------------------------------------
RHLB_ECOLU      ----------------------------------------------------------------------
RHLB_ECOLI      ----------------------------------------------------------------------
RHLB_ECOLC      ----------------------------------------------------------------------
RHLB_ECOL6      ----------------------------------------------------------------------
RHLB_ECOL5      ----------------------------------------------------------------------
RHLB_ECOK1      ----------------------------------------------------------------------
RHLB_ECOHS      ----------------------------------------------------------------------
RHLB_ECODH      ----------------------------------------------------------------------
RHLB_ECOBW      ----------------------------------------------------------------------
RHLB_ECO8A      ----------------------------------------------------------------------
RHLB_ECO81      ----------------------------------------------------------------------
RHLB_ECO7I      ----------------------------------------------------------------------
RHLB_ECO5E      ----------------------------------------------------------------------
RHLB_ECO55      ----------------------------------------------------------------------
RHLB_ECO45      ----------------------------------------------------------------------
RHLB_ECO27      ----------------------------------------------------------------------
RHLB_ECO24      ----------------------------------------------------------------------
PRP5_PHANO      ----------------------------------------------------------------------
DED1_ASHGO      ----------------------------------------------------------------------
DBP5_ASPCL      ----------------------------------------------------------------------
DBP2_MAGGR      ----------------------------------------------------------------------
UVRB_STRMU      ----------------------------------------------------------------------
UVRB_MYCMS      ----------------------------------------------------------------------
UVRB_METMA      ----------------------------------------------------------------------
UVRB_CAMHC      ----------------------------------------------------------------------
RHLB_HAES2      ----------------------------------------------------------------------
RHLB_HAEIN      ----------------------------------------------------------------------
RHLB_HAEIG      ----------------------------------------------------------------------
RHLB_HAEIE      ----------------------------------------------------------------------
RHLB_CITK8      ----------------------------------------------------------------------
RECG_SYNY3      ----------------------------------------------------------------------
DED1_YARLI      ----------------------------------------------------------------------
UVRB_STRSV      ----------------------------------------------------------------------
UVRB_STRGC      ----------------------------------------------------------------------
UVRB_MYCMO      ----------------------------------------------------------------------
UVRB_LEIXX      ----------------------------------------------------------------------
PRP28_NEUCR     ----------------------------------------------------------------------
DED1_ASPCL      ----------------------------------------------------------------------
UVRB_ZYMMO      ----------------------------------------------------------------------
UVRB_STRS7      ----------------------------------------------------------------------
UVRB_STRS2      ----------------------------------------------------------------------
UVRB_STRPZ      ----------------------------------------------------------------------
UVRB_STRPM      ----------------------------------------------------------------------
UVRB_STRPG      ----------------------------------------------------------------------
UVRB_STRPD      ----------------------------------------------------------------------
UVRB_STRPC      ----------------------------------------------------------------------
UVRB_STRPB      ----------------------------------------------------------------------
UVRB_STRP8      ----------------------------------------------------------------------
UVRB_STRP6      ----------------------------------------------------------------------
UVRB_STRP3      ----------------------------------------------------------------------
UVRB_STRP1      ----------------------------------------------------------------------
UVRB_STREM      ----------------------------------------------------------------------
UVRB_STRE4      ----------------------------------------------------------------------
UVRB_STRA5      ----------------------------------------------------------------------
UVRB_STRA3      ----------------------------------------------------------------------
UVRB_STRA1      ----------------------------------------------------------------------
UVRB_PROMT      ----------------------------------------------------------------------
UVRB_PROM1      ----------------------------------------------------------------------
UVRB_MICLC      ----------------------------------------------------------------------
UVRB_BACSK      ----------------------------------------------------------------------
RHLB_ECO57      ----------------------------------------------------------------------
DED1_BOTFB      ----------------------------------------------------------------------
UVRB_STRPF      ----------------------------------------------------------------------
UVRB_STAS1      ----------------------------------------------------------------------
UVRB_RICAE      ----------------------------------------------------------------------
UVRB_PROM4      ----------------------------------------------------------------------
UVRB_MYCPE      ----------------------------------------------------------------------
UVRB_MICAN      ----------------------------------------------------------------------
UVRB_FRATT      ----------------------------------------------------------------------
ROK1_NEOFI      ----------------------------------------------------------------------
ROK1_ASPFU      ----------------------------------------------------------------------
RHLB_SERP5      ----------------------------------------------------------------------
RHLB_PHOLL      ----------------------------------------------------------------------
RHLB_KLEP7      ----------------------------------------------------------------------
RHLB_AERHH      ----------------------------------------------------------------------
RH3_ARATH       ----------------------------------------------------------------------
PRP28_ASPOR     ----------------------------------------------------------------------
DDX47_DICDI     ----------------------------------------------------------------------
DBP5_CHAGB      ----------------------------------------------------------------------
DBP3_GIBZE      ----------------------------------------------------------------------
UVRB_ONYPE      ----------------------------------------------------------------------
UVRB_CAMJR      ----------------------------------------------------------------------
UVRB_CAMJE      ----------------------------------------------------------------------
UVRB_ANAMM      ----------------------------------------------------------------------
UVRB_ANAMF      ----------------------------------------------------------------------
SPB4_DEBHA      ----------------------------------------------------------------------
RHLB_ENT38      ----------------------------------------------------------------------
RHLB_AERS4      ----------------------------------------------------------------------
RECG_ECOLI      ----------------------------------------------------------------------
PRP28_COCIM     ----------------------------------------------------------------------
I4A3A_XENLA     ----------------------------------------------------------------------
DCL2_ASPOR      ----------------------------------------------------------------------
DBP5_CANGA      ----------------------------------------------------------------------
DBP2_SCLS1      ----------------------------------------------------------------------
DBP2_BOTFB      ----------------------------------------------------------------------
UVRB_RICRS      ----------------------------------------------------------------------
UVRB_RICRO      ----------------------------------------------------------------------
UVRB_RICPU      ----------------------------------------------------------------------
UVRB_RICCN      ----------------------------------------------------------------------
UVRB_LEPBP      ----------------------------------------------------------------------
UVRB_LEPBA      ----------------------------------------------------------------------
UVRB_LACJO      ----------------------------------------------------------------------
UVRB_LACGA      ----------------------------------------------------------------------
UVRB_BEUC1      ----------------------------------------------------------------------
RRP3_CHAGB      ----------------------------------------------------------------------
ROK1_ASPNC      ----------------------------------------------------------------------
RHLB_YERPY      ----------------------------------------------------------------------
RHLB_YERPS      ----------------------------------------------------------------------
RHLB_YERPP      ----------------------------------------------------------------------
RHLB_YERPN      ----------------------------------------------------------------------
RHLB_YERPE      ----------------------------------------------------------------------
RHLB_YERPB      ----------------------------------------------------------------------
RHLB_YERPA      ----------------------------------------------------------------------
RHLB_YERP3      ----------------------------------------------------------------------
RH47A_ORYSJ     ----------------------------------------------------------------------
RH31_ORYSJ      ----------------------------------------------------------------------
PRP28_GIBZE     ----------------------------------------------------------------------
IF4A3_XENTR     ----------------------------------------------------------------------
IF4A3_TAEGU     ----------------------------------------------------------------------
IF4A3_SALSA     ----------------------------------------------------------------------
IF4A3_RAT       ----------------------------------------------------------------------
IF4A3_PIG       ----------------------------------------------------------------------
IF4A3_MOUSE     ----------------------------------------------------------------------
IF4A3_MACFA     ----------------------------------------------------------------------
IF4A3_HUMAN     ----------------------------------------------------------------------
IF4A3_CHICK     ----------------------------------------------------------------------
IF4A3_BOVIN     ----------------------------------------------------------------------
I4A3B_XENLA     ----------------------------------------------------------------------
DED1_PICGU      ----------------------------------------------------------------------
DED1_GIBZE      ----------------------------------------------------------------------
DED1_DEBHA      ----------------------------------------------------------------------
DED1_CRYNE      ----------------------------------------------------------------------
DBP5_PICST      ----------------------------------------------------------------------
UVRB_WOLTR      ----------------------------------------------------------------------
UVRB_CHLMU      ----------------------------------------------------------------------
UVRB_ARTCA      ----------------------------------------------------------------------
ROK1_ASPOR      ----------------------------------------------------------------------
RHLB_PROMH      ----------------------------------------------------------------------
RHLB_HAMD5      ----------------------------------------------------------------------
RECG_ECO57      ----------------------------------------------------------------------
PRP28_ASPTN     ----------------------------------------------------------------------
PRP28_ASPNC     ----------------------------------------------------------------------
MFD_BUCBP       ----------------------------------------------------------------------
DBP5_PHANO      ----------------------------------------------------------------------
DBP3_CRYNE      ----------------------------------------------------------------------
UVRB_RICAH      ----------------------------------------------------------------------
UVRB_ARTS2      ----------------------------------------------------------------------
UVRB_ARTAT      ----------------------------------------------------------------------
ROK1_COCIM      ----------------------------------------------------------------------
ROK1_ASPCL      ----------------------------------------------------------------------
RHLB_PECCP      ----------------------------------------------------------------------
RHLB_PASMU      ----------------------------------------------------------------------
RHLB_ERWCT      ----------------------------------------------------------------------
PRP28_EMENI     ----------------------------------------------------------------------
PRP28_CANAL     ----------------------------------------------------------------------
PRP28_ASPCL     ----------------------------------------------------------------------
DCL2_EMENI      ----------------------------------------------------------------------
DBP5_YEAST      ----------------------------------------------------------------------
DBP5_YEAS7      ----------------------------------------------------------------------
DBP5_NEUCR      ----------------------------------------------------------------------
UVRB_RICPR      ----------------------------------------------------------------------
SPB42_CANAL     ----------------------------------------------------------------------
SPB41_CANAL     ----------------------------------------------------------------------
RHLB_SODGM      ----------------------------------------------------------------------
PRP28_NEOFI     ----------------------------------------------------------------------
PRP28_DEBHA     ----------------------------------------------------------------------
PRP28_ASPFU     ----------------------------------------------------------------------
MS116_SCHPO     ----------------------------------------------------------------------
DDX23_PONAB     ----------------------------------------------------------------------
DDX23_HUMAN     ----------------------------------------------------------------------
DBP3_SCHPO      ----------------------------------------------------------------------
DBP3_LODEL      ----------------------------------------------------------------------
UVRB_RICTY      ----------------------------------------------------------------------
UVRB_RICM5      ----------------------------------------------------------------------
UVRB_RICFE      ----------------------------------------------------------------------
UVRB_RICBR      ----------------------------------------------------------------------
UVRB_RICB8      ----------------------------------------------------------------------
UVRB_RENSM      ----------------------------------------------------------------------
RRP3_BOTFB      ----------------------------------------------------------------------
RH52A_ORYSJ     ----------------------------------------------------------------------
DEAD_BUCBP      ----------------------------------------------------------------------
DDX4_RANLE      ----------------------------------------------------------------------
DCL4_ARATH      ----------------------------------------------------------------------
DCL2_MAGGR      ----------------------------------------------------------------------
DCL22_ASPNC     ----------------------------------------------------------------------
DBP5_MAGGR      ----------------------------------------------------------------------
DBP5_CRYNE      ----------------------------------------------------------------------
DBP4_ASPCL      ----------------------------------------------------------------------
DBP3_PICST      ----------------------------------------------------------------------
DBP2_ASPFU      ----------------------------------------------------------------------
SKI2_YEAST      ----------------------------------------------------------------------
ROK1_EMENI      ----------------------------------------------------------------------
RH47B_ORYSJ     ----------------------------------------------------------------------
RH26_ORYSJ      ----------------------------------------------------------------------
PRP5_YEAST      ----------------------------------------------------------------------
PRP5_YEAS7      ----------------------------------------------------------------------
PRP28_CRYNE     ----------------------------------------------------------------------
PRP28_CANGA     ----------------------------------------------------------------------
MS116_PHANO     ----------------------------------------------------------------------
IF4A_DICDI      ----------------------------------------------------------------------
DBP4_ASHGO      ----------------------------------------------------------------------
DBP3_VANPO      ----------------------------------------------------------------------
DBP2_NEOFI      ----------------------------------------------------------------------
DBP2_ASPOR      ----------------------------------------------------------------------
DBP2_ASPNC      ----------------------------------------------------------------------
DBP2_ASPCL      ----------------------------------------------------------------------
UVRB_CHLCV      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           XXXXXXXXXXXXYSREQVNFFVDQGAVTIVQKEVRRSAAYFEGIEASRPLELNPEQRQARDAVVSSIGSS
PRIA_BACSU      PEGVKIPAAELCKSSATIKTLIQKGLLKESYEEVYRDPYQDKMFKKTEPLPLTDEQRAAFEPIRETLDSD
PRIA_SYNY3      LIVLKNQGGEMWLSASTIQSLAKKGLVAIAEREKLRLFQQ-PSINASQAPELTPAQKQACQTVLPLQGYH
PRIA_CHLPN      ------------------------------------------------PKDLHPEQQSAIDKIFSSLKTS
PRIA_CHLMU      ------------------------------------------------PPTLTQEQIEAINTISQSLITT
PRIA_CHLTR      ------------------------------------------------PPTLNQEQLDAVNTISQSLVAE
PRIA_ECOLI      -------------------------------------------------LRLNTEQATAVGAIHSAADTF
PRIA_HAEIN      -------------------------------------------VNAENRLTLNKQQALAFSQLLFHSGFN
PRIA_TREPA      ------------------------------------SFASCAGVRRTDTYALSGEQRKAIDAITASTGAR
PRIA_RICBR      --------------------------------------------------DLSEEQKQA----LQMLNDS
PRIA_RICCN      --------------------------------------------------DLSEEQKQA----VTILNES
PRIA_RICTY      --------------------------------------------------QLSEEQKQA----VTIFNES
PRIA_RICPR      --------------------------------------------------KLSEEQKQA----VTILNES
PRIA_RICFE      --------------------------------------------------DLSEEQKQA----VTILNES
PRIA_BORBU      -------------------------------------------------LELNNEQQNIYKEIIGSEKTN
PRIA_THEMA      ----------------------------------------------------------------------
PRIA_HELPY      ----------------------------------------------------------------------
PRIA_HELPJ      ----------------------------------------------------------------------
PRIA_RHORU      --------------------------------------------DADRPGPLSADQQAAADGLRTALDQG
PRIA_BUCAI      ----------------------------------------------------------------------
PRIA_BUCAP      ----------------------------------------------------------------------
PRIA_MYCLE      ----------------------------------------------------------------------
PRIA_MYCTU      ----------------------------------------------------------------------
PRIA_MYCBO      ----------------------------------------------------------------------
MFD_HELPJ       ----------------------------ILGKKMDTHLAELEIFKSHAGFEYTSDQEKAIAEISRDLSSH
MFD_HELPY       ----------------------------ILGKKMDVHLAELEVFKSHAGFEYTSDQEKAIAEISKDLSSH
MFD_ECOLI       ----------------------------------------------SFPFETTPDQAQAINAVLSDM--C
RECG_AQUAE      ------------------------------------------------PFKLTRAQERAIKEILEDLSRD
RECG_STRPN      -------------------------------------------VKVSLPFALTQAQEKSLQEILTDMKSD
MFD_STAHJ       --------------------------------------------EMDFPYELTPDQAKSIDEIKGDMERE
MFD_HAEIN       ------------------------------QREAKKGFAFFQQFSATFPFEETYDQEMAINAVISDM--C
MFD_SYNY3       -------------------------------------------LEDSFPYQPTPDQLKAVQDVKRDLEGD
RECG_MYCLE      ------------------------------------------------PFELTEGQREVRDVLSDGLAAT
MFD_STAAW       --------------------------------------------ELDFPYELTPDQAKSIDEIKDDMQKS
MFD_STAAS       --------------------------------------------ELDFPYELTPDQAKSIDEIKDDMQKS
MFD_STAAR       --------------------------------------------ELDFPYELTPDQAKSIDEIKDDMQKS
MFD_STAAN       --------------------------------------------ELDFPYELTPDQAKSIDEIKDDMQKS
MFD_STAAM       --------------------------------------------ELDFPYELTPDQAKSIDEIKDDMQKS
MFD_STAAC       --------------------------------------------ELDFPYELTPDQAKSIDEIKDDMQKS
MFD_STAAB       --------------------------------------------ELDFPYELTPDQAKSIDEIKDDMQKS
MFD_STAA8       --------------------------------------------ELDFPYELTPDQAKSIDEIKDDMQKS
MFD_STAA3       --------------------------------------------ELDFPYELTPDQAKSIDEIKDDMQKS
COMFA_BACSU     --------------------------------------------------KLSSGQQKAANVLIEAI-SK
MFD_STAS1       --------------------------------------------EIDFPYELTPDQSKSIEEIKQDMEIE
RECG_MYCTU      ------------------------------------------------PFELTAGQREVLDVLSDGLAAN
RECG_MYCBO      ------------------------------------------------PFELTAGQREVLDVLSDGLAAN
UVRB_CLOTE      ----------------------------------------------------------------------
UVRB_CLAMS      ----------------------------------------------------------------------
UVRB_CLAM3      ----------------------------------------------------------------------
RECG_BORBU      -------------------------------------------VVSSLPFELTEDQKISIDEIFFDLNSS
MFD_STAES       ------------------------------------------------PYELTPDQSKSIDEIKGDMERA
MFD_STAEQ       ------------------------------------------------PYELTPDQSKSIDEIKGDMERA
UVRB_PROAC      ----------------------------------------------------------------------
UVRB_DESVV      ------------------------------------------------------DQPEAIGQIVANLGQG
UVRB_DESVH      ------------------------------------------------------DQPEAIGQIVANLGHG
MFD_MYXXA       -----------------------------------------------------PDQAKAIEDVLADMQKP
UVRB_PELCD      ----------------------------------------------------------------------
UVRB_CHLL2      ----------------------------------------------------------------------
UVRB_BACTN      ----------------------------------------------------------------------
UVRB_BACFR      ----------------------------------------------------------------------
UVRB_BACFN      ----------------------------------------------------------------------
UVRB_LEGPL      ----------------------------------------------------------------------
UVRB_LEGPH      ----------------------------------------------------------------------
UVRB_LEGPC      ----------------------------------------------------------------------
UVRB_LEGPA      ----------------------------------------------------------------------
UVRB_CHLCH      ----------------------------------------------------------------------
RECG_STAAW      ------------------------------------------------PFELTEAQKSSVNEIFRDLKAP
RECG_STAAS      ------------------------------------------------PFELTEAQKSSVNEIFRDLKAP
RECG_STAAN      ------------------------------------------------PFELTEAQKSSVNEIFRDLKAP
RECG_STAAM      ------------------------------------------------PFELTEAQKSSVNEIFRDLKAP
RECG_STAAC      ------------------------------------------------PFELTEAQKSSVNEIFRDLKAP
RECG_STAA8      ------------------------------------------------PFELTEAQKSSVNEIFRDLKAP
UVRB_THIDA      ----------------------------------------------------------------------
UVRB_SHIFL      ----------------------------------------------------------------------
UVRB_SHIF8      ----------------------------------------------------------------------
UVRB_DESVM      ------------------------------------------------------DQPEAIGQIVSNIEAG
UVRB_CHLPB      ----------------------------------------------------------------------
MFD_BACSU       --------------------------------------------ESAFPYQETEDQLRSIHEIKKDMERE
UVRB_LACSS      ----------------------------------------------------------------------
UVRB_YERPY      ----------------------------------------------------------------------
UVRB_YERPS      ----------------------------------------------------------------------
UVRB_YERPP      ----------------------------------------------------------------------
UVRB_YERPN      ----------------------------------------------------------------------
UVRB_YERPG      ----------------------------------------------------------------------
UVRB_YERPE      ----------------------------------------------------------------------
UVRB_YERPB      ----------------------------------------------------------------------
UVRB_YERPA      ----------------------------------------------------------------------
UVRB_YERP3      ----------------------------------------------------------------------
UVRB_THEYD      ----------------------------------------------------------------------
UVRB_PASMU      ----------------------------------------------------------------------
UVRB_NITEU      ----------------------------------------------------------------------
UVRB_HAMD5      ----------------------------------------------------------------------
UVRB_FERNB      ----------------------------------------------------------------------
UVRB_DESDG      ----------------------------------------------------------------------
UVRB_METTH      ----------------------------------------------------------------------
UVRB_MANSM      ----------------------------------------------------------------------
MFD_BORBU       --------------------------------------------ESEFPYDETPDQIRAIKEIKEDMMSF
UVRB_SHISS      ----------------------------------------------------------------------
UVRB_SHIDS      ----------------------------------------------------------------------
UVRB_SHIBS      ----------------------------------------------------------------------
UVRB_SHIB3      ----------------------------------------------------------------------
UVRB_SALTY      ----------------------------------------------------------------------
UVRB_SALTI      ----------------------------------------------------------------------
UVRB_SALSV      ----------------------------------------------------------------------
UVRB_SALPK      ----------------------------------------------------------------------
UVRB_SALPC      ----------------------------------------------------------------------
UVRB_SALPB      ----------------------------------------------------------------------
UVRB_SALPA      ----------------------------------------------------------------------
UVRB_SALNS      ----------------------------------------------------------------------
UVRB_SALHS      ----------------------------------------------------------------------
UVRB_SALG2      ----------------------------------------------------------------------
UVRB_SALEP      ----------------------------------------------------------------------
UVRB_SALDC      ----------------------------------------------------------------------
UVRB_SALCH      ----------------------------------------------------------------------
UVRB_SALAR      ----------------------------------------------------------------------
UVRB_SALA4      ----------------------------------------------------------------------
UVRB_KLEP7      ----------------------------------------------------------------------
UVRB_KLEP3      ----------------------------------------------------------------------
UVRB_ESCF3      ----------------------------------------------------------------------
UVRB_ENT38      ----------------------------------------------------------------------
UVRB_ECOUT      ----------------------------------------------------------------------
UVRB_ECOSM      ----------------------------------------------------------------------
UVRB_ECOSE      ----------------------------------------------------------------------
UVRB_ECOLU      ----------------------------------------------------------------------
UVRB_ECOLI      ----------------------------------------------------------------------
UVRB_ECOLC      ----------------------------------------------------------------------
UVRB_ECOL6      ----------------------------------------------------------------------
UVRB_ECOL5      ----------------------------------------------------------------------
UVRB_ECOK1      ----------------------------------------------------------------------
UVRB_ECOHS      ----------------------------------------------------------------------
UVRB_ECODH      ----------------------------------------------------------------------
UVRB_ECOBW      ----------------------------------------------------------------------
UVRB_ECO8A      ----------------------------------------------------------------------
UVRB_ECO81      ----------------------------------------------------------------------
UVRB_ECO7I      ----------------------------------------------------------------------
UVRB_ECO5E      ----------------------------------------------------------------------
UVRB_ECO57      ----------------------------------------------------------------------
UVRB_ECO55      ----------------------------------------------------------------------
UVRB_ECO45      ----------------------------------------------------------------------
UVRB_ECO27      ----------------------------------------------------------------------
UVRB_ECO24      ----------------------------------------------------------------------
UVRB_CITK8      ----------------------------------------------------------------------
RECG_STAES      ----------------------------------------------SLPFELTDAQKVSVNEIFRDLKAP
RECG_STAAR      ------------------------------------------------PFELTEAQKSSVNEIFRDLKAP
UVRB_PECCP      ----------------------------------------------------------------------
UVRB_ERWCT      ----------------------------------------------------------------------
UVRB_DECAR      ----------------------------------------------------------------------
UVRB_COLP3      ----------------------------------------------------------------------
UVRB_AZOSE      ----------------------------------------------------------------------
MFD_BUCAI       ----------------------------------------------------------------------
UVRB_YERE8      ----------------------------------------------------------------------
UVRB_VIBF1      ----------------------------------------------------------------------
UVRB_SERP5      ----------------------------------------------------------------------
UVRB_PROMH      ----------------------------------------------------------------------
UVRB_PHOLL      ----------------------------------------------------------------------
UVRB_MYCA5      ----------------------------------------------------------------------
UVRB_HAEIN      ----------------------------------------------------------------------
UVRB_HAEI8      ----------------------------------------------------------------------
UVRB_GEOSL      ----------------------------------------------------------------------
UVB2_MYCPU      ----------------------------------------------------------------------
RECG_PASMU      ----------------------------------------------------------------------
DBP3_YARLI      ----------------------------------------------------------------------
UVRB_VIBVY      ----------------------------------------------------------------------
UVRB_VIBVU      ----------------------------------------------------------------------
UVRB_VIBPA      ----------------------------------------------------------------------
UVRB_THEAB      ----------------------------------------------------------------------
UVRB_IDILO      ----------------------------------------------------------------------
UVRB_HERA2      ----------------------------------------------------------------------
UVRB_COXBU      ----------------------------------------------------------------------
UVRB_COXBR      ----------------------------------------------------------------------
UVRB_COXBN      ----------------------------------------------------------------------
UVRB_COXB2      ----------------------------------------------------------------------
UVRB_CHLPD      ----------------------------------------------------------------------
UVRB_CARHZ      ----------------------------------------------------------------------
UVRB_BORPD      ----------------------------------------------------------------------
UVRB_AQUAE      ----------------------------------------------------------------------
DBP5_ASPFU      ----------------------------------------------------------------------
UVRB_SYNY3      ----------------------------------------------------------------------
UVRB_NATTJ      ----------------------------------------------------------------------
UVRB_FUSNN      ----------------------------------------------------------------------
UVRB_EDWI9      ----------------------------------------------------------------------
UVRB_CLOBM      ----------------------------------------------------------------------
UVRB_CLOBL      ----------------------------------------------------------------------
UVRB_CLOBK      ----------------------------------------------------------------------
UVRB_CLOBJ      ----------------------------------------------------------------------
UVRB_CLOB6      ----------------------------------------------------------------------
UVRB_CLOB1      ----------------------------------------------------------------------
UVRB_CLOAB      ----------------------------------------------------------------------
UVRB_CHRVO      ----------------------------------------------------------------------
UVRB_CAMFF      ----------------------------------------------------------------------
UVRB_BORA1      ----------------------------------------------------------------------
UVRB_ALISL      ----------------------------------------------------------------------
RHLB_ACTSZ      ----------------------------------------------------------------------
RECG_STAEQ      ----------------------------------------------SLPFELTDAQKVSVNEIFRDLKAP
DBP5_NEOFI      ----------------------------------------------------------------------
UVRB_PSEPK      ----------------------------------------------------------------------
UVRB_PSEPF      ----------------------------------------------------------------------
UVRB_PSEF5      ----------------------------------------------------------------------
UVRB_PHOPR      ----------------------------------------------------------------------
UVRB_PARUW      ----------------------------------------------------------------------
UVRB_METST      ----------------------------------------------------------------------
UVRB_GLOVI      ----------------------------------------------------------------------
UVRB_COXB1      ----------------------------------------------------------------------
UVRB_CLOPS      ----------------------------------------------------------------------
UVRB_CLOPE      ----------------------------------------------------------------------
UVRB_CLOP1      ----------------------------------------------------------------------
RECG_HAEIN      ----------------------------------------------------NAQKRVVSDIEQDLIKDY
UVRB_THEEB      ----------------------------------------------------------------------
UVRB_HELHP      ----------------------------------------------------------------------
UVRB_DEHE1      ----------------------------------------------------------------------
UVRB_CYAP7      ----------------------------------------------------------------------
UVRB_THICR      ----------------------------------------------------------------------
UVRB_PSYIN      ----------------------------------------------------------------------
UVRB_NITOC      ----------------------------------------------------------------------
UVRB_METS3      ----------------------------------------------------------------------
UVRB_ERWT9      ----------------------------------------------------------------------
UVRB_ENTFA      ----------------------------------------------------------------------
UVRB_BORPE      ----------------------------------------------------------------------
UVRB_BORPA      ----------------------------------------------------------------------
UVRB_BORBR      ----------------------------------------------------------------------
UVRB_ACTP2      ----------------------------------------------------------------------
RECG_TREPA      ------------------------------------------------PFELTVDQKRVITEITQDLERE
UVRB_PSEAE      ----------------------------------------------------------------------
UVRB_MYCGE      ----------------------------------------------------------------------
UVRB_KOSOT      ----------------------------------------------------------------------
UVRB_CYAP4      ----------------------------------------------------------------------
UVRB_ACIAD      ----------------------------------------------------------------------
UVRB_TROW8      ----------------------------------------------------------------------
UVRB_STRCO      ----------------------------------------------------------------------
UVRB_NEIMB      ----------------------------------------------------------------------
UVRB_NEIMA      ----------------------------------------------------------------------
UVRB_NEIGO      ----------------------------------------------------------------------
UVRB_NEIG1      ----------------------------------------------------------------------
UVRB_LACPL      ----------------------------------------------------------------------
UVRB_CLOBB      ----------------------------------------------------------------------
UVRB_CLOBA      ----------------------------------------------------------------------
UVRB_CHLTE      ----------------------------------------------------------------------
RHLB_VIBHB      ----------------------------------------------------------------------
UVRB_THET8      ----------------------------------------------------------------------
UVRB_STRAW      ----------------------------------------------------------------------
UVRB_RALSO      ----------------------------------------------------------------------
UVRB_RALEJ      ----------------------------------------------------------------------
UVRB_METMP      ----------------------------------------------------------------------
UVRB_LEPBL      ----------------------------------------------------------------------
UVRB_LEPBJ      ----------------------------------------------------------------------
UVRB_LACAC      ----------------------------------------------------------------------
UVRB_BORGA      ----------------------------------------------------------------------
UVRB_BORAP      ----------------------------------------------------------------------
UVRB_ANASP      ----------------------------------------------------------------------
RHLB_ALISL      ----------------------------------------------------------------------
RECG_BACSU      ----------------------------------------------------NAQSRVLREITADMSSPY
DED1_MAGGR      ----------------------------------------------------------------------
DED1_KLULA      ----------------------------------------------------------------------
UVRB_TREDE      ----------------------------------------------------------------------
UVRB_SYNJB      ----------------------------------------------------------------------
UVRB_PSEU2      ----------------------------------------------------------------------
UVRB_PSESM      ----------------------------------------------------------------------
UVRB_PSEHT      ----------------------------------------------------------------------
UVRB_PSE14      ----------------------------------------------------------------------
UVRB_METBU      ----------------------------------------------------------------------
UVRB_LEPIN      ----------------------------------------------------------------------
UVRB_LEPIC      ----------------------------------------------------------------------
UVRB_GEMAT      ----------------------------------------------------------------------
UVRB_EUBR3      ----------------------------------------------------------------------
UVRB_CLOB8      ----------------------------------------------------------------------
UVRB_BORBZ      ----------------------------------------------------------------------
UVRB_BORBU      ----------------------------------------------------------------------
UVRB_ACAM1      ----------------------------------------------------------------------
UVRB_THETN      ----------------------------------------------------------------------
UVRB_GEOKA      ----------------------------------------------------------------------
UVRB_BURPS      ----------------------------------------------------------------------
UVRB_BURMA      ----------------------------------------------------------------------
UVRB_BACCA      ----------------------------------------------------------------------
RHLB_VIBPA      ----------------------------------------------------------------------
UVRB_WOLSU      ----------------------------------------------------------------------
UVRB_THELT      ----------------------------------------------------------------------
UVRB_SYMTH      ----------------------------------------------------------------------
UVRB_MYCUA      ----------------------------------------------------------------------
UVRB_MYCPU      ----------------------------------------------------------------------
UVRB_LACCB      ----------------------------------------------------------------------
UVRB_LACC3      ----------------------------------------------------------------------
UVRB_CALS8      ----------------------------------------------------------------------
UVRB_BACCR      ----------------------------------------------------------------------
UVRB_ANATD      ----------------------------------------------------------------------
RHLB_VIBSL      ----------------------------------------------------------------------
PRP28_MAGGR     ----------------------------------------------------------------------
UVRB_XYLFT      ----------------------------------------------------------------------
UVRB_XYLFM      ----------------------------------------------------------------------
UVRB_XYLFA      ----------------------------------------------------------------------
UVRB_XYLF2      ----------------------------------------------------------------------
UVRB_TREPS      ----------------------------------------------------------------------
UVRB_TREPA      ----------------------------------------------------------------------
UVRB_SYNP6      ----------------------------------------------------------------------
UVRB_SYNJA      ----------------------------------------------------------------------
UVRB_SYNE7      ----------------------------------------------------------------------
UVRB_OCEIH      ----------------------------------------------------------------------
UVRB_CORDI      ----------------------------------------------------------------------
UVRB_BACLD      ----------------------------------------------------------------------
UVRB_BACHK      ----------------------------------------------------------------------
UVRB_BACCZ      ----------------------------------------------------------------------
UVRB_BACC1      ----------------------------------------------------------------------
UVRB_BACAN      ----------------------------------------------------------------------
UVRB_BACA2      ----------------------------------------------------------------------
DED1_LODEL      ----------------------------------------------------------------------
DBP2_CHAGB      ----------------------------------------------------------------------
DBP1_YEAST      ----------------------------------------------------------------------
DBP1_YEAS7      ----------------------------------------------------------------------
UVRB_THEFY      ----------------------------------------------------------------------
UVRB_STRZT      ----------------------------------------------------------------------
UVRB_NATPD      ----------------------------------------------------------------------
UVRB_METCA      ----------------------------------------------------------------------
UVRB_HALMA      ----------------------------------------------------------------------
UVRB_DEHSC      ----------------------------------------------------------------------
UVRB_CYTH3      ----------------------------------------------------------------------
UVRB_CLONN      ----------------------------------------------------------------------
UVRB_CHLAB      ----------------------------------------------------------------------
UVRB_AYWBP      ----------------------------------------------------------------------
RHLB_VIBCM      ----------------------------------------------------------------------
RHLB_VIBCH      ----------------------------------------------------------------------
RHLB_VIBC3      ----------------------------------------------------------------------
RHLB_MANSM      ----------------------------------------------------------------------
DED1_EMENI      ----------------------------------------------------------------------
DED1_ASPOR      ----------------------------------------------------------------------
DED1_ASPNC      ----------------------------------------------------------------------
DBP5_ASPTN      ----------------------------------------------------------------------
DBP1_CANGA      ----------------------------------------------------------------------
UVRB_STRZP      ----------------------------------------------------------------------
UVRB_STRZJ      ----------------------------------------------------------------------
UVRB_STRR6      ----------------------------------------------------------------------
UVRB_STRPS      ----------------------------------------------------------------------
UVRB_STRPN      ----------------------------------------------------------------------
UVRB_STRPJ      ----------------------------------------------------------------------
UVRB_STRPI      ----------------------------------------------------------------------
UVRB_STRP7      ----------------------------------------------------------------------
UVRB_STRP4      ----------------------------------------------------------------------
UVRB_STRP2      ----------------------------------------------------------------------
UVRB_MYCTU      ----------------------------------------------------------------------
UVRB_MYCPN      ----------------------------------------------------------------------
UVRB_MYCLE      ----------------------------------------------------------------------
UVRB_MYCBO      ----------------------------------------------------------------------
UVRB_METAC      ----------------------------------------------------------------------
UVRB_LISMO      ----------------------------------------------------------------------
UVRB_LISMF      ----------------------------------------------------------------------
UVRB_LISIN      ----------------------------------------------------------------------
UVRB_HELPY      ----------------------------------------------------------------------
UVRB_HAEDU      ----------------------------------------------------------------------
UVRB_CHLAD      ----------------------------------------------------------------------
UVRB_BIFLI      ----------------------------------------------------------------------
DED1_SCLS1      ----------------------------------------------------------------------
DED1_NEOFI      ----------------------------------------------------------------------
DED1_CANGA      ----------------------------------------------------------------------
DED1_ASPFU      ----------------------------------------------------------------------
DED1_AJECN      ----------------------------------------------------------------------
DBP5_ASPNC      ----------------------------------------------------------------------
UVRB_XANOR      ----------------------------------------------------------------------
UVRB_XANOP      ----------------------------------------------------------------------
UVRB_XANOM      ----------------------------------------------------------------------
UVRB_XANCP      ----------------------------------------------------------------------
UVRB_XANCB      ----------------------------------------------------------------------
UVRB_XANC8      ----------------------------------------------------------------------
UVRB_XANAC      ----------------------------------------------------------------------
UVRB_SYNPX      ----------------------------------------------------------------------
UVRB_SYNPW      ----------------------------------------------------------------------
UVRB_STAHJ      ----------------------------------------------------------------------
UVRB_RHOBA      ----------------------------------------------------------------------
UVRB_PROMP      ----------------------------------------------------------------------
UVRB_PROM0      ----------------------------------------------------------------------
UVRB_HALSA      ----------------------------------------------------------------------
UVRB_CHLTR      ----------------------------------------------------------------------
UVRB_CHLTA      ----------------------------------------------------------------------
UVRB_CHLCV      ----------------------------------------------------------------------
RH25_ORYSJ      ----------------------------------------------------------------------
PRP28_SCHPO     ----------------------------------------------------------------------
DED1_NEUCR      ----------------------------------------------------------------------
DED1_COCIM      ----------------------------------------------------------------------
DED1_ASPTN      ----------------------------------------------------------------------
UVRB_STRU0      ----------------------------------------------------------------------
UVRB_STRTD      ----------------------------------------------------------------------
UVRB_STRT2      ----------------------------------------------------------------------
UVRB_STRT1      ----------------------------------------------------------------------
UVRB_STAAW      ----------------------------------------------------------------------
UVRB_STAAS      ----------------------------------------------------------------------
UVRB_STAAR      ----------------------------------------------------------------------
UVRB_STAAN      ----------------------------------------------------------------------
UVRB_STAAM      ----------------------------------------------------------------------
UVRB_STAAC      ----------------------------------------------------------------------
UVRB_CHLPN      ----------------------------------------------------------------------
UVRB_BIFLO      ----------------------------------------------------------------------
UVRB_BACSU      ----------------------------------------------------------------------
UVRB_ANAPZ      ----------------------------------------------------------------------
RHLB_VIBVY      ----------------------------------------------------------------------
RHLB_VIBVU      ----------------------------------------------------------------------
RHLB_VIBFM      ----------------------------------------------------------------------
RHLB_VIBF1      ----------------------------------------------------------------------
RHLB_SHIF8      ----------------------------------------------------------------------
RHLB_PHOPR      ----------------------------------------------------------------------
RH53_ORYSJ      ----------------------------------------------------------------------
DED1_USTMA      ----------------------------------------------------------------------
DED1_PHANO      ----------------------------------------------------------------------
DBP3_PICGU      ----------------------------------------------------------------------
DBP2_NEUCR      ----------------------------------------------------------------------
UVRB_STAES      ----------------------------------------------------------------------
UVRB_STAEQ      ----------------------------------------------------------------------
UVRB_HELAH      ----------------------------------------------------------------------
UVRB_BACHD      ----------------------------------------------------------------------
RHLB_SALTY      ----------------------------------------------------------------------
RHLB_SALTI      ----------------------------------------------------------------------
RHLB_SALSV      ----------------------------------------------------------------------
RHLB_SALPK      ----------------------------------------------------------------------
RHLB_SALPC      ----------------------------------------------------------------------
RHLB_SALPB      ----------------------------------------------------------------------
RHLB_SALNS      ----------------------------------------------------------------------
RHLB_SALHS      ----------------------------------------------------------------------
RHLB_SALG2      ----------------------------------------------------------------------
RHLB_SALEP      ----------------------------------------------------------------------
RHLB_SALDC      ----------------------------------------------------------------------
RHLB_SALCH      ----------------------------------------------------------------------
RHLB_SALAR      ----------------------------------------------------------------------
RHLB_SALA4      ----------------------------------------------------------------------
RHLB_ERWT9      ----------------------------------------------------------------------
MFD_MYCTU       ----------------------------------------------------------------------
MFD_MYCBO       ----------------------------------------------------------------------
DED1_SCHPO      ----------------------------------------------------------------------
DED1_CHAGB      ----------------------------------------------------------------------
DBP5_EMENI      ----------------------------------------------------------------------
DBP5_ASPOR      ----------------------------------------------------------------------
DBP2_GIBZE      ----------------------------------------------------------------------
UVRB_SYNS3      ----------------------------------------------------------------------
UVRB_PROMM      ----------------------------------------------------------------------
UVRB_PROMA      ----------------------------------------------------------------------
UVRB_PROM3      ----------------------------------------------------------------------
UVRB_LACLS      ----------------------------------------------------------------------
UVRB_LACLM      ----------------------------------------------------------------------
UVRB_LACLA      ----------------------------------------------------------------------
UVRB_LACBA      ----------------------------------------------------------------------
UVRB_HELPJ      ----------------------------------------------------------------------
UVRB_HELPH      ----------------------------------------------------------------------
RHLB_SHISS      ----------------------------------------------------------------------
RHLB_SHIFL      ----------------------------------------------------------------------
RHLB_SHIDS      ----------------------------------------------------------------------
RHLB_SHIBS      ----------------------------------------------------------------------
RHLB_SHIB3      ----------------------------------------------------------------------
RHLB_KLEP3      ----------------------------------------------------------------------
RHLB_HAES1      ----------------------------------------------------------------------
RHLB_ESCF3      ----------------------------------------------------------------------
RHLB_ENTS8      ----------------------------------------------------------------------
RHLB_ECOUT      ----------------------------------------------------------------------
RHLB_ECOSM      ----------------------------------------------------------------------
RHLB_ECOSE      ----------------------------------------------------------------------
RHLB_ECOLU      ----------------------------------------------------------------------
RHLB_ECOLI      ----------------------------------------------------------------------
RHLB_ECOLC      ----------------------------------------------------------------------
RHLB_ECOL6      ----------------------------------------------------------------------
RHLB_ECOL5      ----------------------------------------------------------------------
RHLB_ECOK1      ----------------------------------------------------------------------
RHLB_ECOHS      ----------------------------------------------------------------------
RHLB_ECODH      ----------------------------------------------------------------------
RHLB_ECOBW      ----------------------------------------------------------------------
RHLB_ECO8A      ----------------------------------------------------------------------
RHLB_ECO81      ----------------------------------------------------------------------
RHLB_ECO7I      ----------------------------------------------------------------------
RHLB_ECO5E      ----------------------------------------------------------------------
RHLB_ECO55      ----------------------------------------------------------------------
RHLB_ECO45      ----------------------------------------------------------------------
RHLB_ECO27      ----------------------------------------------------------------------
RHLB_ECO24      ----------------------------------------------------------------------
PRP5_PHANO      ----------------------------------------------------------------------
DED1_ASHGO      ----------------------------------------------------------------------
DBP5_ASPCL      ----------------------------------------------------------------------
DBP2_MAGGR      ----------------------------------------------------------------------
UVRB_STRMU      ----------------------------------------------------------------------
UVRB_MYCMS      ----------------------------------------------------------------------
UVRB_METMA      ----------------------------------------------------------------------
UVRB_CAMHC      ----------------------------------------------------------------------
RHLB_HAES2      ----------------------------------------------------------------------
RHLB_HAEIN      ----------------------------------------------------------------------
RHLB_HAEIG      ----------------------------------------------------------------------
RHLB_HAEIE      ----------------------------------------------------------------------
RHLB_CITK8      ----------------------------------------------------------------------
RECG_SYNY3      ----------------------------------------------------------------------
DED1_YARLI      ----------------------------------------------------------------------
UVRB_STRSV      ----------------------------------------------------------------------
UVRB_STRGC      ----------------------------------------------------------------------
UVRB_MYCMO      ----------------------------------------------------------------------
UVRB_LEIXX      ----------------------------------------------------------------------
PRP28_NEUCR     ----------------------------------------------------------------------
DED1_ASPCL      ----------------------------------------------------------------------
UVRB_ZYMMO      ----------------------------------------------------------------------
UVRB_STRS7      ----------------------------------------------------------------------
UVRB_STRS2      ----------------------------------------------------------------------
UVRB_STRPZ      ----------------------------------------------------------------------
UVRB_STRPM      ----------------------------------------------------------------------
UVRB_STRPG      ----------------------------------------------------------------------
UVRB_STRPD      ----------------------------------------------------------------------
UVRB_STRPC      ----------------------------------------------------------------------
UVRB_STRPB      ----------------------------------------------------------------------
UVRB_STRP8      ----------------------------------------------------------------------
UVRB_STRP6      ----------------------------------------------------------------------
UVRB_STRP3      ----------------------------------------------------------------------
UVRB_STRP1      ----------------------------------------------------------------------
UVRB_STREM      ----------------------------------------------------------------------
UVRB_STRE4      ----------------------------------------------------------------------
UVRB_STRA5      ----------------------------------------------------------------------
UVRB_STRA3      ----------------------------------------------------------------------
UVRB_STRA1      ----------------------------------------------------------------------
UVRB_PROMT      ----------------------------------------------------------------------
UVRB_PROM1      ----------------------------------------------------------------------
UVRB_MICLC      ----------------------------------------------------------------------
UVRB_BACSK      ----------------------------------------------------------------------
RHLB_ECO57      ----------------------------------------------------------------------
DED1_BOTFB      ----------------------------------------------------------------------
UVRB_STRPF      ----------------------------------------------------------------------
UVRB_STAS1      ----------------------------------------------------------------------
UVRB_RICAE      ----------------------------------------------------------------------
UVRB_PROM4      ----------------------------------------------------------------------
UVRB_MYCPE      ----------------------------------------------------------------------
UVRB_MICAN      ----------------------------------------------------------------------
UVRB_FRATT      ----------------------------------------------------------------------
ROK1_NEOFI      ----------------------------------------------------------------------
ROK1_ASPFU      ----------------------------------------------------------------------
RHLB_SERP5      ----------------------------------------------------------------------
RHLB_PHOLL      ----------------------------------------------------------------------
RHLB_KLEP7      ----------------------------------------------------------------------
RHLB_AERHH      ----------------------------------------------------------------------
RH3_ARATH       ----------------------------------------------------------------------
PRP28_ASPOR     ----------------------------------------------------------------------
DDX47_DICDI     ----------------------------------------------------------------------
DBP5_CHAGB      ----------------------------------------------------------------------
DBP3_GIBZE      ----------------------------------------------------------------------
UVRB_ONYPE      ----------------------------------------------------------------------
UVRB_CAMJR      ----------------------------------------------------------------------
UVRB_CAMJE      ----------------------------------------------------------------------
UVRB_ANAMM      ----------------------------------------------------------------------
UVRB_ANAMF      ----------------------------------------------------------------------
SPB4_DEBHA      ----------------------------------------------------------------------
RHLB_ENT38      ----------------------------------------------------------------------
RHLB_AERS4      ----------------------------------------------------------------------
RECG_ECOLI      ----------------------------------------------------------------------
PRP28_COCIM     ----------------------------------------------------------------------
I4A3A_XENLA     ----------------------------------------------------------------------
DCL2_ASPOR      ----------------------------------------------------------------------
DBP5_CANGA      ----------------------------------------------------------------------
DBP2_SCLS1      ----------------------------------------------------------------------
DBP2_BOTFB      ----------------------------------------------------------------------
UVRB_RICRS      ----------------------------------------------------------------------
UVRB_RICRO      ----------------------------------------------------------------------
UVRB_RICPU      ----------------------------------------------------------------------
UVRB_RICCN      ----------------------------------------------------------------------
UVRB_LEPBP      ----------------------------------------------------------------------
UVRB_LEPBA      ----------------------------------------------------------------------
UVRB_LACJO      ----------------------------------------------------------------------
UVRB_LACGA      ----------------------------------------------------------------------
UVRB_BEUC1      ----------------------------------------------------------------------
RRP3_CHAGB      ----------------------------------------------------------------------
ROK1_ASPNC      ----------------------------------------------------------------------
RHLB_YERPY      ----------------------------------------------------------------------
RHLB_YERPS      ----------------------------------------------------------------------
RHLB_YERPP      ----------------------------------------------------------------------
RHLB_YERPN      ----------------------------------------------------------------------
RHLB_YERPE      ----------------------------------------------------------------------
RHLB_YERPB      ----------------------------------------------------------------------
RHLB_YERPA      ----------------------------------------------------------------------
RHLB_YERP3      ----------------------------------------------------------------------
RH47A_ORYSJ     ----------------------------------------------------------------------
RH31_ORYSJ      ----------------------------------------------------------------------
PRP28_GIBZE     ----------------------------------------------------------------------
IF4A3_XENTR     ----------------------------------------------------------------------
IF4A3_TAEGU     ----------------------------------------------------------------------
IF4A3_SALSA     ----------------------------------------------------------------------
IF4A3_RAT       ----------------------------------------------------------------------
IF4A3_PIG       ----------------------------------------------------------------------
IF4A3_MOUSE     ----------------------------------------------------------------------
IF4A3_MACFA     ----------------------------------------------------------------------
IF4A3_HUMAN     ----------------------------------------------------------------------
IF4A3_CHICK     ----------------------------------------------------------------------
IF4A3_BOVIN     ----------------------------------------------------------------------
I4A3B_XENLA     ----------------------------------------------------------------------
DED1_PICGU      ----------------------------------------------------------------------
DED1_GIBZE      ----------------------------------------------------------------------
DED1_DEBHA      ----------------------------------------------------------------------
DED1_CRYNE      ----------------------------------------------------------------------
DBP5_PICST      ----------------------------------------------------------------------
UVRB_WOLTR      ----------------------------------------------------------------------
UVRB_CHLMU      ----------------------------------------------------------------------
UVRB_ARTCA      ----------------------------------------------------------------------
ROK1_ASPOR      ----------------------------------------------------------------------
RHLB_PROMH      ----------------------------------------------------------------------
RHLB_HAMD5      ----------------------------------------------------------------------
RECG_ECO57      ----------------------------------------------------------------------
PRP28_ASPTN     ----------------------------------------------------------------------
PRP28_ASPNC     ----------------------------------------------------------------------
MFD_BUCBP       ------------------------------------------------PFTLTPDQDSAINSVLSDMYKS
DBP5_PHANO      ----------------------------------------------------------------------
DBP3_CRYNE      ----------------------------------------------------------------------
UVRB_RICAH      ----------------------------------------------------------------------
UVRB_ARTS2      ----------------------------------------------------------------------
UVRB_ARTAT      ----------------------------------------------------------------------
ROK1_COCIM      ----------------------------------------------------------------------
ROK1_ASPCL      ----------------------------------------------------------------------
RHLB_PECCP      ----------------------------------------------------------------------
RHLB_PASMU      ----------------------------------------------------------------------
RHLB_ERWCT      ----------------------------------------------------------------------
PRP28_EMENI     ----------------------------------------------------------------------
PRP28_CANAL     ----------------------------------------------------------------------
PRP28_ASPCL     ----------------------------------------------------------------------
DCL2_EMENI      ---------------------------------------------ASIPEERSAEHRARSYQLEMFEASL
DBP5_YEAST      ----------------------------------------------------------------------
DBP5_YEAS7      ----------------------------------------------------------------------
DBP5_NEUCR      ----------------------------------------------------------------------
UVRB_RICPR      ----------------------------------------------------------------------
SPB42_CANAL     ----------------------------------------------------------------------
SPB41_CANAL     ----------------------------------------------------------------------
RHLB_SODGM      ----------------------------------------------------------------------
PRP28_NEOFI     ----------------------------------------------------------------------
PRP28_DEBHA     ----------------------------------------------------------------------
PRP28_ASPFU     ----------------------------------------------------------------------
MS116_SCHPO     ----------------------------------------------------------------------
DDX23_PONAB     ----------------------------------------------------------------------
DDX23_HUMAN     ----------------------------------------------------------------------
DBP3_SCHPO      ----------------------------------------------------------------------
DBP3_LODEL      ----------------------------------------------------------------------
UVRB_RICTY      ----------------------------------------------------------------------
UVRB_RICM5      ----------------------------------------------------------------------
UVRB_RICFE      ----------------------------------------------------------------------
UVRB_RICBR      ----------------------------------------------------------------------
UVRB_RICB8      ----------------------------------------------------------------------
UVRB_RENSM      ----------------------------------------------------------------------
RRP3_BOTFB      ----------------------------------------------------------------------
RH52A_ORYSJ     ----------------------------------------------------------------------
DEAD_BUCBP      ----------------------------------------------------------------SPIQAA
DDX4_RANLE      ----------------------------------------------------------------------
DCL4_ARATH      ----------------------------------------------------------------------
DCL2_MAGGR      --------------------------------------------------------------------SM
DCL22_ASPNC     ----------------------------------------------------------------------
DBP5_MAGGR      ----------------------------------------------------------------------
DBP5_CRYNE      ----------------------------------------------------------------------
DBP4_ASPCL      ----------------------------------------------------------------------
DBP3_PICST      ----------------------------------------------------------------------
DBP2_ASPFU      ----------------------------------------------------------------------
SKI2_YEAST      ----------------------------------------------------------------------
ROK1_EMENI      ----------------------------------------------------------------------
RH47B_ORYSJ     ----------------------------------------------------------------------
RH26_ORYSJ      ----------------------------------------------------------------------
PRP5_YEAST      ----------------------------------------------------------------------
PRP5_YEAS7      ----------------------------------------------------------------------
PRP28_CRYNE     ----------------------------------------------------------------------
PRP28_CANGA     ----------------------------------------------------------------------
MS116_PHANO     ----------------------------------------------------------------------
IF4A_DICDI      ----------------------------------------------------------------------
DBP4_ASHGO      ----------------------------------------------------------------------
DBP3_VANPO      ----------------------------------------------------------------------
DBP2_NEOFI      ----------------------------------------------------------------------
DBP2_ASPOR      ----------------------------------------------------------------------
DBP2_ASPNC      ----------------------------------------------------------------------
DBP2_ASPCL      ----------------------------------------------------------------------
UVRB_CHLCV      --------------------------------------------------ELNESQGHIVEQIIRPTGIP


                         .         *         .         .         .         .         +:350
query           QPPFLLQGITGSGKTEVYLQIIQGALDKGKTAILLVPEISLTPQMTERFIARFGDKVAILHSGLSNGEKY
PRIA_BACSU      EHKFLLHGVTGSGKTEIYLQSIEKVLAKGKEAIVLVPEISLTPQMVNRFKGRFGSQVAVMHSGLSTGEKY
PRIA_SYNY3      Q--VLLHGVTGSGKTEVYLQICGDRLGKGQSVLVLVPEIGLTPQLTDRFRARFGNKVAVYHSGLSSGEKY
PRIA_CHLPN      QHTHLLFGITGSGKTEIYLRATSEALKQGKSTILLVPEIALTVQTVSLFKARFGKDVGVLHHKLSDSDKS
PRIA_CHLMU      KQTCLLFGVTGSGKTEVYLQVIRKARSLGKSVILLVPEVALTIQTLSFFKMHFGAEVGVLHYKLSESERT
PRIA_CHLTR      QQTCLLFGVTGSGKTEVYLQVIRKARALGKSVILLVPEVALTIQTLSFFKMHFGSEVGVLHYKLSDSERT
PRIA_ECOLI      SA-WLLAGVTGSGKTEVYLSVLENVLAQGKQALVMVPEIGLTPQTIARFRERFNAPVEVLHSGLNDSERL
PRIA_HAEIN      V--WLLDGVTGSGKTEIYLQYIEEILKSGKQVLVLVPEIGLTPQTVQRFKVRFNVEIDVLHSNLTDTQRL
PRIA_TREPA      S--FYVHGVTGSGKTEVFLRAAEAVLARGKSVIYLVPEIALTHQVLQEVYVRFGSQAAVLHSALSGSQRL
PRIA_RICBR      NKPILIKGVTGSGKTEVYFYLIAEYLAKGKQALVMLPEIALSTQIINRFKERFGFDPIIWNSSVTKAQKK
PRIA_RICCN      NKPTLVKGVTGSGKTEIYFHLIADYLAKGKQVLVMLPEIALSTQIINRFIERFGFEPIIWNSSVTKAHKK
PRIA_RICTY      NKPTLIKGVTGSGKTEIYFHIIADHLMKGQQVLIMLPEIALSRQIINRFIDRFGFEPIIWNSSVTKAQKK
PRIA_RICPR      NKPTLIKGVTGSGKTEIYFHIIADYLIKGRQVLIMLPEIALGKQIINRFIDRFGFEPIIWNSSVTKAQKK
PRIA_RICFE      NKPTLIKGVTGSGKTEIYFHLIADYLVKGKQVLIMLPEIALSTQIINRFIERFGFEPIIWNSSVTKAQKK
PRIA_BORBU      V--FYLFGIPGSGKTEIFIKLCEYYLALEQQVLFLIPEISLGYQIIKRYALNMHHKIYEYNSKVPNSDKN
PRIA_THEMA      ----LFFGPTGSGKTEALFELIDVYSRKG-TVLFLVPEVSVLTHTLSRLKGAFPDKIGIYHSYLSRARKN
PRIA_HELPY      ----LLFGDTGSGKTEIYMHAIAQTLEQKKSALLLVPEIALTPQMQQRLKRVFKENLGLWHSKLSQNQKK
PRIA_HELPJ      -PASLLFGDTGSGKTEIYMHAIAQTLEQKKSALLLVPEIALTPQMQQRLKKVFKENLGLWHSKLSQNQKK
PRIA_RHORU      FSGLLLEGVTGSGKTEVYFEAIAETLRRGRQALVLLPEIALAAQWPRRFADRFGAAPVQWHSQMGXXXXX
PRIA_BUCAI      -------------KVKFYLGLIQSVLYKGVQILILVPYIKNINTIAFFLEKYFNASIDVMHSKLTSSKYF
PRIA_BUCAP      -------------KVKFYLGLIKECLSKNLQILILVPFVKDIYQILFFLKKYFNVYIDIIHSQLNNEDYL
PRIA_MYCLE      --------------------------------------------------------VVALSAGLGQAVRY
PRIA_MYCTU      ------QALPGELWADRFAEAAAQTVRAGRTVLAIVPDQRDLDTLWQAATALVDESVVALSAGLGPEARY
PRIA_MYCBO      ------QALPGELWADRFAEAAAQTVRAGRTVLAIVPDQRDLDTLWQAATALVDESVVALSAGLGPEARY
MFD_HELPJ       RVDRLLSGDVGFGKTEVAMHAIFCAFLNGFQSALVVPTTLLAHQHFETLKARFGVKVARLDRYIKTSEKS
MFD_HELPY       RVDRLLSGDVGFGKTEVAMHAIFCAFLNGFQSALVVPTTLLAHQHFETLRARFGVKVARLDRYAS--EKN
MFD_ECOLI       QPDRLVCGDVGFGKTEVAMRAAFLAVDNHKQVAVLVPTTLLAQQHYDNFRDRFANRIEMISRFRSAKEQT
RECG_AQUAE      VPMNLLQGDVGSGKTIVAILTSLAVVKSGYQVAVMVPTEILAHQHYKKFLKDYGVNVALLTGSLTPSQKK
RECG_STRPN      HHMNLLQGDVGSGKTVVAGLAMFAAVTAGYQAALMVPTEILAEQHFESLQNLFPNKLALLTGSLKAAEKR
MFD_STAHJ       RPDRLLCGDVGYGKTEVAVRAAFKAVMEGKQVAFLVPTTILAQQHYETLIERMQDQIELISRFRSTKEVK
MFD_HAEIN       QPKALVCGDVGFGKTEVAMRAAFLAVMNHKQVAVLVPTTLLAQQHYENFKDRFANNVEVLSRFKTAKEQK
MFD_SYNY3       RPDRLVCGDVGFGKTEVAVRAIFKAVTSGKQVALLAPTTVLTQQLKERF-APYPITIGLLNRFRTASEKK
RECG_MYCLE      RPNRLLQGEVGSGKTIVAVLAMLQMIDAGYQCVLLAPTEVLAAQLSIRDVAENATQVALLTGSMTMAQKK
MFD_STAAW       RPDRLLCGDVGYGKTEVAVRAAFKAVMEGKQVAFLVPTTILAQQHYETLIERMQDEIQLMSRFRTPKEIK
MFD_STAAS       RPDRLLCGDVGYGKTEVAVRAAFKAVMEGKQVAFLVPTTILAQQHYETLIERMQDEIQLMSRFRTPKEIK
MFD_STAAR       RPDRLLCGDVGYGKTEVAVRAAFKAVMEGKQVAFLVPTTILAQQHYETLIERMQDEIQLMSRFRTPKEIK
MFD_STAAN       RPDRLLCGDVGYGKTEVAVRAAFKAVMEGKQVAFLVPTTILAQQHYETLIERMQDEIQLMSRFRTPKEIK
MFD_STAAM       RPDRLLCGDVGYGKTEVAVRAAFKAVMEGKQVAFLVPTTILAQQHYETLIERMQDEIQLMSRFRTPKEIK
MFD_STAAC       RPDRLLCGDVGYGKTEVAVRAAFKAVMEGKQVAFLVPTTILAQQHYETLIERMQDEIQLMSRFRTPKEIK
MFD_STAAB       RPDRLLCGDVGYGKTEVAVRAAFKAVMEGKQVAFLVPTTILAQQHYETLIERMQDEIQLMSRFRTPKEIK
MFD_STAA8       RPDRLLCGDVGYGKTEVAVRAAFKAVMEGKQVAFLVPTTILAQQHYETLIERMQDEIQLMSRFRTPKEIK
MFD_STAA3       RPDRLLCGDVGYGKTEVAVRAAFKAVMEGKQVAFLVPTTILAQQHYETLIERMQDEIQLMSRFRTPKEIK
COMFA_BACSU     KEELLIWAVCGAGKTEMLFPGIESALNQGLRVCIATPRTDVVLELAPRLKAAFGADISALYGGSDDKGRL
MFD_STAS1       RPDRLLCGDVGYGKTEVAVRAAFKAVMEGKQVAFLVPTTILAQQHYETLIERMQDEVQLISRFRTTKEVK
RECG_MYCTU      RPNRLLQGEVGSGKTIVAVLAMLQMVDAGYQCALLAPTEVLAAQHLRSIRAENATRVALLTGSMTAGQKK
RECG_MYCBO      RPNRLLQGEVGSGKTIVAVLAMLQMVDAGYQCALLAPTEVLAAQHLRSIRAENATRVALLTGSMTAGQKK
UVRB_CLOTE      ----------------------------------------------------------------------
UVRB_CLAMS      ----------------------------------------------------------------------
UVRB_CLAM3      ----------------------------------------------------------------------
RECG_BORBU      KPMNLLQGDVGSGKTLVALLSGLPLIEAGYQVAFMAPTDLLARQHYDNILAPFNISMTLLTGSLRKKDKE
MFD_STAES       RPDRLLCGDVGYGKTEVAVRAAFKAVMDGKQVAFLVPTTILAQQHYETLLERMQDEIQLVSRFRTAKEIR
MFD_STAEQ       RPDRLLCGDVGYGKTEVAVRAAFKAVMDGKQVAFLVPTTILAQQHYETLLERMQDEIQLVSRFRTAKEIR
UVRB_PROAC      ----------------------------------------------------------------------
UVRB_DESVV      VRDQVLLGVTGSGKTFTVANVIAAC---NRPALILAPNKTLAAQLYNEFRALFPD---------------
UVRB_DESVH      VRDQVLLGVTGSGKTFTVANVIAAC---NRPALILAPNKTLAAQLYNEFRALFPD---------------
MFD_MYXXA       EPDRLVCGDVGYGKTEVAMRAFKAALDRKQVAV-LVPTTVLAQQHFLSFKKRFADYPVTVESGLKKAPEV
UVRB_PELCD      ----------------------------------------------------------------------
UVRB_CHLL2      ----------------------------------------------------------------------
UVRB_BACTN      ----------------------------------------------------------------------
UVRB_BACFR      ----------------------------------------------------------------------
UVRB_BACFN      ----------------------------------------------------------------------
UVRB_LEGPL      ----------------------------------------------------------------------
UVRB_LEGPH      ----------------------------------------------------------------------
UVRB_LEGPC      ----------------------------------------------------------------------
UVRB_LEGPA      ----------------------------------------------------------------------
UVRB_CHLCH      ----------------------------------------------------------------------
RECG_STAAW      RMHRLLQGDVGSGKTVVAAICMYALKTAGYQSALMVPTEILAEQHAESLMALFGDNVALLTGSVKGKKRK
RECG_STAAS      RMHRLLQGDVGSGKTVVAAICMYALKTAGYQSALMVPTEILAEQHAESLMALFGDNVALLTGSVKGKKRK
RECG_STAAN      RMHRLLQGDVGSGKTVVAAICMYALKTAGYQSALMVPTEILAEQHAESLMALFGDNVALLTGSVKGKKRK
RECG_STAAM      RMHRLLQGDVGSGKTVVAAICMYALKTAGYQSALMVPTEILAEQHAESLMALFGDNVALLTGSVKGKKRK
RECG_STAAC      RMHRLLQGDVGSGKTVVAAICMYALKTAGYQSALMVPTEILAEQHAESLMALFGDNVALLTGSVKGKKRK
RECG_STAA8      RMHRLLQGDVGSGKTVVAAICMYALKTAGYQSALMVPTEILAEQHAESLMALFGDNVALLTGSVKGKKRK
UVRB_THIDA      ----------------------------------------------------------------------
UVRB_SHIFL      ----------------------------------------------------------------------
UVRB_SHIF8      ----------------------------------------------------------------------
UVRB_DESVM      VTDQVLLGVTGSGKTFTMAQVIARC---GRPALVLAPNKTLAAQLYNEF---------------------
UVRB_CHLPB      ----------------------------------------------------------------------
MFD_BACSU       RPDRLLCGDVGYGKTEVAIRAAFKAIGDGKQVALLVPTTILAQQHYETIKERFQDNIGLLSRFRTRKEAN
UVRB_LACSS      ----------------------------------------------------------------------
UVRB_YERPY      ----------------------------------------------------------------------
UVRB_YERPS      ----------------------------------------------------------------------
UVRB_YERPP      ----------------------------------------------------------------------
UVRB_YERPN      ----------------------------------------------------------------------
UVRB_YERPG      ----------------------------------------------------------------------
UVRB_YERPE      ----------------------------------------------------------------------
UVRB_YERPB      ----------------------------------------------------------------------
UVRB_YERPA      ----------------------------------------------------------------------
UVRB_YERP3      ----------------------------------------------------------------------
UVRB_THEYD      ----------------------------------------------------------------------
UVRB_PASMU      ----------------------------------------------------------------------
UVRB_NITEU      ----------------------------------------------------------------------
UVRB_HAMD5      ----------------------------------------------------------------------
UVRB_FERNB      ----------------------------------------------------------------------
UVRB_DESDG      ----------------------------------------------------------------------
UVRB_METTH      ----------------------------------------------------------------------
UVRB_MANSM      ----------------------------------------------------------------------
MFD_BORBU       KVDRLLCGDVGFGKTEVAMRAAFKAVMGNKQVIVLSPTTILAEQHFNTFKKRFKNKIEVLSRFIKNNAES
UVRB_SHISS      ----------------------------------------------------------------------
UVRB_SHIDS      ----------------------------------------------------------------------
UVRB_SHIBS      ----------------------------------------------------------------------
UVRB_SHIB3      ----------------------------------------------------------------------
UVRB_SALTY      ----------------------------------------------------------------------
UVRB_SALTI      ----------------------------------------------------------------------
UVRB_SALSV      ----------------------------------------------------------------------
UVRB_SALPK      ----------------------------------------------------------------------
UVRB_SALPC      ----------------------------------------------------------------------
UVRB_SALPB      ----------------------------------------------------------------------
UVRB_SALPA      ----------------------------------------------------------------------
UVRB_SALNS      ----------------------------------------------------------------------
UVRB_SALHS      ----------------------------------------------------------------------
UVRB_SALG2      ----------------------------------------------------------------------
UVRB_SALEP      ----------------------------------------------------------------------
UVRB_SALDC      ----------------------------------------------------------------------
UVRB_SALCH      ----------------------------------------------------------------------
UVRB_SALAR      ----------------------------------------------------------------------
UVRB_SALA4      ----------------------------------------------------------------------
UVRB_KLEP7      ----------------------------------------------------------------------
UVRB_KLEP3      ----------------------------------------------------------------------
UVRB_ESCF3      ----------------------------------------------------------------------
UVRB_ENT38      ----------------------------------------------------------------------
UVRB_ECOUT      ----------------------------------------------------------------------
UVRB_ECOSM      ----------------------------------------------------------------------
UVRB_ECOSE      ----------------------------------------------------------------------
UVRB_ECOLU      ----------------------------------------------------------------------
UVRB_ECOLI      ----------------------------------------------------------------------
UVRB_ECOLC      ----------------------------------------------------------------------
UVRB_ECOL6      ----------------------------------------------------------------------
UVRB_ECOL5      ----------------------------------------------------------------------
UVRB_ECOK1      ----------------------------------------------------------------------
UVRB_ECOHS      ----------------------------------------------------------------------
UVRB_ECODH      ----------------------------------------------------------------------
UVRB_ECOBW      ----------------------------------------------------------------------
UVRB_ECO8A      ----------------------------------------------------------------------
UVRB_ECO81      ----------------------------------------------------------------------
UVRB_ECO7I      ----------------------------------------------------------------------
UVRB_ECO5E      ----------------------------------------------------------------------
UVRB_ECO57      ----------------------------------------------------------------------
UVRB_ECO55      ----------------------------------------------------------------------
UVRB_ECO45      ----------------------------------------------------------------------
UVRB_ECO27      ----------------------------------------------------------------------
UVRB_ECO24      ----------------------------------------------------------------------
UVRB_CITK8      ----------------------------------------------------------------------
RECG_STAES      RMHRLLQGDVGSGKTVVAAICMYALKTAGYQSALMVPTEILAEQHAESLIQLFGNNVALLTGSVKGKKRR
RECG_STAAR      RMHRLLQGDVGSGKTVVAAICMYALKTAGYQSALMVPTEILAEQHAESLIALFGDNVALLTGSVKGKKRK
UVRB_PECCP      ----------------------------------------------------------------------
UVRB_ERWCT      ----------------------------------------------------------------------
UVRB_DECAR      ----------------------------------------------------------------------
UVRB_COLP3      ----------------------------------------------------------------------
UVRB_AZOSE      ----------------------------------------------------------------------
MFD_BUCAI       ----LICGDVGFGKTEIAMRASFLAVSNKKQVAILVPTTLLAQQHYKNFKIRFSNNINILSRFQTQKEQD
UVRB_YERE8      ----------------------------------------------------------------------
UVRB_VIBF1      ----------------------------------------------------------------------
UVRB_SERP5      ----------------------------------------------------------------------
UVRB_PROMH      ----------------------------------------------------------------------
UVRB_PHOLL      ----------------------------------------------------------------------
UVRB_MYCA5      ----------------------------------------------------------------------
UVRB_HAEIN      ----------------------------------------------------------------------
UVRB_HAEI8      ----------------------------------------------------------------------
UVRB_GEOSL      ----------------------------------------------------------------------
UVB2_MYCPU      ----------------------------------------------------------------------
RECG_PASMU      ----LVQGDVGSGKTLVXXXXXXXXIDNGKQVALMAPTEILAEQHARRWFESLGIEVGWLAGKVKGKARQ
DBP3_YARLI      ----------------------------------------------------------------------
UVRB_VIBVY      ----------------------------------------------------------------------
UVRB_VIBVU      ----------------------------------------------------------------------
UVRB_VIBPA      ----------------------------------------------------------------------
UVRB_THEAB      ----------------------------------------------------------------------
UVRB_IDILO      ----------------------------------------------------------------------
UVRB_HERA2      ----------------------------------------------------------------------
UVRB_COXBU      ----------------------------------------------------------------------
UVRB_COXBR      ----------------------------------------------------------------------
UVRB_COXBN      ----------------------------------------------------------------------
UVRB_COXB2      ----------------------------------------------------------------------
UVRB_CHLPD      ----------------------------------------------------------------------
UVRB_CARHZ      ----------------------------------------------------------------------
UVRB_BORPD      ----------------------------------------------------------------------
UVRB_AQUAE      ----------------------------------------------------------------------
DBP5_ASPFU      ----------------------------------------------------------------------
UVRB_SYNY3      ----------------------------------------------------------------------
UVRB_NATTJ      ----------------------------------------------------------------------
UVRB_FUSNN      ----------------------------------------------------------------------
UVRB_EDWI9      ----------------------------------------------------------------------
UVRB_CLOBM      ----------------------------------------------------------------------
UVRB_CLOBL      ----------------------------------------------------------------------
UVRB_CLOBK      ----------------------------------------------------------------------
UVRB_CLOBJ      ----------------------------------------------------------------------
UVRB_CLOB6      ----------------------------------------------------------------------
UVRB_CLOB1      ----------------------------------------------------------------------
UVRB_CLOAB      ----------------------------------------------------------------------
UVRB_CHRVO      ----------------------------------------------------------------------
UVRB_CAMFF      ----------------------------------------------------------------------
UVRB_BORA1      ----------------------------------------------------------------------
UVRB_ALISL      ----------------------------------------------------------------------
RHLB_ACTSZ      ----------------------------------------------------------------------
RECG_STAEQ      RMHRLLQGDVGSGKTIVAAICMYALKTAGYQSALMVPTEILAEQHAESLMQLFGNNVALLTGSVKGKKRR
DBP5_NEOFI      ----------------------------------------------------------------------
UVRB_PSEPK      ----------------------------------------------------------------------
UVRB_PSEPF      ----------------------------------------------------------------------
UVRB_PSEF5      ----------------------------------------------------------------------
UVRB_PHOPR      ----------------------------------------------------------------------
UVRB_PARUW      ----------------------------------------------------------------------
UVRB_METST      ----------------------------------------------------------------------
UVRB_GLOVI      ----------------------------------------------------------------------
UVRB_COXB1      ----------------------------------------------------------------------
UVRB_CLOPS      ----------------------------------------------------------------------
UVRB_CLOPE      ----------------------------------------------------------------------
UVRB_CLOP1      ----------------------------------------------------------------------
RECG_HAEIN      PMMRLVQGDVGSGKXXXXXXXXXXXIDNGKQVALMAPTEILAEQHARRWFKPFGIEVGWLAGKVKGKSRQ
UVRB_THEEB      ----------------------------------------------------------------------
UVRB_HELHP      ----------------------------------------------------------------------
UVRB_DEHE1      ----------------------------------------------------------------------
UVRB_CYAP7      ----------------------------------------------------------------------
UVRB_THICR      ----------------------------------------------------------------------
UVRB_PSYIN      ----------------------------------------------------------------------
UVRB_NITOC      ----------------------------------------------------------------------
UVRB_METS3      ----------------------------------------------------------------------
UVRB_ERWT9      ----------------------------------------------------------------------
UVRB_ENTFA      ----------------------------------------------------------------------
UVRB_BORPE      ----------------------------------------------------------------------
UVRB_BORPA      ----------------------------------------------------------------------
UVRB_BORBR      ----------------------------------------------------------------------
UVRB_ACTP2      ----------------------------------------------------------------------
RECG_TREPA      EPMALIQGDVGSGKTLVAFFSCLKIIEQGGQVALLAPTELLARQHADRLLAPIGIRLAFLTGNVKSEGRA
UVRB_PSEAE      ----------------------------------------------------------------------
UVRB_MYCGE      ----------------------------------------------------------------------
UVRB_KOSOT      ----------------------------------------------------------------------
UVRB_CYAP4      ----------------------------------------------------------------------
UVRB_ACIAD      ----------------------------------------------------------------------
UVRB_TROW8      ----------------------------------------------------------------------
UVRB_STRCO      ----------------------------------------------------------------------
UVRB_NEIMB      ----------------------------------------------------------------------
UVRB_NEIMA      ----------------------------------------------------------------------
UVRB_NEIGO      ----------------------------------------------------------------------
UVRB_NEIG1      ----------------------------------------------------------------------
UVRB_LACPL      ----------------------------------------------------------------------
UVRB_CLOBB      ----------------------------------------------------------------------
UVRB_CLOBA      ----------------------------------------------------------------------
UVRB_CHLTE      ----------------------------------------------------------------------
RHLB_VIBHB      ----------------------------------------------------------------------
UVRB_THET8      ----------------------------------------------------------------------
UVRB_STRAW      ----------------------------------------------------------------------
UVRB_RALSO      ----------------------------------------------------------------------
UVRB_RALEJ      ----------------------------------------------------------------------
UVRB_METMP      ----------------------------------------------------------------------
UVRB_LEPBL      ----------------------------------------------------------------------
UVRB_LEPBJ      ----------------------------------------------------------------------
UVRB_LACAC      ----------------------------------------------------------------------
UVRB_BORGA      ----------------------------------------------------------------------
UVRB_BORAP      ----------------------------------------------------------------------
UVRB_ANASP      ----------------------------------------------------------------------
RHLB_ALISL      ----------------------------------------------------------------------
RECG_BACSU      RMNRLLQGDVGSGKTXXXXXXXXXXXXSGYQGALMVPTEILAEQHADSLVSLFEKSVALLTSSVKGKRRK
DED1_MAGGR      ----------------------------------------------------------------------
DED1_KLULA      ----------------------------------------------------------------------
UVRB_TREDE      ----------------------------------------------------------------------
UVRB_SYNJB      ----------------------------------------------------------------------
UVRB_PSEU2      ----------------------------------------------------------------------
UVRB_PSESM      ----------------------------------------------------------------------
UVRB_PSEHT      ----------------------------------------------------------------------
UVRB_PSE14      ----------------------------------------------------------------------
UVRB_METBU      ----------------------------------------------------------------------
UVRB_LEPIN      ----------------------------------------------------------------------
UVRB_LEPIC      ----------------------------------------------------------------------
UVRB_GEMAT      ----------------------------------------------------------------------
UVRB_EUBR3      ----------------------------------------------------------------------
UVRB_CLOB8      ----------------------------------------------------------------------
UVRB_BORBZ      ----------------------------------------------------------------------
UVRB_BORBU      ----------------------------------------------------------------------
UVRB_ACAM1      ----------------------------------------------------------------------
UVRB_THETN      ----------------------------------------------------------------------
UVRB_GEOKA      ----------------------------------------------------------------------
UVRB_BURPS      ----------------------------------------------------------------------
UVRB_BURMA      ----------------------------------------------------------------------
UVRB_BACCA      ----------------------------------------------------------------------
RHLB_VIBPA      ----------------------------------------------------------------------
UVRB_WOLSU      ----------------------------------------------------------------------
UVRB_THELT      ----------------------------------------------------------------------
UVRB_SYMTH      ----------------------------------------------------------------------
UVRB_MYCUA      ----------------------------------------------------------------------
UVRB_MYCPU      ----------------------------------------------------------------------
UVRB_LACCB      ----------------------------------------------------------------------
UVRB_LACC3      ----------------------------------------------------------------------
UVRB_CALS8      ----------------------------------------------------------------------
UVRB_BACCR      ----------------------------------------------------------------------
UVRB_ANATD      ----------------------------------------------------------------------
RHLB_VIBSL      ----------------------------------------------------------------------
PRP28_MAGGR     ----------------------------------------------------------------------
UVRB_XYLFT      ----------------------------------------------------------------------
UVRB_XYLFM      ----------------------------------------------------------------------
UVRB_XYLFA      ----------------------------------------------------------------------
UVRB_XYLF2      ----------------------------------------------------------------------
UVRB_TREPS      ----------------------------------------------------------------------
UVRB_TREPA      ----------------------------------------------------------------------
UVRB_SYNP6      ----------------------------------------------------------------------
UVRB_SYNJA      ----------------------------------------------------------------------
UVRB_SYNE7      ----------------------------------------------------------------------
UVRB_OCEIH      ----------------------------------------------------------------------
UVRB_CORDI      ----------------------------------------------------------------------
UVRB_BACLD      ----------------------------------------------------------------------
UVRB_BACHK      ----------------------------------------------------------------------
UVRB_BACCZ      ----------------------------------------------------------------------
UVRB_BACC1      ----------------------------------------------------------------------
UVRB_BACAN      ----------------------------------------------------------------------
UVRB_BACA2      ----------------------------------------------------------------------
DED1_LODEL      ----------------------------------------------------------------------
DBP2_CHAGB      ----------------------------------------------------------------------
DBP1_YEAST      ----------------------------------------------------------------------
DBP1_YEAS7      ----------------------------------------------------------------------
UVRB_THEFY      ----------------------------------------------------------------------
UVRB_STRZT      ----------------------------------------------------------------------
UVRB_NATPD      ----------------------------------------------------------------------
UVRB_METCA      ----------------------------------------------------------------------
UVRB_HALMA      ----------------------------------------------------------------------
UVRB_DEHSC      ----------------------------------------------------------------------
UVRB_CYTH3      ----------------------------------------------------------------------
UVRB_CLONN      ----------------------------------------------------------------------
UVRB_CHLAB      ----------------------------------------------------------------------
UVRB_AYWBP      ----------------------------------------------------------------------
RHLB_VIBCM      ----------------------------------------------------------------------
RHLB_VIBCH      ----------------------------------------------------------------------
RHLB_VIBC3      ----------------------------------------------------------------------
RHLB_MANSM      ----------------------------------------------------------------------
DED1_EMENI      ----------------------------------------------------------------------
DED1_ASPOR      ----------------------------------------------------------------------
DED1_ASPNC      ----------------------------------------------------------------------
DBP5_ASPTN      ----------------------------------------------------------------------
DBP1_CANGA      ----------------------------------------------------------------------
UVRB_STRZP      ----------------------------------------------------------------------
UVRB_STRZJ      ----------------------------------------------------------------------
UVRB_STRR6      ----------------------------------------------------------------------
UVRB_STRPS      ----------------------------------------------------------------------
UVRB_STRPN      ----------------------------------------------------------------------
UVRB_STRPJ      ----------------------------------------------------------------------
UVRB_STRPI      ----------------------------------------------------------------------
UVRB_STRP7      ----------------------------------------------------------------------
UVRB_STRP4      ----------------------------------------------------------------------
UVRB_STRP2      ----------------------------------------------------------------------
UVRB_MYCTU      ----------------------------------------------------------------------
UVRB_MYCPN      ----------------------------------------------------------------------
UVRB_MYCLE      ----------------------------------------------------------------------
UVRB_MYCBO      ----------------------------------------------------------------------
UVRB_METAC      ----------------------------------------------------------------------
UVRB_LISMO      ----------------------------------------------------------------------
UVRB_LISMF      ----------------------------------------------------------------------
UVRB_LISIN      ----------------------------------------------------------------------
UVRB_HELPY      ----------------------------------------------------------------------
UVRB_HAEDU      ----------------------------------------------------------------------
UVRB_CHLAD      ----------------------------------------------------------------------
UVRB_BIFLI      ----------------------------------------------------------------------
DED1_SCLS1      ----------------------------------------------------------------------
DED1_NEOFI      ----------------------------------------------------------------------
DED1_CANGA      ----------------------------------------------------------------------
DED1_ASPFU      ----------------------------------------------------------------------
DED1_AJECN      ----------------------------------------------------------------------
DBP5_ASPNC      ----------------------------------------------------------------------
UVRB_XANOR      ----------------------------------------------------------------------
UVRB_XANOP      ----------------------------------------------------------------------
UVRB_XANOM      ----------------------------------------------------------------------
UVRB_XANCP      ----------------------------------------------------------------------
UVRB_XANCB      ----------------------------------------------------------------------
UVRB_XANC8      ----------------------------------------------------------------------
UVRB_XANAC      ----------------------------------------------------------------------
UVRB_SYNPX      ----------------------------------------------------------------------
UVRB_SYNPW      ----------------------------------------------------------------------
UVRB_STAHJ      ----------------------------------------------------------------------
UVRB_RHOBA      ----------------------------------------------------------------------
UVRB_PROMP      ----------------------------------------------------------------------
UVRB_PROM0      ----------------------------------------------------------------------
UVRB_HALSA      ----------------------------------------------------------------------
UVRB_CHLTR      ----------------------------------------------------------------------
UVRB_CHLTA      ----------------------------------------------------------------------
UVRB_CHLCV      ----------------------------------------------------------------------
RH25_ORYSJ      ----------------------------------------------------------------------
PRP28_SCHPO     ----------------------------------------------------------------------
DED1_NEUCR      ----------------------------------------------------------------------
DED1_COCIM      ----------------------------------------------------------------------
DED1_ASPTN      ----------------------------------------------------------------------
UVRB_STRU0      ----------------------------------------------------------------------
UVRB_STRTD      ----------------------------------------------------------------------
UVRB_STRT2      ----------------------------------------------------------------------
UVRB_STRT1      ----------------------------------------------------------------------
UVRB_STAAW      ----------------------------------------------------------------------
UVRB_STAAS      ----------------------------------------------------------------------
UVRB_STAAR      ----------------------------------------------------------------------
UVRB_STAAN      ----------------------------------------------------------------------
UVRB_STAAM      ----------------------------------------------------------------------
UVRB_STAAC      ----------------------------------------------------------------------
UVRB_CHLPN      ----------------------------------------------------------------------
UVRB_BIFLO      ----------------------------------------------------------------------
UVRB_BACSU      ----------------------------------------------------------------------
UVRB_ANAPZ      ----------------------------------------------------------------------
RHLB_VIBVY      ----------------------------------------------------------------------
RHLB_VIBVU      ----------------------------------------------------------------------
RHLB_VIBFM      ----------------------------------------------------------------------
RHLB_VIBF1      ----------------------------------------------------------------------
RHLB_SHIF8      ----------------------------------------------------------------------
RHLB_PHOPR      ----------------------------------------------------------------------
RH53_ORYSJ      ----------------------------------------------------------------------
DED1_USTMA      ----------------------------------------------------------------------
DED1_PHANO      ----------------------------------------------------------------------
DBP3_PICGU      ----------------------------------------------------------------------
DBP2_NEUCR      ----------------------------------------------------------------------
UVRB_STAES      ----------------------------------------------------------------------
UVRB_STAEQ      ----------------------------------------------------------------------
UVRB_HELAH      ----------------------------------------------------------------------
UVRB_BACHD      ----------------------------------------------------------------------
RHLB_SALTY      ----------------------------------------------------------------------
RHLB_SALTI      ----------------------------------------------------------------------
RHLB_SALSV      ----------------------------------------------------------------------
RHLB_SALPK      ----------------------------------------------------------------------
RHLB_SALPC      ----------------------------------------------------------------------
RHLB_SALPB      ----------------------------------------------------------------------
RHLB_SALNS      ----------------------------------------------------------------------
RHLB_SALHS      ----------------------------------------------------------------------
RHLB_SALG2      ----------------------------------------------------------------------
RHLB_SALEP      ----------------------------------------------------------------------
RHLB_SALDC      ----------------------------------------------------------------------
RHLB_SALCH      ----------------------------------------------------------------------
RHLB_SALAR      ----------------------------------------------------------------------
RHLB_SALA4      ----------------------------------------------------------------------
RHLB_ERWT9      ----------------------------------------------------------------------
MFD_MYCTU       -------GDVGYGKTEIAVRAAFKAVQDGKQVAVLVP----TTLLADQHLQTFGERMSVTIKGLSRFTDA
MFD_MYCBO       -------GDVGYGKTEIAVRAAFKAVQDGKQVAVLVP----TTLLADQHLQTFGERMSVTIKGLSRFTDA
DED1_SCHPO      ----------------------------------------------------------------------
DED1_CHAGB      ----------------------------------------------------------------------
DBP5_EMENI      ----------------------------------------------------------------------
DBP5_ASPOR      ----------------------------------------------------------------------
DBP2_GIBZE      ----------------------------------------------------------------------
UVRB_SYNS3      ----------------------------------------------------------------------
UVRB_PROMM      ----------------------------------------------------------------------
UVRB_PROMA      ----------------------------------------------------------------------
UVRB_PROM3      ----------------------------------------------------------------------
UVRB_LACLS      ----------------------------------------------------------------------
UVRB_LACLM      ----------------------------------------------------------------------
UVRB_LACLA      ----------------------------------------------------------------------
UVRB_LACBA      ----------------------------------------------------------------------
UVRB_HELPJ      ----------------------------------------------------------------------
UVRB_HELPH      ----------------------------------------------------------------------
RHLB_SHISS      ----------------------------------------------------------------------
RHLB_SHIFL      ----------------------------------------------------------------------
RHLB_SHIDS      ----------------------------------------------------------------------
RHLB_SHIBS      ----------------------------------------------------------------------
RHLB_SHIB3      ----------------------------------------------------------------------
RHLB_KLEP3      ----------------------------------------------------------------------
RHLB_HAES1      ----------------------------------------------------------------------
RHLB_ESCF3      ----------------------------------------------------------------------
RHLB_ENTS8      ----------------------------------------------------------------------
RHLB_ECOUT      ----------------------------------------------------------------------
RHLB_ECOSM      ----------------------------------------------------------------------
RHLB_ECOSE      ----------------------------------------------------------------------
RHLB_ECOLU      ----------------------------------------------------------------------
RHLB_ECOLI      ----------------------------------------------------------------------
RHLB_ECOLC      ----------------------------------------------------------------------
RHLB_ECOL6      ----------------------------------------------------------------------
RHLB_ECOL5      ----------------------------------------------------------------------
RHLB_ECOK1      ----------------------------------------------------------------------
RHLB_ECOHS      ----------------------------------------------------------------------
RHLB_ECODH      ----------------------------------------------------------------------
RHLB_ECOBW      ----------------------------------------------------------------------
RHLB_ECO8A      ----------------------------------------------------------------------
RHLB_ECO81      ----------------------------------------------------------------------
RHLB_ECO7I      ----------------------------------------------------------------------
RHLB_ECO5E      ----------------------------------------------------------------------
RHLB_ECO55      ----------------------------------------------------------------------
RHLB_ECO45      ----------------------------------------------------------------------
RHLB_ECO27      ----------------------------------------------------------------------
RHLB_ECO24      ----------------------------------------------------------------------
PRP5_PHANO      ----------------------------------------------------------------------
DED1_ASHGO      ----------------------------------------------------------------------
DBP5_ASPCL      ----------------------------------------------------------------------
DBP2_MAGGR      ----------------------------------------------------------------------
UVRB_STRMU      ----------------------------------------------------------------------
UVRB_MYCMS      ----------------------------------------------------------------------
UVRB_METMA      ----------------------------------------------------------------------
UVRB_CAMHC      ----------------------------------------------------------------------
RHLB_HAES2      ----------------------------------------------------------------------
RHLB_HAEIN      ----------------------------------------------------------------------
RHLB_HAEIG      ----------------------------------------------------------------------
RHLB_HAEIE      ----------------------------------------------------------------------
RHLB_CITK8      ----------------------------------------------------------------------
RECG_SYNY3      ----------------------------------------------------------------------
DED1_YARLI      ----------------------------------------------------------------------
UVRB_STRSV      ----------------------------------------------------------------------
UVRB_STRGC      ----------------------------------------------------------------------
UVRB_MYCMO      ----------------------------------------------------------------------
UVRB_LEIXX      ----------------------------------------------------------------------
PRP28_NEUCR     ----------------------------------------------------------------------
DED1_ASPCL      ----------------------------------------------------------------------
UVRB_ZYMMO      ----------------------------------------------------------------------
UVRB_STRS7      ----------------------------------------------------------------------
UVRB_STRS2      ----------------------------------------------------------------------
UVRB_STRPZ      ----------------------------------------------------------------------
UVRB_STRPM      ----------------------------------------------------------------------
UVRB_STRPG      ----------------------------------------------------------------------
UVRB_STRPD      ----------------------------------------------------------------------
UVRB_STRPC      ----------------------------------------------------------------------
UVRB_STRPB      ----------------------------------------------------------------------
UVRB_STRP8      ----------------------------------------------------------------------
UVRB_STRP6      ----------------------------------------------------------------------
UVRB_STRP3      ----------------------------------------------------------------------
UVRB_STRP1      ----------------------------------------------------------------------
UVRB_STREM      ----------------------------------------------------------------------
UVRB_STRE4      ----------------------------------------------------------------------
UVRB_STRA5      ----------------------------------------------------------------------
UVRB_STRA3      ----------------------------------------------------------------------
UVRB_STRA1      ----------------------------------------------------------------------
UVRB_PROMT      ----------------------------------------------------------------------
UVRB_PROM1      ----------------------------------------------------------------------
UVRB_MICLC      ----------------------------------------------------------------------
UVRB_BACSK      ----------------------------------------------------------------------
RHLB_ECO57      ----------------------------------------------------------------------
DED1_BOTFB      ----------------------------------------------------------------------
UVRB_STRPF      ----------------------------------------------------------------------
UVRB_STAS1      ----------------------------------------------------------------------
UVRB_RICAE      ----------------------------------------------------------------------
UVRB_PROM4      ----------------------------------------------------------------------
UVRB_MYCPE      ----------------------------------------------------------------------
UVRB_MICAN      ----------------------------------------------------------------------
UVRB_FRATT      ----------------------------------------------------------------------
ROK1_NEOFI      ----------------------------------------------------------------------
ROK1_ASPFU      ----------------------------------------------------------------------
RHLB_SERP5      ----------------------------------------------------------------------
RHLB_PHOLL      ----------------------------------------------------------------------
RHLB_KLEP7      ----------------------------------------------------------------------
RHLB_AERHH      ----------------------------------------------------------------------
RH3_ARATH       ----------------------------------------------------------------------
PRP28_ASPOR     ----------------------------------------------------------------------
DDX47_DICDI     ----------------------------------------------------------------------
DBP5_CHAGB      ----------------------------------------------------------------------
DBP3_GIBZE      ----------------------------------------------------------------------
UVRB_ONYPE      ----------------------------------------------------------------------
UVRB_CAMJR      ----------------------------------------------------------------------
UVRB_CAMJE      ----------------------------------------------------------------------
UVRB_ANAMM      ----------------------------------------------------------------------
UVRB_ANAMF      ----------------------------------------------------------------------
SPB4_DEBHA      ----------------------------------------------------------------------
RHLB_ENT38      ----------------------------------------------------------------------
RHLB_AERS4      ----------------------------------------------------------------------
RECG_ECOLI      ----LVQGDVGSGKTXXXXXXXXXXXXHGKQVALMAPTELLAEQHANNFFAPLGIEVGWLAGKQKGKARL
PRP28_COCIM     ----------------------------------------------------------------------
I4A3A_XENLA     ----------------------------------------------------------------------
DCL2_ASPOR      ---------TGTGKTQIALLRIAHQLEGGKLTWFLTPTVALCLQQYEVIRSHLPAVRACTITGLDKVERW
DBP5_CANGA      ----------------------------------------------------------------------
DBP2_SCLS1      ----------------------------------------------------------------------
DBP2_BOTFB      ----------------------------------------------------------------------
UVRB_RICRS      ----------------------------------------------------------------------
UVRB_RICRO      ----------------------------------------------------------------------
UVRB_RICPU      ----------------------------------------------------------------------
UVRB_RICCN      ----------------------------------------------------------------------
UVRB_LEPBP      ----------------------------------------------------------------------
UVRB_LEPBA      ----------------------------------------------------------------------
UVRB_LACJO      ----------------------------------------------------------------------
UVRB_LACGA      ----------------------------------------------------------------------
UVRB_BEUC1      ----------------------------------------------------------------------
RRP3_CHAGB      ----------------------------------------------------------------------
ROK1_ASPNC      ----------------------------------------------------------------------
RHLB_YERPY      ----------------------------------------------------------------------
RHLB_YERPS      ----------------------------------------------------------------------
RHLB_YERPP      ----------------------------------------------------------------------
RHLB_YERPN      ----------------------------------------------------------------------
RHLB_YERPE      ----------------------------------------------------------------------
RHLB_YERPB      ----------------------------------------------------------------------
RHLB_YERPA      ----------------------------------------------------------------------
RHLB_YERP3      ----------------------------------------------------------------------
RH47A_ORYSJ     ----------------------------------------------------------------------
RH31_ORYSJ      ----------------------------------------------------------------------
PRP28_GIBZE     ----------------------------------------------------------------------
IF4A3_XENTR     ----------------------------------------------------------------------
IF4A3_TAEGU     ----------------------------------------------------------------------
IF4A3_SALSA     ----------------------------------------------------------------------
IF4A3_RAT       ----------------------------------------------------------------------
IF4A3_PIG       ----------------------------------------------------------------------
IF4A3_MOUSE     ----------------------------------------------------------------------
IF4A3_MACFA     ----------------------------------------------------------------------
IF4A3_HUMAN     ----------------------------------------------------------------------
IF4A3_CHICK     ----------------------------------------------------------------------
IF4A3_BOVIN     ----------------------------------------------------------------------
I4A3B_XENLA     ----------------------------------------------------------------------
DED1_PICGU      ----------------------------------------------------------------------
DED1_GIBZE      ----------------------------------------------------------------------
DED1_DEBHA      ----------------------------------------------------------------------
DED1_CRYNE      ----------------------------------------------------------------------
DBP5_PICST      ----------------------------------------------------------------------
UVRB_WOLTR      ----------------------------------------------------------------------
UVRB_CHLMU      ----------------------------------------------------------------------
UVRB_ARTCA      ----------------------------------------------------------------------
ROK1_ASPOR      ----------------------------------------------------------------------
RHLB_PROMH      ----------------------------------------------------------------------
RHLB_HAMD5      ----------------------------------------------------------------------
RECG_ECO57      ----LVQGDVGSGKTXXXXXXXXXXXXHGKQVALMAPTELLAEQHANNFRNWFGIEVGWLAGKQKGKARL
PRP28_ASPTN     ----------------------------------------------------------------------
PRP28_ASPNC     ----------------------------------------------------------------------
MFD_BUCBP       TPDRLVCGDVGFGKTEVAMRATFLAVCNQKQVAILVPTTLLAQQHFNNFTLRF-----------------
DBP5_PHANO      ----------------------------------------------------------------------
DBP3_CRYNE      ----------------------------------------------------------------------
UVRB_RICAH      ----------------------------------------------------------------------
UVRB_ARTS2      ----------------------------------------------------------------------
UVRB_ARTAT      ----------------------------------------------------------------------
ROK1_COCIM      ----------------------------------------------------------------------
ROK1_ASPCL      ----------------------------------------------------------------------
RHLB_PECCP      ----------------------------------------------------------------------
RHLB_PASMU      ----------------------------------------------------------------------
RHLB_ERWCT      ----------------------------------------------------------------------
PRP28_EMENI     ----------------------------------------------------------------------
PRP28_CANAL     ----------------------------------------------------------------------
PRP28_ASPCL     ----------------------------------------------------------------------
DCL2_EMENI      KGNIIVVMGTGSGKTQIALLRIIHELENGKLIWFLAPTVPLCLQQ-HRVISQHIP--AVKSRTLLGSDKV
DBP5_YEAST      ----------------------------------------------------------------------
DBP5_YEAS7      ----------------------------------------------------------------------
DBP5_NEUCR      ----------------------------------------------------------------------
UVRB_RICPR      ----------------------------------------------------------------------
SPB42_CANAL     ----------------------------------------------------------------------
SPB41_CANAL     ----------------------------------------------------------------------
RHLB_SODGM      ----------------------------------------------------------------------
PRP28_NEOFI     ----------------------------------------------------------------------
PRP28_DEBHA     ----------------------------------------------------------------------
PRP28_ASPFU     ----------------------------------------------------------------------
MS116_SCHPO     ----------------------------------------------------------------------
DDX23_PONAB     ----------------------------------------------------------------------
DDX23_HUMAN     ----------------------------------------------------------------------
DBP3_SCHPO      ----------------------------------------------------------------------
DBP3_LODEL      ----------------------------------------------------------------------
UVRB_RICTY      ----------------------------------------------------------------------
UVRB_RICM5      ----------------------------------------------------------------------
UVRB_RICFE      ----------------------------------------------------------------------
UVRB_RICBR      ----------------------------------------------------------------------
UVRB_RICB8      ----------------------------------------------------------------------
UVRB_RENSM      ----------------------------------------------------------------------
RRP3_BOTFB      ----------------------------------------------------------------------
RH52A_ORYSJ     ----------------------------------------------------------------------
DEAD_BUCBP      CIPYLIKGKTGSGKTAAFLPLLHNILDVRVPQILLTPTRELAVQVAEAF-SNFSKKLIGVHVALYGGQRY
DDX4_RANLE      ----------------------------------------------------------------------
DCL4_ARATH      ---------TGCGKTHIAVMLIYGHLPKKSVCIFLAPTVALVEQQAKVIADSVNFKVAIHCGGKRIVKSH
DCL2_MAGGR      QQNIIVSMDTGSGKTQVAVLRIRAELEREKRVWFLAPTVALCAQQYEVIRSQIKVANSIVMTGDDN---V
DCL22_ASPNC     ---------TGTGKTQVAILRILADIDKGKFVWLLCPTVALSEQQYIQYATVF------LPSGAEDKAIW
DBP5_MAGGR      ----------------------------------------------------------------------
DBP5_CRYNE      ----------------------------------------------------------------------
DBP4_ASPCL      ----------------------------------------------------------------------
DBP3_PICST      ----------------------------------------------------------------------
DBP2_ASPFU      ----------------------------------------------------------------------
SKI2_YEAST      ----------------------------------------------------------------------
ROK1_EMENI      ----------------------------------------------------------------------
RH47B_ORYSJ     ----------------------------------------------------------------------
RH26_ORYSJ      ----------------------------------------------------------------------
PRP5_YEAST      ----------------------------------------------------------------------
PRP5_YEAS7      ----------------------------------------------------------------------
PRP28_CRYNE     ----------------------------------------------------------------------
PRP28_CANGA     ----------------------------------------------------------------------
MS116_PHANO     ----------------------------------------------------------------------
IF4A_DICDI      ----------------------------------------------------------------------
DBP4_ASHGO      ----------------------------------------------------------------------
DBP3_VANPO      ----------------------------------------------------------------------
DBP2_NEOFI      ----------------------------------------------------------------------
DBP2_ASPOR      ----------------------------------------------------------------------
DBP2_ASPNC      ----------------------------------------------------------------------
DBP2_ASPCL      ----------------------------------------------------------------------
UVRB_CHLCV      DPIPEIRPATG--QVDDLLEEIRKRLSKSQEKILV---ISITKKLAEAFLSELDIAAAYLHSGIETAERT


                         .         .         .         .         *         .         .:420
query           DEWRKVERGDAQVVVGARSAIFAPLKNLGVMIIDEEHEAAYKQDSNPRYHAREVAILRAQYNQATLVLGS
PRIA_BACSU      DEWRKIHRKEVRLVVGARSAIFAPFENLGMIIIDEEHESSYKQEEMPRYHAKEVAIKRAEHHSCPVVLGS
PRIA_SYNY3      DTWRQTLLGHEQIVIGTRSAIFTPLPNLGLIILDEEHDSSFKQTQTPNYHARTVAQRRAELEQCPLILGS
PRIA_CHLPN      RTWRQASEGSLRILIGPRSALFCPMKNLGLIIVDEEHDPAYKQESPPCYHARDVAVMRGKLAHATVVLGS
PRIA_CHLMU      QTWHKAARGLINIIIGPRSAIFCPMQNLGLIIVDEEHDGAYKQDLPPFYQARDVAVMRGKFTNATVILGS
PRIA_CHLTR      QTWYKASRGLINIIIGPRSAIFCPIQNLGLIIVDEEHDSAYKQDLPPFYQARDVAVMRGKMTNATVILGS
PRIA_ECOLI      SAWLKAKNGEAAIVIGTRSALFTPFKNLGVIVIDEEHDSSYKQQEGWRYHARDLAVYRAHSEQIPIILGS
PRIA_HAEIN      YVWDRARSGQSAIVIGTRSALFTQFSNLGAIILDEEHDSSYKQQDSWRYHARDLAIVLAQKLNISVLMGS
PRIA_TREPA      GEWRRIQCMRHCVVIGARSAIFAPLKRLGLVIMDEEHDSSYKSAHVPRYHARQVAMYRCADANCPFVMGS
PRIA_RICBR      MILRGILEDKVKIVIGARSSLFLPFKNLGLIVIDEEHDDSYKQDDGVLYNARDTAIVRSTFDKAQIVLCS
PRIA_RICCN      MILRGILSDKVKVVIGARSSLFLPFKNLGLIVIDEEHDDSYKQDDGILYNARDTAIVRGTFDKAQIVLCS
PRIA_RICTY      MILRGILSDKVKVVIGARSSLFLPFHNLGLIVIDEEHDDSYKQDDNILYNARDTAIVRGVFDKAKIVLCS
PRIA_RICPR      MILRGILSNKVKVVIGTRSSLFLPFHNLGLIVIDEEHDDSYKQDDNILYNARDTAIVRGKFDKAKIVLCS
PRIA_RICFE      MILRGILSDKVKVVIGARSSLFLPFKNLGLVVIDEEHDDSYKQDDGILYNARDTAIVRGTFDKAQIVLCS
PRIA_BORBU      LIWNKVKNGESLVVIGIKSVLMLPFTKLKLIIMDEEHETTYKSENIPRFHSRHISFFLQKKFNAKFVMGS
PRIA_THEMA      LEWYKAASGKIDVLLGTRSAVFVPVKNLSLLIVDEEHDESFYQHTRPSYDAIVVARKISEVFDVPIILSS
PRIA_HELPY      QFLEKLYSQEIKLVVGTRSALFLPLKELGLIIVDEEHDFSYKSHQSPMYNARDLCLYLSHKFPIQVILGS
PRIA_HELPJ      QFLEKLYSQEIKLVVGTRSALFLPLKELGLIIVDEEHDFSYKSQQSPMYNARDLCLYLSHKFPIQVILGS
PRIA_RHORU      XXXXXXXXXXXPVVVGARSALFLPYPDLGLIIVDEEHDSAFKQEEGVPYNARDMAVVRARLGGFPAVLAS
PRIA_BUCAI      SNWVRTKNGENSIVIGTGKSXXXXXXXXXXXXXXEEHNLKYKSINQCRYNIRDLGILRAYKEKIPIILDS
PRIA_BUCAP      KKWIRTKSGKNSIIIGTKNSVFFPFLKLGLIIVNQEHHLNYRNLDQCRYNVRDIAILRAYKQNIPIILDS
PRIA_MYCLE      QRWLKVLRGSARLVIGTRSAVFAPVNDLGLVMVWSDADDMLAEPRAPYPHAREVAMLRAYQARCAALIGG
PRIA_MYCTU      RRWLAALRGSARLVIGTRSAVFAPLSELGLVMVWADADDSLAEPRAPYPHAREVAMLRAHQARCAALIGG
PRIA_MYCBO      RRWLAALRGSARLVIGTRSAVFAPLSELGLVMVWADADDSLAEPRAPYPHAREVAMLRAHQARCAALIGG
MFD_HELPJ       KLLKAVELGLVDVLIGTHAILGTKFKNLGLMVVDEEHKFGVKQ---------------------------
MFD_HELPY       KLLKAVELGQVDALIGTHAILGAKFKNLGLVVVDEEHKFGVKQ---------------------------
MFD_ECOLI       QILAEVAEGKIDILIGTHKLLQSDVKDLGLLIVDEEHRFGVR-------HKERIKAMRANVDILTL---T
RECG_AQUAE      SVYKHVKEGNIHVLVGTHALIKVEFKNLGYVIIDEQHRFGVMQ---------------------------
RECG_STRPN      EVLETIAKGEADLIIGTHALIQDGVERLGLIIIDEQH----------RFGVGQRRILREKGDNPDVLMMT
MFD_STAHJ       ETKEGLKSGYVDIVVGTHKLLGKDIKDLGLLIVDEEQRFGVR-------HKERIKTMKTNVDVLTL---T
MFD_HAEIN       QILENLAEGKVDILIGTHKLIQSDVKDLGLLIIDEEHRFGVGQ-------KEKIKQLRANIDILTL---T
MFD_SYNY3       EILAKLKSGELDIVVGTQQVLGTSVKDLGLLVIDEEQRFGVNQKEKIKTLKTEVDVL-------------
RECG_MYCLE      KVRADIFSGQTGIVIGTHALLQDAIENLGMVVVDEQHRFGVEQRDQLRTKAR------------------
MFD_STAAW       QTKEGLKTGFVDIVVGTHKLLSKDIKDLGLLIVDEEQRFGVR-------HKERIKTLKHNVDVLTL---T
MFD_STAAS       QTKEGLKTGFVDIVVGTHKLLSKDIKDLGLLIVDEEQRFGVR-------HKERIKTLKHNVDVLTL---T
MFD_STAAR       QTKEGLKTGFVDIVVGTHKLLSKDIKDLGLLIVDEEQRFGVR-------HKERIKTLKHNVDVLTL---T
MFD_STAAN       QTKEGLKTGFVDIVVGTHKLLSKDIKDLGLLIVDEEQRFGVR-------HKERIKTLKHNVDVLTL---T
MFD_STAAM       QTKEGLKTGFVDIVVGTHKLLSKDIKDLGLLIVDEEQRFGVR-------HKERIKTLKHNVDVLTL---T
MFD_STAAC       QTKEGLKTGFVDIVVGTHKLLSKDIKDLGLLIVDEEQRFGVR-------HKERIKTLKHNVDVLTL---T
MFD_STAAB       QTKEGLKTGFVDIVVGTHKLLSKDIKDLGLLIVDEEQRFGVR-------HKERIKTLKHNVDVLTL---T
MFD_STAA8       QTKEGLKTGFVDIVVGTHKLLSKDIKDLGLLIVDEEQRFGVR-------HKERIKTLKHNVDVLTL---T
MFD_STAA3       QTKEGLKTGFVDIVVGTHKLLSKDIKDLGLLIVDEEQRFGVR-------HKERIKTLKHNVDVLTL---T
COMFA_BACSU     ----------SPLMISTTHQLLRYKDAIDVMIIDEVDAFPYSADQTLQF-----AVQKARKKNSTLVYLS
MFD_STAS1       ETKEGLKSGFVDIVVGTHKLLGKDIKDLGLLIVDEEQ----------RFGVRHKERIKSLKNNVDVLTLT
RECG_MYCTU      QVRAEIASGQVGIVIGTHALLAVDFHNLGMVVVDEQHRFGVEQRDQLRAKA-------------------
RECG_MYCBO      QVRAEIASGQVGIVIGTHALLAVDFHNLGMVVVDEQHRFGVEQRDQLRAKA-------------------
UVRB_CLOTE      ----------------------------------------------------------------------
UVRB_CLAMS      ----------------------------------------------------------------------
UVRB_CLAM3      ----------------------------------------------------------------------
RECG_BORBU      QALESIRNGTSGLIVGTHAIFYTEFKRLAYVIIDEQHK--------------------------------
MFD_STAES       ETKEGLKSGYVDIVVGTHKLLGKDIKDLGLLIVDEEQRFGVR-------HKERIKTLKKNVDVLTL---T
MFD_STAEQ       ETKEGLKSGYVDIVVGTHKLLGKDIKDLGLLIVDEEQRFGVR-------HKERIKTLKKNVDVLTL---T
UVRB_PROAC      ----------------------------------------------------------------------
UVRB_DESVV      ----------------------------------------------------------------------
UVRB_DESVH      ----------------------------------------------------------------------
MFD_MYXXA       RELKRAKEGKVDILIGTHKLLGGEVKELGLMIVDEEQRFGVKQKESLKKWRSQIDVL-------------
UVRB_PELCD      ----------------------------------------------------------------------
UVRB_CHLL2      ----------------------------------------------------------------------
UVRB_BACTN      ----------------------------------------------------------------------
UVRB_BACFR      ----------------------------------------------------------------------
UVRB_BACFN      ----------------------------------------------------------------------
UVRB_LEGPL      ----------------------------------------------------------------------
UVRB_LEGPH      ----------------------------------------------------------------------
UVRB_LEGPC      ----------------------------------------------------------------------
UVRB_LEGPA      ----------------------------------------------------------------------
UVRB_CHLCH      ----------------------------------------------------------------------
RECG_STAAW      ILLEQLENGTIDCLIGTHALIQDDVHNVGLVITDEQH----------RFGVNQRQLLREKGAMTNVLFMT
RECG_STAAS      ILLEQLENGTIDCLIGTHALIQDDVHNVGLVITDEQH----------RFGVNQRQLLREKGAMTNVLFMT
RECG_STAAN      ILLEQLENGTIDCLIGTHALIQDDVHNVGLVITDEQH----------RFGVNQRQLLREKGAMTNVLFMT
RECG_STAAM      ILLEQLENGTIDCLIGTHALIQDDVHNVGLVITDEQH----------RFGVNQRQLLREKGAMTNVLFMT
RECG_STAAC      ILLEQLENGTIDCLIGTHALIQDDVHNVGLVITDEQH----------RFGVNQRQLLREKGAMTNVLFMT
RECG_STAA8      ILLEQLENGTIDCLIGTHALIQDDVHNVGLVITDEQH----------RFGVNQRQLLREKGAMTNVLFMT
UVRB_THIDA      ----------------------------------------------------------------------
UVRB_SHIFL      ----------------------------------------------------------------------
UVRB_SHIF8      ----------------------------------------------------------------------
UVRB_DESVM      ----------------------------------------------------------------------
UVRB_CHLPB      ----------------------------------------------------------------------
MFD_BACSU       ETIKGLKNGTVDIVIGTHRLLSKDVKDLGLLIIDEEQRFGVT-------HKEKIKQIKANVDVLTL---T
UVRB_LACSS      ----------------------------------------------------------------------
UVRB_YERPY      ----------------------------------------------------------------------
UVRB_YERPS      ----------------------------------------------------------------------
UVRB_YERPP      ----------------------------------------------------------------------
UVRB_YERPN      ----------------------------------------------------------------------
UVRB_YERPG      ----------------------------------------------------------------------
UVRB_YERPE      ----------------------------------------------------------------------
UVRB_YERPB      ----------------------------------------------------------------------
UVRB_YERPA      ----------------------------------------------------------------------
UVRB_YERP3      ----------------------------------------------------------------------
UVRB_THEYD      ----------------------------------------------------------------------
UVRB_PASMU      ----------------------------------------------------------------------
UVRB_NITEU      ----------------------------------------------------------------------
UVRB_HAMD5      ----------------------------------------------------------------------
UVRB_FERNB      ----------------------------------------------------------------------
UVRB_DESDG      ----------------------------------------------------------------------
UVRB_METTH      ----------------------------------------------------------------------
UVRB_MANSM      ----------------------------------------------------------------------
MFD_BORBU       RILKELKSGKIDIIIGTHKILSKKFKNLGLIIIDEEQRFGVKE---------------------------
UVRB_SHISS      ----------------------------------------------------------------------
UVRB_SHIDS      ----------------------------------------------------------------------
UVRB_SHIBS      ----------------------------------------------------------------------
UVRB_SHIB3      ----------------------------------------------------------------------
UVRB_SALTY      ----------------------------------------------------------------------
UVRB_SALTI      ----------------------------------------------------------------------
UVRB_SALSV      ----------------------------------------------------------------------
UVRB_SALPK      ----------------------------------------------------------------------
UVRB_SALPC      ----------------------------------------------------------------------
UVRB_SALPB      ----------------------------------------------------------------------
UVRB_SALPA      ----------------------------------------------------------------------
UVRB_SALNS      ----------------------------------------------------------------------
UVRB_SALHS      ----------------------------------------------------------------------
UVRB_SALG2      ----------------------------------------------------------------------
UVRB_SALEP      ----------------------------------------------------------------------
UVRB_SALDC      ----------------------------------------------------------------------
UVRB_SALCH      ----------------------------------------------------------------------
UVRB_SALAR      ----------------------------------------------------------------------
UVRB_SALA4      ----------------------------------------------------------------------
UVRB_KLEP7      ----------------------------------------------------------------------
UVRB_KLEP3      ----------------------------------------------------------------------
UVRB_ESCF3      ----------------------------------------------------------------------
UVRB_ENT38      ----------------------------------------------------------------------
UVRB_ECOUT      ----------------------------------------------------------------------
UVRB_ECOSM      ----------------------------------------------------------------------
UVRB_ECOSE      ----------------------------------------------------------------------
UVRB_ECOLU      ----------------------------------------------------------------------
UVRB_ECOLI      ----------------------------------------------------------------------
UVRB_ECOLC      ----------------------------------------------------------------------
UVRB_ECOL6      ----------------------------------------------------------------------
UVRB_ECOL5      ----------------------------------------------------------------------
UVRB_ECOK1      ----------------------------------------------------------------------
UVRB_ECOHS      ----------------------------------------------------------------------
UVRB_ECODH      ----------------------------------------------------------------------
UVRB_ECOBW      ----------------------------------------------------------------------
UVRB_ECO8A      ----------------------------------------------------------------------
UVRB_ECO81      ----------------------------------------------------------------------
UVRB_ECO7I      ----------------------------------------------------------------------
UVRB_ECO5E      ----------------------------------------------------------------------
UVRB_ECO57      ----------------------------------------------------------------------
UVRB_ECO55      ----------------------------------------------------------------------
UVRB_ECO45      ----------------------------------------------------------------------
UVRB_ECO27      ----------------------------------------------------------------------
UVRB_ECO24      ----------------------------------------------------------------------
UVRB_CITK8      ----------------------------------------------------------------------
RECG_STAES      LLLEQLENGTIDCLIGTHALIDVVFNNVGLVITDEQH----------RFGVNQRQILREKGAMTNVLFMT
RECG_STAAR      ILLEQLENRTIDCLIGTHALIQDDVHNVGLVITDEQH----------RFGVNQRQLLREKGAMTNVLFMT
UVRB_PECCP      ----------------------------------------------------------------------
UVRB_ERWCT      ----------------------------------------------------------------------
UVRB_DECAR      ----------------------------------------------------------------------
UVRB_COLP3      ----------------------------------------------------------------------
UVRB_AZOSE      ----------------------------------------------------------------------
MFD_BUCAI       LIFKHTKNGRINIIIGTHKLLFKNIESLGLLIIDEEH----------RFGVSHKEIIKKIYSNIDILTLT
UVRB_YERE8      ----------------------------------------------------------------------
UVRB_VIBF1      ----------------------------------------------------------------------
UVRB_SERP5      ----------------------------------------------------------------------
UVRB_PROMH      ----------------------------------------------------------------------
UVRB_PHOLL      ----------------------------------------------------------------------
UVRB_MYCA5      ----------------------------------------------------------------------
UVRB_HAEIN      ----------------------------------------------------------------------
UVRB_HAEI8      ----------------------------------------------------------------------
UVRB_GEOSL      ----------------------------------------------------------------------
UVB2_MYCPU      ----------------------------------------------------------------------
RECG_PASMU      TELEKIRTGQVQMVVGTH-ALFVEFSDLALVIVDEQHRFGVHQ---------------------------
DBP3_YARLI      ----------------------------------------------------------------------
UVRB_VIBVY      ----------------------------------------------------------------------
UVRB_VIBVU      ----------------------------------------------------------------------
UVRB_VIBPA      ----------------------------------------------------------------------
UVRB_THEAB      ----------------------------------------------------------------------
UVRB_IDILO      ----------------------------------------------------------------------
UVRB_HERA2      ----------------------------------------------------------------------
UVRB_COXBU      ----------------------------------------------------------------------
UVRB_COXBR      ----------------------------------------------------------------------
UVRB_COXBN      ----------------------------------------------------------------------
UVRB_COXB2      ----------------------------------------------------------------------
UVRB_CHLPD      ----------------------------------------------------------------------
UVRB_CARHZ      ----------------------------------------------------------------------
UVRB_BORPD      ----------------------------------------------------------------------
UVRB_AQUAE      ----------------------------------------------------------------------
DBP5_ASPFU      ----------------------------------------------------------------------
UVRB_SYNY3      ----------------------------------------------------------------------
UVRB_NATTJ      ----------------------------------------------------------------------
UVRB_FUSNN      ----------------------------------------------------------------------
UVRB_EDWI9      ----------------------------------------------------------------------
UVRB_CLOBM      ----------------------------------------------------------------------
UVRB_CLOBL      ----------------------------------------------------------------------
UVRB_CLOBK      ----------------------------------------------------------------------
UVRB_CLOBJ      ----------------------------------------------------------------------
UVRB_CLOB6      ----------------------------------------------------------------------
UVRB_CLOB1      ----------------------------------------------------------------------
UVRB_CLOAB      ----------------------------------------------------------------------
UVRB_CHRVO      ----------------------------------------------------------------------
UVRB_CAMFF      ----------------------------------------------------------------------
UVRB_BORA1      ----------------------------------------------------------------------
UVRB_ALISL      ----------------------------------------------------------------------
RHLB_ACTSZ      ----------------------------------------------------------------------
RECG_STAEQ      LLLEQLENGTIDCLIGTHALIDVVFNNVGLVITDEQH----------RFGVNQRQILREKGAMTNVLFMT
DBP5_NEOFI      ----------------------------------------------------------------------
UVRB_PSEPK      ----------------------------------------------------------------------
UVRB_PSEPF      ----------------------------------------------------------------------
UVRB_PSEF5      ----------------------------------------------------------------------
UVRB_PHOPR      ----------------------------------------------------------------------
UVRB_PARUW      ----------------------------------------------------------------------
UVRB_METST      ----------------------------------------------------------------------
UVRB_GLOVI      ----------------------------------------------------------------------
UVRB_COXB1      ----------------------------------------------------------------------
UVRB_CLOPS      ----------------------------------------------------------------------
UVRB_CLOPE      ----------------------------------------------------------------------
UVRB_CLOP1      ----------------------------------------------------------------------
RECG_HAEIN      AELEKIKTGAVQMVVGTH-ALFVEFSDLALVIIDEQHRFGVHQ---------------------------
UVRB_THEEB      ----------------------------------------------------------------------
UVRB_HELHP      ----------------------------------------------------------------------
UVRB_DEHE1      ----------------------------------------------------------------------
UVRB_CYAP7      ----------------------------------------------------------------------
UVRB_THICR      ----------------------------------------------------------------------
UVRB_PSYIN      ----------------------------------------------------------------------
UVRB_NITOC      ----------------------------------------------------------------------
UVRB_METS3      ----------------------------------------------------------------------
UVRB_ERWT9      ----------------------------------------------------------------------
UVRB_ENTFA      ----------------------------------------------------------------------
UVRB_BORPE      ----------------------------------------------------------------------
UVRB_BORPA      ----------------------------------------------------------------------
UVRB_BORBR      ----------------------------------------------------------------------
UVRB_ACTP2      ----------------------------------------------------------------------
RECG_TREPA      YLLEALVAGEINLVVGTHALFSKSVRDLRLVIIDEQHRFGVLQRSALIQKGREG---NPQGKTPHIIMMS
UVRB_PSEAE      ----------------------------------------------------------------------
UVRB_MYCGE      ----------------------------------------------------------------------
UVRB_KOSOT      ----------------------------------------------------------------------
UVRB_CYAP4      ----------------------------------------------------------------------
UVRB_ACIAD      ----------------------------------------------------------------------
UVRB_TROW8      ----------------------------------------------------------------------
UVRB_STRCO      ----------------------------------------------------------------------
UVRB_NEIMB      ----------------------------------------------------------------------
UVRB_NEIMA      ----------------------------------------------------------------------
UVRB_NEIGO      ----------------------------------------------------------------------
UVRB_NEIG1      ----------------------------------------------------------------------
UVRB_LACPL      ----------------------------------------------------------------------
UVRB_CLOBB      ----------------------------------------------------------------------
UVRB_CLOBA      ----------------------------------------------------------------------
UVRB_CHLTE      ----------------------------------------------------------------------
RHLB_VIBHB      ----------------------------------------------------------------------
UVRB_THET8      ----------------------------------------------------------------------
UVRB_STRAW      ----------------------------------------------------------------------
UVRB_RALSO      ----------------------------------------------------------------------
UVRB_RALEJ      ----------------------------------------------------------------------
UVRB_METMP      ----------------------------------------------------------------------
UVRB_LEPBL      ----------------------------------------------------------------------
UVRB_LEPBJ      ----------------------------------------------------------------------
UVRB_LACAC      ----------------------------------------------------------------------
UVRB_BORGA      ----------------------------------------------------------------------
UVRB_BORAP      ----------------------------------------------------------------------
UVRB_ANASP      ----------------------------------------------------------------------
RHLB_ALISL      ----------------------------------------------------------------------
RECG_BACSU      ELLERLAAGEIDILVGTHALIEVEFKALSLVITDEQHRFGVEQRKKLRNKGQDPDVL-------------
DED1_MAGGR      ----------------------------------------------------------------------
DED1_KLULA      ----------------------------------------------------------------------
UVRB_TREDE      ----------------------------------------------------------------------
UVRB_SYNJB      ----------------------------------------------------------------------
UVRB_PSEU2      ----------------------------------------------------------------------
UVRB_PSESM      ----------------------------------------------------------------------
UVRB_PSEHT      ----------------------------------------------------------------------
UVRB_PSE14      ----------------------------------------------------------------------
UVRB_METBU      ----------------------------------------------------------------------
UVRB_LEPIN      ----------------------------------------------------------------------
UVRB_LEPIC      ----------------------------------------------------------------------
UVRB_GEMAT      ----------------------------------------------------------------------
UVRB_EUBR3      ----------------------------------------------------------------------
UVRB_CLOB8      ----------------------------------------------------------------------
UVRB_BORBZ      ----------------------------------------------------------------------
UVRB_BORBU      ----------------------------------------------------------------------
UVRB_ACAM1      ----------------------------------------------------------------------
UVRB_THETN      ----------------------------------------------------------------------
UVRB_GEOKA      ----------------------------------------------------------------------
UVRB_BURPS      ----------------------------------------------------------------------
UVRB_BURMA      ----------------------------------------------------------------------
UVRB_BACCA      ----------------------------------------------------------------------
RHLB_VIBPA      ----------------------------------------------------------------------
UVRB_WOLSU      ----------------------------------------------------------------------
UVRB_THELT      ----------------------------------------------------------------------
UVRB_SYMTH      ----------------------------------------------------------------------
UVRB_MYCUA      ----------------------------------------------------------------------
UVRB_MYCPU      ----------------------------------------------------------------------
UVRB_LACCB      ----------------------------------------------------------------------
UVRB_LACC3      ----------------------------------------------------------------------
UVRB_CALS8      ----------------------------------------------------------------------
UVRB_BACCR      ----------------------------------------------------------------------
UVRB_ANATD      ----------------------------------------------------------------------
RHLB_VIBSL      ----------------------------------------------------------------------
PRP28_MAGGR     ----------------------------------------------------------------------
UVRB_XYLFT      ----------------------------------------------------------------------
UVRB_XYLFM      ----------------------------------------------------------------------
UVRB_XYLFA      ----------------------------------------------------------------------
UVRB_XYLF2      ----------------------------------------------------------------------
UVRB_TREPS      ----------------------------------------------------------------------
UVRB_TREPA      ----------------------------------------------------------------------
UVRB_SYNP6      ----------------------------------------------------------------------
UVRB_SYNJA      ----------------------------------------------------------------------
UVRB_SYNE7      ----------------------------------------------------------------------
UVRB_OCEIH      ----------------------------------------------------------------------
UVRB_CORDI      ----------------------------------------------------------------------
UVRB_BACLD      ----------------------------------------------------------------------
UVRB_BACHK      ----------------------------------------------------------------------
UVRB_BACCZ      ----------------------------------------------------------------------
UVRB_BACC1      ----------------------------------------------------------------------
UVRB_BACAN      ----------------------------------------------------------------------
UVRB_BACA2      ----------------------------------------------------------------------
DED1_LODEL      ----------------------------------------------------------------------
DBP2_CHAGB      ----------------------------------------------------------------------
DBP1_YEAST      ----------------------------------------------------------------------
DBP1_YEAS7      ----------------------------------------------------------------------
UVRB_THEFY      ----------------------------------------------------------------------
UVRB_STRZT      ----------------------------------------------------------------------
UVRB_NATPD      ----------------------------------------------------------------------
UVRB_METCA      ----------------------------------------------------------------------
UVRB_HALMA      ----------------------------------------------------------------------
UVRB_DEHSC      ----------------------------------------------------------------------
UVRB_CYTH3      ----------------------------------------------------------------------
UVRB_CLONN      ----------------------------------------------------------------------
UVRB_CHLAB      ----------------------------------------------------------------------
UVRB_AYWBP      ----------------------------------------------------------------------
RHLB_VIBCM      ----------------------------------------------------------------------
RHLB_VIBCH      ----------------------------------------------------------------------
RHLB_VIBC3      ----------------------------------------------------------------------
RHLB_MANSM      ----------------------------------------------------------------------
DED1_EMENI      ----------------------------------------------------------------------
DED1_ASPOR      ----------------------------------------------------------------------
DED1_ASPNC      ----------------------------------------------------------------------
DBP5_ASPTN      ----------------------------------------------------------------------
DBP1_CANGA      ----------------------------------------------------------------------
UVRB_STRZP      ----------------------------------------------------------------------
UVRB_STRZJ      ----------------------------------------------------------------------
UVRB_STRR6      ----------------------------------------------------------------------
UVRB_STRPS      ----------------------------------------------------------------------
UVRB_STRPN      ----------------------------------------------------------------------
UVRB_STRPJ      ----------------------------------------------------------------------
UVRB_STRPI      ----------------------------------------------------------------------
UVRB_STRP7      ----------------------------------------------------------------------
UVRB_STRP4      ----------------------------------------------------------------------
UVRB_STRP2      ----------------------------------------------------------------------
UVRB_MYCTU      ----------------------------------------------------------------------
UVRB_MYCPN      ----------------------------------------------------------------------
UVRB_MYCLE      ----------------------------------------------------------------------
UVRB_MYCBO      ----------------------------------------------------------------------
UVRB_METAC      ----------------------------------------------------------------------
UVRB_LISMO      ----------------------------------------------------------------------
UVRB_LISMF      ----------------------------------------------------------------------
UVRB_LISIN      ----------------------------------------------------------------------
UVRB_HELPY      ----------------------------------------------------------------------
UVRB_HAEDU      ----------------------------------------------------------------------
UVRB_CHLAD      ----------------------------------------------------------------------
UVRB_BIFLI      ----------------------------------------------------------------------
DED1_SCLS1      ------------------SLILAPTRELVSQIFDESRKFAYRSWVRPCYGGADIGSQLRQMERGCDLLVA
DED1_NEOFI      ----------------------------------------------------------------------
DED1_CANGA      ----------------------------------------------------------------------
DED1_ASPFU      ----------------------------------------------------------------------
DED1_AJECN      --------------------ILGPTRELVSQIYDEARKFCYRTALHPRYGGAEMGNQLRQLDQGCNVL-V
DBP5_ASPNC      ----------------------------------------------------------------------
UVRB_XANOR      ----------------------------------------------------------------------
UVRB_XANOP      ----------------------------------------------------------------------
UVRB_XANOM      ----------------------------------------------------------------------
UVRB_XANCP      ----------------------------------------------------------------------
UVRB_XANCB      ----------------------------------------------------------------------
UVRB_XANC8      ----------------------------------------------------------------------
UVRB_XANAC      ----------------------------------------------------------------------
UVRB_SYNPX      ----------------------------------------------------------------------
UVRB_SYNPW      ----------------------------------------------------------------------
UVRB_STAHJ      ----------------------------------------------------------------------
UVRB_RHOBA      ----------------------------------------------------------------------
UVRB_PROMP      ----------------------------------------------------------------------
UVRB_PROM0      ----------------------------------------------------------------------
UVRB_HALSA      ----------------------------------------------------------------------
UVRB_CHLTR      ----------------------------------------------------------------------
UVRB_CHLTA      ----------------------------------------------------------------------
UVRB_CHLCV      ----------------------------------------------------------------------
RH25_ORYSJ      ----------------------------------------------------------------------
PRP28_SCHPO     ----------------------------------------------------------------------
DED1_NEUCR      ----------------------------------------------------------------------
DED1_COCIM      ----------------------------------------------------------------------
DED1_ASPTN      ----------------------------------------------------------------------
UVRB_STRU0      ----------------------------------------------------------------------
UVRB_STRTD      ----------------------------------------------------------------------
UVRB_STRT2      ----------------------------------------------------------------------
UVRB_STRT1      ----------------------------------------------------------------------
UVRB_STAAW      ----------------------------------------------------------------------
UVRB_STAAS      ----------------------------------------------------------------------
UVRB_STAAR      ----------------------------------------------------------------------
UVRB_STAAN      ----------------------------------------------------------------------
UVRB_STAAM      ----------------------------------------------------------------------
UVRB_STAAC      ----------------------------------------------------------------------
UVRB_CHLPN      ----------------------------------------------------------------------
UVRB_BIFLO      ----------------------------------------------------------------------
UVRB_BACSU      ----------------------------------------------------------------------
UVRB_ANAPZ      ----------------------------------------------------------------------
RHLB_VIBVY      ----------------------------------------------------------------------
RHLB_VIBVU      ----------------------------------------------------------------------
RHLB_VIBFM      ----------------------------------------------------------------------
RHLB_VIBF1      ----------------------------------------------------------------------
RHLB_SHIF8      ----------------------------------------------------------------------
RHLB_PHOPR      ----------------------------------------------------------------------
RH53_ORYSJ      ----------------------------------------------------------------------
DED1_USTMA      ----------------------------------------------------------------------
DED1_PHANO      ------------------SLILAPTRELVSQIFDEARKFAYRSWVRPCYGGADIGSQLRQIERGCDLL-V
DBP3_PICGU      ----------------------------------------------------------------------
DBP2_NEUCR      ----------------------------------------------------------------------
UVRB_STAES      ----------------------------------------------------------------------
UVRB_STAEQ      ----------------------------------------------------------------------
UVRB_HELAH      ----------------------------------------------------------------------
UVRB_BACHD      ----------------------------------------------------------------------
RHLB_SALTY      ----------------------------------------------------------------------
RHLB_SALTI      ----------------------------------------------------------------------
RHLB_SALSV      ----------------------------------------------------------------------
RHLB_SALPK      ----------------------------------------------------------------------
RHLB_SALPC      ----------------------------------------------------------------------
RHLB_SALPB      ----------------------------------------------------------------------
RHLB_SALNS      ----------------------------------------------------------------------
RHLB_SALHS      ----------------------------------------------------------------------
RHLB_SALG2      ----------------------------------------------------------------------
RHLB_SALEP      ----------------------------------------------------------------------
RHLB_SALDC      ----------------------------------------------------------------------
RHLB_SALCH      ----------------------------------------------------------------------
RHLB_SALAR      ----------------------------------------------------------------------
RHLB_SALA4      ----------------------------------------------------------------------
RHLB_ERWT9      ----------------------------------------------------------------------
MFD_MYCTU       AESRAVADGSVDIVIGTHRLLQTGVKDLGLVVVDEEQRFGVE-------HKEHIKSLRTHVDVLTM---S
MFD_MYCBO       AESRAVADGSVDIVIGTHRLLQTGVKDLGLVVVDEEQRFGVE-------HKEHIKSLRTHVDVLTM---S
DED1_SCHPO      ----------------------------------------------------------------------
DED1_CHAGB      ----------------------------------------------------------------------
DBP5_EMENI      ----------------------------------------------------------------------
DBP5_ASPOR      ----------------------------------------------------------------------
DBP2_GIBZE      ----------------------------------------------------------------------
UVRB_SYNS3      ----------------------------------------------------------------------
UVRB_PROMM      ----------------------------------------------------------------------
UVRB_PROMA      ----------------------------------------------------------------------
UVRB_PROM3      ----------------------------------------------------------------------
UVRB_LACLS      ----------------------------------------------------------------------
UVRB_LACLM      ----------------------------------------------------------------------
UVRB_LACLA      ----------------------------------------------------------------------
UVRB_LACBA      ----------------------------------------------------------------------
UVRB_HELPJ      ----------------------------------------------------------------------
UVRB_HELPH      ----------------------------------------------------------------------
RHLB_SHISS      ----------------------------------------------------------------------
RHLB_SHIFL      ----------------------------------------------------------------------
RHLB_SHIDS      ----------------------------------------------------------------------
RHLB_SHIBS      ----------------------------------------------------------------------
RHLB_SHIB3      ----------------------------------------------------------------------
RHLB_KLEP3      ----------------------------------------------------------------------
RHLB_HAES1      ----------------------------------------------------------------------
RHLB_ESCF3      ----------------------------------------------------------------------
RHLB_ENTS8      ----------------------------------------------------------------------
RHLB_ECOUT      ----------------------------------------------------------------------
RHLB_ECOSM      ----------------------------------------------------------------------
RHLB_ECOSE      ----------------------------------------------------------------------
RHLB_ECOLU      ----------------------------------------------------------------------
RHLB_ECOLI      ----------------------------------------------------------------------
RHLB_ECOLC      ----------------------------------------------------------------------
RHLB_ECOL6      ----------------------------------------------------------------------
RHLB_ECOL5      ----------------------------------------------------------------------
RHLB_ECOK1      ----------------------------------------------------------------------
RHLB_ECOHS      ----------------------------------------------------------------------
RHLB_ECODH      ----------------------------------------------------------------------
RHLB_ECOBW      ----------------------------------------------------------------------
RHLB_ECO8A      ----------------------------------------------------------------------
RHLB_ECO81      ----------------------------------------------------------------------
RHLB_ECO7I      ----------------------------------------------------------------------
RHLB_ECO5E      ----------------------------------------------------------------------
RHLB_ECO55      ----------------------------------------------------------------------
RHLB_ECO45      ----------------------------------------------------------------------
RHLB_ECO27      ----------------------------------------------------------------------
RHLB_ECO24      ----------------------------------------------------------------------
PRP5_PHANO      ----------------------------------------------------------------------
DED1_ASHGO      ----------------------------------------------------------------------
DBP5_ASPCL      ----------------------------------------------------------------------
DBP2_MAGGR      ----------------------------------------------------------------------
UVRB_STRMU      ----------------------------------------------------------------------
UVRB_MYCMS      ----------------------------------------------------------------------
UVRB_METMA      ----------------------------------------------------------------------
UVRB_CAMHC      ----------------------------------------------------------------------
RHLB_HAES2      ----------------------------------------------------------------------
RHLB_HAEIN      ----------------------------------------------------------------------
RHLB_HAEIG      ----------------------------------------------------------------------
RHLB_HAEIE      ----------------------------------------------------------------------
RHLB_CITK8      ----------------------------------------------------------------------
RECG_SYNY3      ----------------------------------------------------------------------
DED1_YARLI      ----------------------------------------------------------------------
UVRB_STRSV      ----------------------------------------------------------------------
UVRB_STRGC      ----------------------------------------------------------------------
UVRB_MYCMO      ----------------------------------------------------------------------
UVRB_LEIXX      ----------------------------------------------------------------------
PRP28_NEUCR     ----------------------------------------------------------------------
DED1_ASPCL      ----------------------------------------------------------------------
UVRB_ZYMMO      ----------------------------------------------------------------------
UVRB_STRS7      ----------------------------------------------------------------------
UVRB_STRS2      ----------------------------------------------------------------------
UVRB_STRPZ      ----------------------------------------------------------------------
UVRB_STRPM      ----------------------------------------------------------------------
UVRB_STRPG      ----------------------------------------------------------------------
UVRB_STRPD      ----------------------------------------------------------------------
UVRB_STRPC      ----------------------------------------------------------------------
UVRB_STRPB      ----------------------------------------------------------------------
UVRB_STRP8      ----------------------------------------------------------------------
UVRB_STRP6      ----------------------------------------------------------------------
UVRB_STRP3      ----------------------------------------------------------------------
UVRB_STRP1      ----------------------------------------------------------------------
UVRB_STREM      ----------------------------------------------------------------------
UVRB_STRE4      ----------------------------------------------------------------------
UVRB_STRA5      ----------------------------------------------------------------------
UVRB_STRA3      ----------------------------------------------------------------------
UVRB_STRA1      ----------------------------------------------------------------------
UVRB_PROMT      ----------------------------------------------------------------------
UVRB_PROM1      ----------------------------------------------------------------------
UVRB_MICLC      ----------------------------------------------------------------------
UVRB_BACSK      ----------------------------------------------------------------------
RHLB_ECO57      ----------------------------------------------------------------------
DED1_BOTFB      ------------------SLILAPTRELVSQIYDESRKFAYRSWVRPCYGGADIGSQLRQMERGCDLLVA
UVRB_STRPF      ----------------------------------------------------------------------
UVRB_STAS1      ----------------------------------------------------------------------
UVRB_RICAE      ----------------------------------------------------------------------
UVRB_PROM4      ----------------------------------------------------------------------
UVRB_MYCPE      ----------------------------------------------------------------------
UVRB_MICAN      ----------------------------------------------------------------------
UVRB_FRATT      ----------------------------------------------------------------------
ROK1_NEOFI      ----------------------------------------------------------------------
ROK1_ASPFU      ----------------------------------------------------------------------
RHLB_SERP5      ----------------------------------------------------------------------
RHLB_PHOLL      ----------------------------------------------------------------------
RHLB_KLEP7      ----------------------------------------------------------------------
RHLB_AERHH      ----------------------------------------------------------------------
RH3_ARATH       ----------------------------------------------------------------------
PRP28_ASPOR     ----------------------------------------------------------------------
DDX47_DICDI     ----------------------------------------------------------------------
DBP5_CHAGB      ----------------------------------------------------------------------
DBP3_GIBZE      ----------------------------------------------------------------------
UVRB_ONYPE      ----------------------------------------------------------------------
UVRB_CAMJR      ----------------------------------------------------------------------
UVRB_CAMJE      ----------------------------------------------------------------------
UVRB_ANAMM      ----------------------------------------------------------------------
UVRB_ANAMF      ----------------------------------------------------------------------
SPB4_DEBHA      ----------------------------------------------------------------------
RHLB_ENT38      ----------------------------------------------------------------------
RHLB_AERS4      ----------------------------------------------------------------------
RECG_ECOLI      AQQEAIASGQVQMIVGTH-AIFVQFNGLALVIIDEQHRFGVHQ---------------------------
PRP28_COCIM     ----------------------------------------------------------------------
I4A3A_XENLA     ----------------------------------------------------------------------
DCL2_ASPOR      KSWDELLK-DKQVVVSTHAVLFEALTHLGLLIFDEAHHCMRRHPAN------------------------
DBP5_CANGA      ----------------------------------------------------------------------
DBP2_SCLS1      ----------------------------------------------------------------------
DBP2_BOTFB      ----------------------------------------------------------------------
UVRB_RICRS      ----------------------------------------------------------------------
UVRB_RICRO      ----------------------------------------------------------------------
UVRB_RICPU      ----------------------------------------------------------------------
UVRB_RICCN      ----------------------------------------------------------------------
UVRB_LEPBP      ----------------------------------------------------------------------
UVRB_LEPBA      ----------------------------------------------------------------------
UVRB_LACJO      ----------------------------------------------------------------------
UVRB_LACGA      ----------------------------------------------------------------------
UVRB_BEUC1      ----------------------------------------------------------------------
RRP3_CHAGB      ----------------------------------------------------------------------
ROK1_ASPNC      ----------------------------------------------------------------------
RHLB_YERPY      ----------------------------------------------------------------------
RHLB_YERPS      ----------------------------------------------------------------------
RHLB_YERPP      ----------------------------------------------------------------------
RHLB_YERPN      ----------------------------------------------------------------------
RHLB_YERPE      ----------------------------------------------------------------------
RHLB_YERPB      ----------------------------------------------------------------------
RHLB_YERPA      ----------------------------------------------------------------------
RHLB_YERP3      ----------------------------------------------------------------------
RH47A_ORYSJ     ----------------------------------------------------------------------
RH31_ORYSJ      ----------------------------------------------------------------------
PRP28_GIBZE     ----------------------------------------------------------------------
IF4A3_XENTR     ----------------------------------------------------------------------
IF4A3_TAEGU     ----------------------------------------------------------------------
IF4A3_SALSA     ----------------------------------------------------------------------
IF4A3_RAT       ----------------------------------------------------------------------
IF4A3_PIG       ----------------------------------------------------------------------
IF4A3_MOUSE     ----------------------------------------------------------------------
IF4A3_MACFA     ----------------------------------------------------------------------
IF4A3_HUMAN     ----------------------------------------------------------------------
IF4A3_CHICK     ----------------------------------------------------------------------
IF4A3_BOVIN     ----------------------------------------------------------------------
I4A3B_XENLA     ----------------------------------------------------------------------
DED1_PICGU      ----------------------------------------------------------------------
DED1_GIBZE      ----------------------------------------------------------------------
DED1_DEBHA      ----------------------------------------------------------------------
DED1_CRYNE      ----------------------------------------------------------------------
DBP5_PICST      ----------------------------------------------------------------------
UVRB_WOLTR      ----------------------------------------------------------------------
UVRB_CHLMU      ----------------------------------------------------------------------
UVRB_ARTCA      ----------------------------------------------------------------------
ROK1_ASPOR      ----------------------------------------------------------------------
RHLB_PROMH      ----------------------------------------------------------------------
RHLB_HAMD5      ----------------------------------------------------------------------
RECG_ECO57      SQQEAIASGQVQMIVGTH-AIFVQFNGLALVIIDEQHRFGVHQ---------------------------
PRP28_ASPTN     ----------------------------------------------------------------------
PRP28_ASPNC     ----------------------------------------------------------------------
MFD_BUCBP       ----------------------------------------------------------------------
DBP5_PHANO      ----------------------------------------------------------------------
DBP3_CRYNE      ----------------------------------------------------------------------
UVRB_RICAH      ----------------------------------------------------------------------
UVRB_ARTS2      ----------------------------------------------------------------------
UVRB_ARTAT      ----------------------------------------------------------------------
ROK1_COCIM      ----------------------------------------------------------------------
ROK1_ASPCL      ----------------------------------------------------------------------
RHLB_PECCP      ----------------------------------------------------------------------
RHLB_PASMU      ----------------------------------------------------------------------
RHLB_ERWCT      ----------------------------------------------------------------------
PRP28_EMENI     ----------------------------------------------------------------------
PRP28_CANAL     ----------------------------------------------------------------------
PRP28_ASPCL     ----------------------------------------------------------------------
DCL2_EMENI      ELWTEQAVWDAQVIVSTPAVLFVRISRLGLLIFDEAHHCIRKHPTN--------MIMRNFYHPALQEYGG
DBP5_YEAST      ----------------------------------------------------------------------
DBP5_YEAS7      ----------------------------------------------------------------------
DBP5_NEUCR      ----------------------------------------------------------------------
UVRB_RICPR      ----------------------------------------------------------------------
SPB42_CANAL     ----------------------------------------------------------------------
SPB41_CANAL     ----------------------------------------------------------------------
RHLB_SODGM      ----------------------------------------------------------------------
PRP28_NEOFI     ----------------------------------------------------------------------
PRP28_DEBHA     ----------------------------------------------------------------------
PRP28_ASPFU     ----------------------------------------------------------------------
MS116_SCHPO     ----------------------------------------------------------------------
DDX23_PONAB     ----------------------------------------------------------------------
DDX23_HUMAN     ----------------------------------------------------------------------
DBP3_SCHPO      ----------------------------------------------------------------------
DBP3_LODEL      ----------------------------------------------------------------------
UVRB_RICTY      ----------------------------------------------------------------------
UVRB_RICM5      ----------------------------------------------------------------------
UVRB_RICFE      ----------------------------------------------------------------------
UVRB_RICBR      ----------------------------------------------------------------------
UVRB_RICB8      ----------------------------------------------------------------------
UVRB_RENSM      ----------------------------------------------------------------------
RRP3_BOTFB      ----------------------------------------------------------------------
RH52A_ORYSJ     ----------------------------------------------------------------------
DEAD_BUCBP      DLQLKSLRKGPQIIVGTPGRLLDHLKNLHSLVLDEADE--------------------------------
DDX4_RANLE      ----------------------------------------------------------------------
DCL4_ARATH      SEWREIAANEVQILLHNLQHCFIKMECISLLIFDECHHA--QQQSNHPYAEIMKVFYKSESLQASPVVGK
DCL2_MAGGR      DSWSDVQTWDAMILFEALSHAFVTMDSISLLVMDEAHNCTGK----------------------------
DCL22_ASPNC     DSGIKIAVSTYQVLYDALSHGFVKLSQMSLLIFDEAH---------------------------------
DBP5_MAGGR      ----------------------------------------------------------------------
DBP5_CRYNE      ----------------------------------------------------------------------
DBP4_ASPCL      ----------------------------------------------------------------------
DBP3_PICST      ----------------------------------------------------------------------
DBP2_ASPFU      ----------------------------------------------------------------------
SKI2_YEAST      ----------------------------------------------------------------------
ROK1_EMENI      ----------------------------------------------------------------------
RH47B_ORYSJ     ----------------------------------------------------------------------
RH26_ORYSJ      ----------------------------------------------------------------------
PRP5_YEAST      ----------------------------------------------------------------------
PRP5_YEAS7      ----------------------------------------------------------------------
PRP28_CRYNE     ----------------------------------------------------------------------
PRP28_CANGA     ----------------------------------------------------------------------
MS116_PHANO     ----------------------------------------------------------------------
IF4A_DICDI      ----------------------------------------------------------------------
DBP4_ASHGO      ----------------------------------------------------------------------
DBP3_VANPO      ----------------------------------------------------------------------
DBP2_NEOFI      ----------------------------------------------------------------------
DBP2_ASPOR      ----------------------------------------------------------------------
DBP2_ASPNC      ----------------------------------------------------------------------
DBP2_ASPCL      ----------------------------------------------------------------------
UVRB_CHLCV      RILADLRLGNIDVLIGVREGLDLPEVSL-VAILDADKEGFLRSTS---------SLIQFCGRAARNVEGK


                         .         .         +         .         .         .         .:490
query           ATPSLESRARAGKGVYQHLRLTQRANPLATIPEVQVIDFRDYIGQNETSNFTPPLLEAIQDRLVKKEQVV
PRIA_BACSU      ATPTLESYARAQKGVYELLSLKHRVNH-RVMPEVSLVDMREELRNGNRSMFSVELMEKLEETIAKGEQAV
PRIA_SYNY3      ATPSLESHRHQNDPQRHYLELPERVQS-RPLPPVQIVDMRAELKQGNRSIFSRALQTALGELKAKQQQGI
PRIA_CHLPN      ATPSLESYTNALSGKYVXXXXXXXXXXXHPA-KISLINMNLEREKSKTKIFSQPVLKKIAERLEVGEQVL
PRIA_CHLMU      ATPSLESYTNALSKKYTLSVLSKRAS--TSIPKVSLIDMREMEKTRKKILFSPTVIRSIEQRLAVGEQTI
PRIA_CHLTR      ATPSLESYTNALSKKYTLSVLSKRAST-STPTKVFLIDMNLEMEKTRKKPFSQTVIRSIEQRLEVGEQTI
PRIA_ECOLI      ATPALETLCNVQQKKYRLLRLTRRAGNAR--PAIQVLDLK---GQKVQAGLAPALITRMRQHLQADNQVI
PRIA_HAEIN      ATPSLESINNVQNGKYQHLVLSKRAGNSTALRHF-VIDLKN---QNIQNGLSKPLLERMKAHLEKGNQVL
PRIA_TREPA      ATPSVEAWYAMLRGAVRRLPLTARVAGGAP-PRVEVVDV-----SKEALLLSTRLVDEIRKTKEAGYQSM
PRIA_RICBR      ATPSIETMYNANIGKYSVINLSSRYKN-AVLPNIEMIDMKEELPKNYLSNI---LIKAIKNNLENKEQTL
PRIA_RICCN      ATPSIETIHNIEIGKYQLVTLVNRYKNV-DLPNIEIIDM-TXXXXXXXXXXXXXXIEAIKGNLDNKKQVL
PRIA_RICTY      ATPSLETIYNIKTHKYQLVTLVNRYKNI-DLPNIEIIDMKEKLPKN--SYLSKILIDAIKGNLENKKQVL
PRIA_RICPR      ATPSLETIYNIKTHKYQLVTLANRYKNV-DLPNIEIIDMKEKLPKN--SYLSKILIDAIKGNLENKKQAL
PRIA_RICFE      ATPSIETMYNIEIGKYQLVTLVNRYNNV-DLPNIEIIDMKEKLSKN--SYLSKILIEAIKDNLDNKKQVL
PRIA_BORBU      ATPSLEAYHAMKNNQIKKI-IMQNKFSQSKIEDIKIINMK-----KEPSTISSELLYSIQKSLNEKRQSL
PRIA_THEMA      ATPDLWTYREAKEGRIRTFNFTRRFGSLS----VEVVDMRN---EEKIGSFAKKTLDRIEETLEEGKRVL
PRIA_HELPY      ATPSLNSYKRFKDKAL--VRLKGRYTPTQ----------KNIIFEKTERFITPKLLEALQQVLDKNEQAI
PRIA_HELPJ      ATPSLSSYQRFKDKAL--VRLKGRYTPTQ----------KNIIFEKTERFITPKLLEALKQVIDKNEQAI
PRIA_RHORU      ATPSLETIENARQGRYRHLVLPRRHGG-AEMPEITLLDLRDFAGPGGSEGLSPPLITAVEETLAAGEQVL
PRIA_BUCAI      ETPSLKTLNNVLHRKCFYIKLXXXXXXXXXXXXXXXL-------KTEKIKFSLTLINEIYKNFTGK-QVL
PRIA_BUCAP      DTPSLRTLYNILHKKCFYIKFIK--NKKTFFLKNNVIDLRK---ERIKIGLSSTLINEIFNNIQKNYPVL
PRIA_MYCLE      YTRTAEAHALVRSG-WAHDXXXXXXXXXXXXXXXXXLDDSGYAEESDTXXXXXXXXXXXXXXXXXXXXVL
PRIA_MYCTU      YARTAEAHALVRSG-WAHDVVAPRPEVRARSPRVVALDDSGYXXXXXXXXXXXXLLRAARSALQSGAPVL
PRIA_MYCBO      YARTAEAHALVRSG-WAHDVVAPRPEVRARSPRVVALDDSGYXXXXXXXXXXXXLLRAARSALQSGAPVL
MFD_HELPJ       ----------------------------------------------------------------------
MFD_HELPY       ----------------------------------------------------------------------
MFD_ECOLI       ATP-------------------------------------------------------------------
RECG_AQUAE      ----------------------------------------------------------------------
RECG_STRPN      ATP-------------------------------------------------------------------
MFD_STAHJ       ATPIPRTLHMSMLGV-------RDLSVIETPPENR-FPVQTYV-LEQNSNF---IKEALERELSRDGQVF
MFD_HAEIN       ATPIPRTLNMAMNGI--------RDLSIISTPPARRLSIKTFVRQNDDL----VVREAILREILRGGQVY
MFD_SYNY3       ----------------------------------------------------------------------
RECG_MYCLE      ----------------------------------------------------------------------
MFD_STAAW       ATP-------------------------------------------------------------------
MFD_STAAS       ATP-------------------------------------------------------------------
MFD_STAAR       ATP-------------------------------------------------------------------
MFD_STAAN       ATP-------------------------------------------------------------------
MFD_STAAM       ATP-------------------------------------------------------------------
MFD_STAAC       ATP-------------------------------------------------------------------
MFD_STAAB       ATP-------------------------------------------------------------------
MFD_STAA8       ATP-------------------------------------------------------------------
MFD_STAA3       ATP-------------------------------------------------------------------
COMFA_BACSU     ATPPKELKRKALNGQLHSVRIPAR----------------------------------------------
MFD_STAS1       ATPIPRTLHMSMLGV-------RDLSVIETPPENR-FPVQTYVLEQNT-NF---IKEALERELSRDGQVF
RECG_MYCTU      ----------------------------------------------------------------------
RECG_MYCBO      ----------------------------------------------------------------------
UVRB_CLOTE      ----------------------------------------------------------------------
UVRB_CLAMS      ----------------------------------------------------------------------
UVRB_CLAM3      ----------------------------------------------------------------------
RECG_BORBU      ----------------------------------------------------------------------
MFD_STAES       ATPIPRTLHMSMLGV-------RDLSVIETPPENR-FPVQTYVLEQNT-NF---IKEALERELSRDGQVF
MFD_STAEQ       ATPIPRTLHMSMLGV-------RDLSVIETPPENR-FPVQTYVLEQNT-NF---IKEALERELSRDGQVF
UVRB_PROAC      ----------------------------------------------------------------------
UVRB_DESVV      ----------------------------------------------------------------------
UVRB_DESVH      ----------------------------------------------------------------------
MFD_MYXXA       ----------------------------------------------------------------------
UVRB_PELCD      ----------------------------------------------------------------------
UVRB_CHLL2      ----------------------------------------------------------------------
UVRB_BACTN      ----------------------------------------------------------------------
UVRB_BACFR      ----------------------------------------------------------------------
UVRB_BACFN      ----------------------------------------------------------------------
UVRB_LEGPL      ----------------------------------------------------------------------
UVRB_LEGPH      ----------------------------------------------------------------------
UVRB_LEGPC      ----------------------------------------------------------------------
UVRB_LEGPA      ----------------------------------------------------------------------
UVRB_CHLCH      ----------------------------------------------------------------------
RECG_STAAW      ATP-------------------------------------------------------------------
RECG_STAAS      ATP-------------------------------------------------------------------
RECG_STAAN      ATP-------------------------------------------------------------------
RECG_STAAM      ATP-------------------------------------------------------------------
RECG_STAAC      ATP-------------------------------------------------------------------
RECG_STAA8      ATP-------------------------------------------------------------------
UVRB_THIDA      ----------------------------------------------------------------------
UVRB_SHIFL      ----------------------------------------------------------------------
UVRB_SHIF8      ----------------------------------------------------------------------
UVRB_DESVM      ----------------------------------------------------------------------
UVRB_CHLPB      ----------------------------------------------------------------------
MFD_BACSU       ATP-------------------------------------------------------------------
UVRB_LACSS      ----------------------------------------------------------------------
UVRB_YERPY      ----------------------------------------------------------------------
UVRB_YERPS      ----------------------------------------------------------------------
UVRB_YERPP      ----------------------------------------------------------------------
UVRB_YERPN      ----------------------------------------------------------------------
UVRB_YERPG      ----------------------------------------------------------------------
UVRB_YERPE      ----------------------------------------------------------------------
UVRB_YERPB      ----------------------------------------------------------------------
UVRB_YERPA      ----------------------------------------------------------------------
UVRB_YERP3      ----------------------------------------------------------------------
UVRB_THEYD      ----------------------------------------------------------------------
UVRB_PASMU      ----------------------------------------------------------------------
UVRB_NITEU      ----------------------------------------------------------------------
UVRB_HAMD5      ----------------------------------------------------------------------
UVRB_FERNB      ----------------------------------------------------------------------
UVRB_DESDG      ----------------------------------------------------------------------
UVRB_METTH      ----------------------------------------------------------------------
UVRB_MANSM      ----------------------------------------------------------------------
MFD_BORBU       ----------------------------------------------------------------------
UVRB_SHISS      ----------------------------------------------------------------------
UVRB_SHIDS      ----------------------------------------------------------------------
UVRB_SHIBS      ----------------------------------------------------------------------
UVRB_SHIB3      ----------------------------------------------------------------------
UVRB_SALTY      ----------------------------------------------------------------------
UVRB_SALTI      ----------------------------------------------------------------------
UVRB_SALSV      ----------------------------------------------------------------------
UVRB_SALPK      ----------------------------------------------------------------------
UVRB_SALPC      ----------------------------------------------------------------------
UVRB_SALPB      ----------------------------------------------------------------------
UVRB_SALPA      ----------------------------------------------------------------------
UVRB_SALNS      ----------------------------------------------------------------------
UVRB_SALHS      ----------------------------------------------------------------------
UVRB_SALG2      ----------------------------------------------------------------------
UVRB_SALEP      ----------------------------------------------------------------------
UVRB_SALDC      ----------------------------------------------------------------------
UVRB_SALCH      ----------------------------------------------------------------------
UVRB_SALAR      ----------------------------------------------------------------------
UVRB_SALA4      ----------------------------------------------------------------------
UVRB_KLEP7      ----------------------------------------------------------------------
UVRB_KLEP3      ----------------------------------------------------------------------
UVRB_ESCF3      ----------------------------------------------------------------------
UVRB_ENT38      ----------------------------------------------------------------------
UVRB_ECOUT      ----------------------------------------------------------------------
UVRB_ECOSM      ----------------------------------------------------------------------
UVRB_ECOSE      ----------------------------------------------------------------------
UVRB_ECOLU      ----------------------------------------------------------------------
UVRB_ECOLI      ----------------------------------------------------------------------
UVRB_ECOLC      ----------------------------------------------------------------------
UVRB_ECOL6      ----------------------------------------------------------------------
UVRB_ECOL5      ----------------------------------------------------------------------
UVRB_ECOK1      ----------------------------------------------------------------------
UVRB_ECOHS      ----------------------------------------------------------------------
UVRB_ECODH      ----------------------------------------------------------------------
UVRB_ECOBW      ----------------------------------------------------------------------
UVRB_ECO8A      ----------------------------------------------------------------------
UVRB_ECO81      ----------------------------------------------------------------------
UVRB_ECO7I      ----------------------------------------------------------------------
UVRB_ECO5E      ----------------------------------------------------------------------
UVRB_ECO57      ----------------------------------------------------------------------
UVRB_ECO55      ----------------------------------------------------------------------
UVRB_ECO45      ----------------------------------------------------------------------
UVRB_ECO27      ----------------------------------------------------------------------
UVRB_ECO24      ----------------------------------------------------------------------
UVRB_CITK8      ----------------------------------------------------------------------
RECG_STAES      ATP-------------------------------------------------------------------
RECG_STAAR      ATP-------------------------------------------------------------------
UVRB_PECCP      ----------------------------------------------------------------------
UVRB_ERWCT      ----------------------------------------------------------------------
UVRB_DECAR      ----------------------------------------------------------------------
UVRB_COLP3      ----------------------------------------------------------------------
UVRB_AZOSE      ----------------------------------------------------------------------
MFD_BUCAI       ATP-------------------------------------------------------------------
UVRB_YERE8      ----------------------------------------------------------------------
UVRB_VIBF1      ----------------------------------------------------------------------
UVRB_SERP5      ----------------------------------------------------------------------
UVRB_PROMH      ----------------------------------------------------------------------
UVRB_PHOLL      ----------------------------------------------------------------------
UVRB_MYCA5      ----------------------------------------------------------------------
UVRB_HAEIN      ----------------------------------------------------------------------
UVRB_HAEI8      ----------------------------------------------------------------------
UVRB_GEOSL      ----------------------------------------------------------------------
UVB2_MYCPU      ----------------------------------------------------------------------
RECG_PASMU      ----------------------------------------------------------------------
DBP3_YARLI      ----------------------------------------------------------------------
UVRB_VIBVY      ----------------------------------------------------------------------
UVRB_VIBVU      ----------------------------------------------------------------------
UVRB_VIBPA      ----------------------------------------------------------------------
UVRB_THEAB      ----------------------------------------------------------------------
UVRB_IDILO      ----------------------------------------------------------------------
UVRB_HERA2      ----------------------------------------------------------------------
UVRB_COXBU      ----------------------------------------------------------------------
UVRB_COXBR      ----------------------------------------------------------------------
UVRB_COXBN      ----------------------------------------------------------------------
UVRB_COXB2      ----------------------------------------------------------------------
UVRB_CHLPD      ----------------------------------------------------------------------
UVRB_CARHZ      ----------------------------------------------------------------------
UVRB_BORPD      ----------------------------------------------------------------------
UVRB_AQUAE      ----------------------------------------------------------------------
DBP5_ASPFU      ----------------------------------------------------------------------
UVRB_SYNY3      ----------------------------------------------------------------------
UVRB_NATTJ      ----------------------------------------------------------------------
UVRB_FUSNN      ----------------------------------------------------------------------
UVRB_EDWI9      ----------------------------------------------------------------------
UVRB_CLOBM      ----------------------------------------------------------------------
UVRB_CLOBL      ----------------------------------------------------------------------
UVRB_CLOBK      ----------------------------------------------------------------------
UVRB_CLOBJ      ----------------------------------------------------------------------
UVRB_CLOB6      ----------------------------------------------------------------------
UVRB_CLOB1      ----------------------------------------------------------------------
UVRB_CLOAB      ----------------------------------------------------------------------
UVRB_CHRVO      ----------------------------------------------------------------------
UVRB_CAMFF      ----------------------------------------------------------------------
UVRB_BORA1      ----------------------------------------------------------------------
UVRB_ALISL      ----------------------------------------------------------------------
RHLB_ACTSZ      ----------------------------------------------------------------------
RECG_STAEQ      ATP-------------------------------------------------------------------
DBP5_NEOFI      ----------------------------------------------------------------------
UVRB_PSEPK      ----------------------------------------------------------------------
UVRB_PSEPF      ----------------------------------------------------------------------
UVRB_PSEF5      ----------------------------------------------------------------------
UVRB_PHOPR      ----------------------------------------------------------------------
UVRB_PARUW      ----------------------------------------------------------------------
UVRB_METST      ----------------------------------------------------------------------
UVRB_GLOVI      ----------------------------------------------------------------------
UVRB_COXB1      ----------------------------------------------------------------------
UVRB_CLOPS      ----------------------------------------------------------------------
UVRB_CLOPE      ----------------------------------------------------------------------
UVRB_CLOP1      ----------------------------------------------------------------------
RECG_HAEIN      ----------------------------------------------------------------------
UVRB_THEEB      ----------------------------------------------------------------------
UVRB_HELHP      ----------------------------------------------------------------------
UVRB_DEHE1      ----------------------------------------------------------------------
UVRB_CYAP7      ----------------------------------------------------------------------
UVRB_THICR      ----------------------------------------------------------------------
UVRB_PSYIN      ----------------------------------------------------------------------
UVRB_NITOC      ----------------------------------------------------------------------
UVRB_METS3      ----------------------------------------------------------------------
UVRB_ERWT9      ----------------------------------------------------------------------
UVRB_ENTFA      ----------------------------------------------------------------------
UVRB_BORPE      ----------------------------------------------------------------------
UVRB_BORPA      ----------------------------------------------------------------------
UVRB_BORBR      ----------------------------------------------------------------------
UVRB_ACTP2      ----------------------------------------------------------------------
RECG_TREPA      ATP-------------------------------------------------------------------
UVRB_PSEAE      ----------------------------------------------------------------------
UVRB_MYCGE      ----------------------------------------------------------------------
UVRB_KOSOT      ----------------------------------------------------------------------
UVRB_CYAP4      ----------------------------------------------------------------------
UVRB_ACIAD      ----------------------------------------------------------------------
UVRB_TROW8      ----------------------------------------------------------------------
UVRB_STRCO      ----------------------------------------------------------------------
UVRB_NEIMB      ----------------------------------------------------------------------
UVRB_NEIMA      ----------------------------------------------------------------------
UVRB_NEIGO      ----------------------------------------------------------------------
UVRB_NEIG1      ----------------------------------------------------------------------
UVRB_LACPL      ----------------------------------------------------------------------
UVRB_CLOBB      ----------------------------------------------------------------------
UVRB_CLOBA      ----------------------------------------------------------------------
UVRB_CHLTE      ----------------------------------------------------------------------
RHLB_VIBHB      ----------------------------------------------------------------------
UVRB_THET8      ----------------------------------------------------------------------
UVRB_STRAW      ----------------------------------------------------------------------
UVRB_RALSO      ----------------------------------------------------------------------
UVRB_RALEJ      ----------------------------------------------------------------------
UVRB_METMP      ----------------------------------------------------------------------
UVRB_LEPBL      ----------------------------------------------------------------------
UVRB_LEPBJ      ----------------------------------------------------------------------
UVRB_LACAC      ----------------------------------------------------------------------
UVRB_BORGA      ----------------------------------------------------------------------
UVRB_BORAP      -----------------------------TLPQFRGMYNGDYSRKLNLVNFGFRLPAALENRPLKYDEFD
UVRB_ANASP      ----------------------------------------------------------------------
RHLB_ALISL      ----------------------------------------------------------------------
RECG_BACSU      ----------------------------------------------------------------------
DED1_MAGGR      ----------------------------------------------------------------------
DED1_KLULA      ----------------------------------------------------------------------
UVRB_TREDE      ----------------------------------------------------------------------
UVRB_SYNJB      ----------------------------------------------------------------------
UVRB_PSEU2      ----------------------------------------------------------------------
UVRB_PSESM      ----------------------------------------------------------------------
UVRB_PSEHT      ----------------------------------------------------------------------
UVRB_PSE14      ----------------------------------------------------------------------
UVRB_METBU      ----------------------------------------------------------------------
UVRB_LEPIN      ----------------------------------------------------------------------
UVRB_LEPIC      ----------------------------------------------------------------------
UVRB_GEMAT      ----------------------------------------------------------------------
UVRB_EUBR3      ----------------------------------------------------------------------
UVRB_CLOB8      ----------------------------------------------------------------------
UVRB_BORBZ      ----------------------------------------------------------------------
UVRB_BORBU      ----------------------------------------------------------------------
UVRB_ACAM1      ----------------------------------------------------------------------
UVRB_THETN      ----------------------------------------------------------------------
UVRB_GEOKA      ----------------------------------------------------------------------
UVRB_BURPS      ----------------------------------------------------------------------
UVRB_BURMA      ----------------------------------------------------------------------
UVRB_BACCA      ----------------------------------------------------------------------
RHLB_VIBPA      ----------------------------------------------------------------------
UVRB_WOLSU      ----------------------------------------------------------------------
UVRB_THELT      ----------------------------------------------------------------------
UVRB_SYMTH      ----------------------------------------------------------------------
UVRB_MYCUA      ----------------------------------------------------------------------
UVRB_MYCPU      ----------------------------------------------------------------------
UVRB_LACCB      ----------------------------------------------------------------------
UVRB_LACC3      ----------------------------------------------------------------------
UVRB_CALS8      ----------------------------------------------------------------------
UVRB_BACCR      ----------------------------------------------------------------------
UVRB_ANATD      ----------------------------------------------------------------------
RHLB_VIBSL      ----------------------------------------------------------------------
PRP28_MAGGR     ----------------------------------------------------------------------
UVRB_XYLFT      ----------------------------------------------------------------------
UVRB_XYLFM      ----------------------------------------------------------------------
UVRB_XYLFA      ----------------------------------------------------------------------
UVRB_XYLF2      ----------------------------------------------------------------------
UVRB_TREPS      ----------------------------------------------------------------------
UVRB_TREPA      ----------------------------------------------------------------------
UVRB_SYNP6      ----------------------------------------------------------------------
UVRB_SYNJA      ----------------------------------------------------------------------
UVRB_SYNE7      ----------------------------------------------------------------------
UVRB_OCEIH      ----------------------------------------------------------------------
UVRB_CORDI      ----------------------------------------------------------------------
UVRB_BACLD      ----------------------------------------------------------------------
UVRB_BACHK      ----------------------------------------------------------------------
UVRB_BACCZ      ----------------------------------------------------------------------
UVRB_BACC1      ----------------------------------------------------------------------
UVRB_BACAN      ----------------------------------------------------------------------
UVRB_BACA2      ----------------------------------------------------------------------
DED1_LODEL      ----------------------------------------------------------------------
DBP2_CHAGB      ----------------------------------------------------------------------
DBP1_YEAST      ----------------------------------------------------------------------
DBP1_YEAS7      ----------------------------------------------------------------------
UVRB_THEFY      ----------------------------------------------------------------------
UVRB_STRZT      ----------------------------------------------------------------------
UVRB_NATPD      ----------------------------------------------------------------------
UVRB_METCA      ----------------------------------------------------------------------
UVRB_HALMA      ----------------------------------------------------------------------
UVRB_DEHSC      ----------------------------------------------------------------------
UVRB_CYTH3      ----------------------------------------------------------------------
UVRB_CLONN      ----------------------------------------------------------------------
UVRB_CHLAB      ----------------------------------------------------------------------
UVRB_AYWBP      -----------------------------TIPQIKGMYFGDFSRKNNLVNFGFRLPSALDNRPLKFNEFQ
RHLB_VIBCM      ----------------------------------------------------------------------
RHLB_VIBCH      ----------------------------------------------------------------------
RHLB_VIBC3      ----------------------------------------------------------------------
RHLB_MANSM      ----------------------------------------------------------------------
DED1_EMENI      ----------------------------------------------------------------------
DED1_ASPOR      ----------------------------------------------------------------------
DED1_ASPNC      ----------------------------------------------------------------------
DBP5_ASPTN      ----------------------------------------------------------------------
DBP1_CANGA      ----------------------------------------------------------------------
UVRB_STRZP      ----------------------------------------------------------------------
UVRB_STRZJ      ----------------------------------------------------------------------
UVRB_STRR6      ----------------------------------------------------------------------
UVRB_STRPS      ----------------------------------------------------------------------
UVRB_STRPN      ----------------------------------------------------------------------
UVRB_STRPJ      ----------------------------------------------------------------------
UVRB_STRPI      ----------------------------------------------------------------------
UVRB_STRP7      ----------------------------------------------------------------------
UVRB_STRP4      ----------------------------------------------------------------------
UVRB_STRP2      ----------------------------------------------------------------------
UVRB_MYCTU      ----------------------------------------------------------------------
UVRB_MYCPN      ----------------------------------------------------------------------
UVRB_MYCLE      ----------------------------------------------------------------------
UVRB_MYCBO      ----------------------------------------------------------------------
UVRB_METAC      ----------------------------------------------------------------------
UVRB_LISMO      ----------------------------------------------------------------------
UVRB_LISMF      ----------------------------------------------------------------------
UVRB_LISIN      ----------------------------------------------------------------------
UVRB_HELPY      ----------------------------------------------------------------------
UVRB_HAEDU      ----------------------------------------------------------------------
UVRB_CHLAD      ----------------------------------------------------------------------
UVRB_BIFLI      ----------------------------------------------------------------------
DED1_SCLS1      TPGRLVDLIERGRISLQNIKYADRMLDMGFEPQIRIVEGEDMPGNRQTLMFSATFPRDIQARDFLKDYVF
DED1_NEOFI      ----------------------------------------------------------------------
DED1_CANGA      ----------------------------------------------------------------------
DED1_ASPFU      ----------------------------------------------------------------------
DED1_AJECN      ATPGMMERGRISLAHIQYLVLDERMLDMGFEPQIRRIDMPDK-HMRQTLMFSPPDIQKLAEEFLK-DHIF
DBP5_ASPNC      ----------------------------------------------------------------------
UVRB_XANOR      ----------------------------------------------------------------------
UVRB_XANOP      ----------------------------------------------------------------------
UVRB_XANOM      ----------------------------------------------------------------------
UVRB_XANCP      ----------------------------------------------------------------------
UVRB_XANCB      ----------------------------------------------------------------------
UVRB_XANC8      ----------------------------------------------------------------------
UVRB_XANAC      ----------------------------------------------------------------------
UVRB_SYNPX      ----------------------------------------------------------------------
UVRB_SYNPW      ----------------------------------------------------------------------
UVRB_STAHJ      ----------------------------------------------------------------------
UVRB_RHOBA      ----------------------------------------------------------------------
UVRB_PROMP      ----------------------------------------------------------------------
UVRB_PROM0      ----------------------------------------------------------------------
UVRB_HALSA      ----------------------------------------------------------------------
UVRB_CHLTR      ----------------------------------------------------------------------
UVRB_CHLTA      ----------------------------------------------------------------------
UVRB_CHLCV      ----------------------------------------------------------------------
RH25_ORYSJ      ----------------------------------------------------------------------
PRP28_SCHPO     ----------------------------------------------------------------------
DED1_NEUCR      ----------------------------------------------------------------------
DED1_COCIM      ----------------------------------------------------------------------
DED1_ASPTN      ----------------------------------------------------------------------
UVRB_STRU0      ----------------------------------------------------------------------
UVRB_STRTD      ----------------------------------------------------------------------
UVRB_STRT2      ----------------------------------------------------------------------
UVRB_STRT1      ----------------------------------------------------------------------
UVRB_STAAW      ----------------------------------------------------------------------
UVRB_STAAS      ----------------------------------------------------------------------
UVRB_STAAR      ----------------------------------------------------------------------
UVRB_STAAN      ----------------------------------------------------------------------
UVRB_STAAM      ----------------------------------------------------------------------
UVRB_STAAC      ----------------------------------------------------------------------
UVRB_CHLPN      ----------------------------------------------------------------------
UVRB_BIFLO      ----------------------------------------------------------------------
UVRB_BACSU      ----------------------------------------------------------------------
UVRB_ANAPZ      ----------------------------------------------------------------------
RHLB_VIBVY      ----------------------------------------------------------------------
RHLB_VIBVU      ----------------------------------------------------------------------
RHLB_VIBFM      ----------------------------------------------------------------------
RHLB_VIBF1      ----------------------------------------------------------------------
RHLB_SHIF8      ----------------------------------------------------------------------
RHLB_PHOPR      ----------------------------------------------------------------------
RH53_ORYSJ      ----------------------------------------------------------------------
DED1_USTMA      ----------------------------------------------------------------------
DED1_PHANO      ATPGLIERGRISLASIKYLVLDERMLDMGFEPQIRIVEGEDMTAGRQTLMFSATFPRDIQARDFLKEYIF
DBP3_PICGU      ----------------------------------------------------------------------
DBP2_NEUCR      ----------------------------------------------------------------------
UVRB_STAES      ----------------------------------------------------------------------
UVRB_STAEQ      ----------------------------------------------------------------------
UVRB_HELAH      ----------------------------------------------------------------------
UVRB_BACHD      ----------------------------------------------------------------------
RHLB_SALTY      ----------------------------------------------------------------------
RHLB_SALTI      ----------------------------------------------------------------------
RHLB_SALSV      ----------------------------------------------------------------------
RHLB_SALPK      ----------------------------------------------------------------------
RHLB_SALPC      ----------------------------------------------------------------------
RHLB_SALPB      ----------------------------------------------------------------------
RHLB_SALNS      ----------------------------------------------------------------------
RHLB_SALHS      ----------------------------------------------------------------------
RHLB_SALG2      ----------------------------------------------------------------------
RHLB_SALEP      ----------------------------------------------------------------------
RHLB_SALDC      ----------------------------------------------------------------------
RHLB_SALCH      ----------------------------------------------------------------------
RHLB_SALAR      ----------------------------------------------------------------------
RHLB_SALA4      ----------------------------------------------------------------------
RHLB_ERWT9      ----------------------------------------------------------------------
MFD_MYCTU       ATP-------------------------------------------------------------------
MFD_MYCBO       ATP-------------------------------------------------------------------
DED1_SCHPO      ----------------------------------------------------------------------
DED1_CHAGB      ----------------------------------------------------------------------
DBP5_EMENI      ----------------------------------------------------------------------
DBP5_ASPOR      ----------------------------------------------------------------------
DBP2_GIBZE      ----------------------------------------------------------------------
UVRB_SYNS3      ----------------------------------------------------------------------
UVRB_PROMM      ----------------------------------------------------------------------
UVRB_PROMA      ----------------------------------------------------------------------
UVRB_PROM3      ----------------------------------------------------------------------
UVRB_LACLS      ----------------------------------------------------------------------
UVRB_LACLM      ----------------------------------------------------------------------
UVRB_LACLA      ----------------------------------------------------------------------
UVRB_LACBA      ----------------------------------------------------------------------
UVRB_HELPJ      ----------------------------------------------------------------------
UVRB_HELPH      ----------------------------------------------------------------------
RHLB_SHISS      ----------------------------------------------------------------------
RHLB_SHIFL      ----------------------------------------------------------------------
RHLB_SHIDS      ----------------------------------------------------------------------
RHLB_SHIBS      ----------------------------------------------------------------------
RHLB_SHIB3      ----------------------------------------------------------------------
RHLB_KLEP3      ----------------------------------------------------------------------
RHLB_HAES1      ----------------------------------------------------------------------
RHLB_ESCF3      ----------------------------------------------------------------------
RHLB_ENTS8      ----------------------------------------------------------------------
RHLB_ECOUT      ----------------------------------------------------------------------
RHLB_ECOSM      ----------------------------------------------------------------------
RHLB_ECOSE      ----------------------------------------------------------------------
RHLB_ECOLU      ----------------------------------------------------------------------
RHLB_ECOLI      ----------------------------------------------------------------------
RHLB_ECOLC      ----------------------------------------------------------------------
RHLB_ECOL6      ----------------------------------------------------------------------
RHLB_ECOL5      ----------------------------------------------------------------------
RHLB_ECOK1      ----------------------------------------------------------------------
RHLB_ECOHS      ----------------------------------------------------------------------
RHLB_ECODH      ----------------------------------------------------------------------
RHLB_ECOBW      ----------------------------------------------------------------------
RHLB_ECO8A      ----------------------------------------------------------------------
RHLB_ECO81      ----------------------------------------------------------------------
RHLB_ECO7I      ----------------------------------------------------------------------
RHLB_ECO5E      ----------------------------------------------------------------------
RHLB_ECO55      ----------------------------------------------------------------------
RHLB_ECO45      ----------------------------------------------------------------------
RHLB_ECO27      ----------------------------------------------------------------------
RHLB_ECO24      ----------------------------------------------------------------------
PRP5_PHANO      ----------------------------------------------------------------------
DED1_ASHGO      ----------------------------------------------------------------------
DBP5_ASPCL      ----------------------------------------------------------------------
DBP2_MAGGR      ----------------------------------------------------------------------
UVRB_STRMU      ----------------------------------------------------------------------
UVRB_MYCMS      ----------------------------------------------------------------------
UVRB_METMA      ----------------------------------------------------------------------
UVRB_CAMHC      ----------------------------------------------------------------------
RHLB_HAES2      ----------------------------------------------------------------------
RHLB_HAEIN      ----------------------------------------------------------------------
RHLB_HAEIG      ----------------------------------------------------------------------
RHLB_HAEIE      ----------------------------------------------------------------------
RHLB_CITK8      ----------------------------------------------------------------------
RECG_SYNY3      ----------------------------------------------------------------------
DED1_YARLI      ----------------------------------------------------------------------
UVRB_STRSV      ----------------------------------------------------------------------
UVRB_STRGC      ----------------------------------------------------------------------
UVRB_MYCMO      ----------------------------------------------------------------------
UVRB_LEIXX      ----------------------------------------------------------------------
PRP28_NEUCR     ----------------------------------------------------------------------
DED1_ASPCL      ----------------------------------------------------------------------
UVRB_ZYMMO      ----------------------------------------------------------------------
UVRB_STRS7      ----------------------------------------------------------------------
UVRB_STRS2      ----------------------------------------------------------------------
UVRB_STRPZ      ----------------------------------------------------------------------
UVRB_STRPM      ----------------------------------------------------------------------
UVRB_STRPG      ----------------------------------------------------------------------
UVRB_STRPD      ----------------------------------------------------------------------
UVRB_STRPC      ----------------------------------------------------------------------
UVRB_STRPB      ----------------------------------------------------------------------
UVRB_STRP8      ----------------------------------------------------------------------
UVRB_STRP6      ----------------------------------------------------------------------
UVRB_STRP3      ----------------------------------------------------------------------
UVRB_STRP1      ----------------------------------------------------------------------
UVRB_STREM      ----------------------------------------------------------------------
UVRB_STRE4      ----------------------------------------------------------------------
UVRB_STRA5      ----------------------------------------------------------------------
UVRB_STRA3      ----------------------------------------------------------------------
UVRB_STRA1      ----------------------------------------------------------------------
UVRB_PROMT      ----------------------------------------------------------------------
UVRB_PROM1      ----------------------------------------------------------------------
UVRB_MICLC      ----------------------------------------------------------------------
UVRB_BACSK      ----------------------------------------------------------------------
RHLB_ECO57      ----------------------------------------------------------------------
DED1_BOTFB      TPGRLVDLIERGRISLQNIKYADRMLDMGFEPQIRIVEGEDMPGNRQTLMFSATFPRDIQARDFLKDYVF
UVRB_STRPF      ----------------------------------------------------------------------
UVRB_STAS1      ----------------------------------------------------------------------
UVRB_RICAE      ----------------------------------------------------------------------
UVRB_PROM4      ----------------------------------------------------------------------
UVRB_MYCPE      ----------------------------------------------------------------------
UVRB_MICAN      ----------------------------------------------------------------------
UVRB_FRATT      ----------------------------------------------------------------------
ROK1_NEOFI      ----------------------------------------------------------------------
ROK1_ASPFU      ----------------------------------------------------------------------
RHLB_SERP5      ----------------------------------------------------------------------
RHLB_PHOLL      ----------------------------------------------------------------------
RHLB_KLEP7      ----------------------------------------------------------------------
RHLB_AERHH      ----------------------------------------------------------------------
RH3_ARATH       ----------------------------------------------------------------------
PRP28_ASPOR     ----------------------------------------------------------------------
DDX47_DICDI     ----------------------------------------------------------------------
DBP5_CHAGB      ----------------------------------------------------------------------
DBP3_GIBZE      ----------------------------------------------------------------------
UVRB_ONYPE      ----------------------------------------------------------------------
UVRB_CAMJR      ----------------------------------------------------------------------
UVRB_CAMJE      ----------------------------------------------------------------------
UVRB_ANAMM      ----------------------------------------------------------------------
UVRB_ANAMF      ----------------------------------------------------------------------
SPB4_DEBHA      ----------------------------------------------------------------------
RHLB_ENT38      ----------------------------------------------------------------------
RHLB_AERS4      ----------------------------------------------------------------------
RECG_ECOLI      ----------------------------------------------------------------------
PRP28_COCIM     ----------------------------------------------------------------------
I4A3A_XENLA     ----------------------------------------------------------------------
DCL2_ASPOR      ----------------------------------------------------------------------
DBP5_CANGA      ----------------------------------------------------------------------
DBP2_SCLS1      ----------------------------------------------------------------------
DBP2_BOTFB      ----------------------------------------------------------------------
UVRB_RICRS      ----------------------------------------------------------------------
UVRB_RICRO      ----------------------------------------------------------------------
UVRB_RICPU      ----------------------------------------------------------------------
UVRB_RICCN      ----------------------------------------------------------------------
UVRB_LEPBP      ----------------------------------------------------------------------
UVRB_LEPBA      ----------------------------------------------------------------------
UVRB_LACJO      ----------------------------------------------------------------------
UVRB_LACGA      ----------------------------------------------------------------------
UVRB_BEUC1      ----------------------------------------------------------------------
RRP3_CHAGB      ----------------------------------------------------------------------
ROK1_ASPNC      ----------------------------------------------------------------------
RHLB_YERPY      ----------------------------------------------------------------------
RHLB_YERPS      ----------------------------------------------------------------------
RHLB_YERPP      ----------------------------------------------------------------------
RHLB_YERPN      ----------------------------------------------------------------------
RHLB_YERPE      ----------------------------------------------------------------------
RHLB_YERPB      ----------------------------------------------------------------------
RHLB_YERPA      ----------------------------------------------------------------------
RHLB_YERP3      ----------------------------------------------------------------------
RH47A_ORYSJ     ----------------------------------------------------------------------
RH31_ORYSJ      ----------------------------------------------------------------------
PRP28_GIBZE     ----------------------------------------------------------------------
IF4A3_XENTR     ----------------------------------------------------------------------
IF4A3_TAEGU     ----------------------------------------------------------------------
IF4A3_SALSA     ----------------------------------------------------------------------
IF4A3_RAT       ----------------------------------------------------------------------
IF4A3_PIG       ----------------------------------------------------------------------
IF4A3_MOUSE     ----------------------------------------------------------------------
IF4A3_MACFA     ----------------------------------------------------------------------
IF4A3_HUMAN     ----------------------------------------------------------------------
IF4A3_CHICK     ----------------------------------------------------------------------
IF4A3_BOVIN     ----------------------------------------------------------------------
I4A3B_XENLA     ----------------------------------------------------------------------
DED1_PICGU      ----------------------------------------------------------------------
DED1_GIBZE      ----------------------------------------------------------------------
DED1_DEBHA      ----------------------------------------------------------------------
DED1_CRYNE      ----------------------------------------------------------------------
DBP5_PICST      ----------------------------------------------------------------------
UVRB_WOLTR      ----------------------------------------------------------------------
UVRB_CHLMU      ----------------------------------------------------------------------
UVRB_ARTCA      ----------------------------------------------------------------------
ROK1_ASPOR      ----------------------------------------------------------------------
RHLB_PROMH      ----------------------------------------------------------------------
RHLB_HAMD5      ----------------------------------------------------------------------
RECG_ECO57      ----------------------------------------------------------------------
PRP28_ASPTN     ----------------------------------------------------------------------
PRP28_ASPNC     ----------------------------------------------------------------------
MFD_BUCBP       ----------------------------------------------------------------------
DBP5_PHANO      ----------------------------------------------------------------------
DBP3_CRYNE      ----------------------------------------------------------------------
UVRB_RICAH      ----------------------------------------------------------------------
UVRB_ARTS2      ----------------------------------------------------------------------
UVRB_ARTAT      ----------------------------------------------------------------------
ROK1_COCIM      ----------------------------------------------------------------------
ROK1_ASPCL      ----------------------------------------------------------------------
RHLB_PECCP      ----------------------------------------------------------------------
RHLB_PASMU      ----------------------------------------------------------------------
RHLB_ERWCT      ----------------------------------------------------------------------
PRP28_EMENI     ----------------------------------------------------------------------
PRP28_CANAL     ----------------------------------------------------------------------
PRP28_ASPCL     ----------------------------------------------------------------------
DCL2_EMENI      AVPRLGLTASAGSSREGLQTIEMNLNSVCTTPQAHRQELLEYTHMPELRRYTPLMKE-------------
DBP5_YEAST      ----------------------------------------------------------------------
DBP5_YEAS7      ----------------------------------------------------------------------
DBP5_NEUCR      ----------------------------------------------------------------------
UVRB_RICPR      ----------------------------------------------------------------------
SPB42_CANAL     ----------------------------------------------------------------------
SPB41_CANAL     ----------------------------------------------------------------------
RHLB_SODGM      ----------------------------------------------------------------------
PRP28_NEOFI     ----------------------------------------------------------------------
PRP28_DEBHA     ----------------------------------------------------------------------
PRP28_ASPFU     ----------------------------------------------------------------------
MS116_SCHPO     ----------------------------------------------------------------------
DDX23_PONAB     ----------------------------------------------------------------------
DDX23_HUMAN     ----------------------------------------------------------------------
DBP3_SCHPO      ----------------------------------------------------------------------
DBP3_LODEL      ----------------------------------------------------------------------
UVRB_RICTY      ----------------------------------------------------------------------
UVRB_RICM5      ----------------------------------------------------------------------
UVRB_RICFE      ----------------------------------------------------------------------
UVRB_RICBR      ----------------------------------------------------------------------
UVRB_RICB8      ----------------------------------------------------------------------
UVRB_RENSM      ----------------------------------------------------------------------
RRP3_BOTFB      ----------------------------------------------------------------------
RH52A_ORYSJ     ----------------------------------------------------------------------
DEAD_BUCBP      ----------------------------------------------------------------------
DDX4_RANLE      ----------------------------------------------------------------------
DCL4_ARATH      DGPPLDSFTYF-SGSFQSENLSKSINSLENLLNAKV----------------------------------
DCL2_MAGGR      ----------------------------------------------------------------------
DCL22_ASPNC     ----------------------------------------------------------------------
DBP5_MAGGR      ----------------------------------------------------------------------
DBP5_CRYNE      ----------------------------------------------------------------------
DBP4_ASPCL      ----------------------------------------------------------------------
DBP3_PICST      ----------------------------------------------------------------------
DBP2_ASPFU      ----------------------------------------------------------------------
SKI2_YEAST      ----------------------------------------------------------------------
ROK1_EMENI      ----------------------------------------------------------------------
RH47B_ORYSJ     ----------------------------------------------------------------------
RH26_ORYSJ      ----------------------------------------------------------------------
PRP5_YEAST      ----------------------------------------------------------------------
PRP5_YEAS7      ----------------------------------------------------------------------
PRP28_CRYNE     ----------------------------------------------------------------------
PRP28_CANGA     ----------------------------------------------------------------------
MS116_PHANO     ----------------------------------------------------------------------
IF4A_DICDI      ----------------------------------------------------------------------
DBP4_ASHGO      ----------------------------------------------------------------------
DBP3_VANPO      ----------------------------------------------------------------------
DBP2_NEOFI      ----------------------------------------------------------------------
DBP2_ASPOR      ----------------------------------------------------------------------
DBP2_ASPNC      ----------------------------------------------------------------------
DBP2_ASPCL      ----------------------------------------------------------------------
UVRB_CHLCV      VIFYADQKTRS---IEQTLKETERRR------QIQL----DY---NKANNITPPIIKAI-----------


                         *         .         .         .         .         +         .:560
query           LMLNRRGYSSFVMCRECGTVDTCPNCDISLTLHMDTKTMNCHYCGFSKDIPQVCPNCKSRSIRYYGTGTQ
PRIA_BACSU      LFLNKRGYSSFVMCRDCGYVPQCPHCDISMTYHRYGQRLKCHYCGHEEPVPHTCPECASEHIRFFGTGTQ
PRIA_SYNY3      LFINRRGHSTFVSCRSCGYVLECPNCDVSLSYHYGQPLLRCHYCNHAEIQPKVCPECSSPYLKFFGSGTQ
PRIA_CHLPN      IFFNRRGYHTNVSCTVCKHTLKCPHCDMVLTFHKYANVLLCHLCNSSKDLPQSCPKCLTMTLQYRGSGTE
PRIA_CHLMU      IFFNRRGFHTNVSCSSCKYTLKCPHCDMILTFHKTERILLCHLCNLSKPITS-CPQCHTMTLQYRGAGTE
PRIA_CHLTR      IFFNRRGFHTNVSCSSCKYTLKCPHCDMILTFHKTERILLCHLCNLSKPITS-CPQCLTMTLQYRGAGTE
PRIA_ECOLI      LFLNRRGFAPALLCHDCGWIAECPRCDHYYTLHQAQHHLRCHHCDSQRPVPRQCPSCGSTHLVPVGLGTE
PRIA_HAEIN      LFLNRRGFAPVLLCHECGWIAQCPHCEKPYTYHQHQNVLRCHHCGAQKTIPRQCGDCGSTHXXXXXXXXX
PRIA_TREPA      LFLNRRGFSYSFQCRSCGYTLCCTQCAVPLTWHKRVGAMQCHYCGRQEAPPESCPCCHSFDTRYGGVGTE
PRIA_RICBR      LFLNRRGYAPLMLCKSCGHKFTCKYCSSWMVVHKSSKKLECHHCGYQSKIFNSCPECEDESLAICGPGIE
PRIA_RICCN      LFLNRRGYAPLMLCKACGYRLTCKFCSSWMVVHKATKKLECHHCGYQSKIFSSCPECEDETLTICGPGIE
PRIA_RICTY      LFLNRRGYAPLMLCKACGHRFTCRFCSAWMVLHKATKTLECHHCGYQSKIFSSCPECEDETLTICGPGIE
PRIA_RICPR      LFLNRRGYAPLMLCKACGHRFTCKFCSAWMVLHKATKKLECHHCGYQSKIFSSCPECEDETLTICGPGIE
PRIA_RICFE      LFLNRRGYAPLMLCKACGHRFTCKFCSSWMVVHKATKKLECHHCGYQSKIFSSCPECEDETLTICGPGIE
PRIA_BORBU      IFINKRGYLKNLECNECGHIICCPNCSFGLIYHKKENKLLCHYCSYKTKTASHCPQCESKDIKYKTYGIQ
PRIA_THEMA      IYVRRKGFWGRVQCEVCGYVLKCENCDVSLVYHSDTHSLKCHQCGREYGLVESCPRCGGRLVG-RTAGTE
PRIA_HELPY      IFVPTRANFKTLLCQSCYKSVQCPFCSVNMSLHLKTNKLMCHYCHFSSPIPKICSACQSEVLVGKRIGTM
PRIA_HELPJ      IFVPTRANFKTLLCPNCYKSVQCPFCSVNMSLHLKTNKLMCHYCHFSSPIPKICNACQSEVLVGKRIGTM
PRIA_RHORU      LFLNRRGYAPLTLCRSCGHRLKCPRCTAWLVEHRRDGRLRCHHCGYQQPIPETCPACVADSLAPCGPGVE
PRIA_BUCAI      LIFNKFVLFFFVMCQKCNEIFKCTNCDDYFEINQYRNILFCKFCLIQIKKPIFCYNCGSFSLIVFKIGAE
PRIA_BUCAP      LVLNKFSFVFFLICRRCGKIEKCHICNDYFETKKYDNFLFCRNCLIKIKKPLFCYNCKNFSLIVFDXXXX
PRIA_MYCLE      VQVPRRGYVPSLACGRCRTLARCRHCTGPLSL-LDRATPGCCWCG-RADLTLRCARCGS-----------
PRIA_MYCTU      VQVPRRGYIPSLXXXXXXXXXXXXXXTGPLSLQAGSPGAVCRWCG-RVDPTLRCVRCGSDXXXXXXXXXX
PRIA_MYCBO      VQVPRRGYIPSLXXXXXXXXXXXXXXTGPLSLQAGSPGAVCRWCG-RVDPTLRCVRCGSDXXXXXXXXXX
MFD_HELPJ       ----------------------------------------------------------------------
MFD_HELPY       ----------------------------------------------------------------------
MFD_ECOLI       ----------------------------------------------------------------------
RECG_AQUAE      ----------------------------------------------------------------------
RECG_STRPN      ----------------------------------------------------------------------
MFD_STAHJ       YLYNR-----------------------------------------------------------------
MFD_HAEIN       YLHN------------------------------------------------------------------
MFD_SYNY3       ----------------------------------------------------------------------
RECG_MYCLE      ----------------------------------------------------------------------
MFD_STAAW       ----------------------------------------------------------------------
MFD_STAAS       ----------------------------------------------------------------------
MFD_STAAR       ----------------------------------------------------------------------
MFD_STAAN       ----------------------------------------------------------------------
MFD_STAAM       ----------------------------------------------------------------------
MFD_STAAC       ----------------------------------------------------------------------
MFD_STAAB       ----------------------------------------------------------------------
MFD_STAA8       ----------------------------------------------------------------------
MFD_STAA3       ----------------------------------------------------------------------
COMFA_BACSU     ----------------------------------------------------------------------
MFD_STAS1       YLYNK-----------------------------------------------------------------
RECG_MYCTU      ----------------------------------------------------------------------
RECG_MYCBO      ----------------------------------------------------------------------
UVRB_CLOTE      ------------------------------------------------------------------TLTK
UVRB_CLAMS      ------------------------------------------------------------------TLTK
UVRB_CLAM3      ------------------------------------------------------------------TLTK
RECG_BORBU      ----------------------------------------------------------------------
MFD_STAES       YLYNK-----------------------------------------------------------------
MFD_STAEQ       YLYNK-----------------------------------------------------------------
UVRB_PROAC      ----------------------------------------------------------------------
UVRB_DESVV      ----------------------------------------------------------------------
UVRB_DESVH      ----------------------------------------------------------------------
MFD_MYXXA       ----------------------------------------------------------------------
UVRB_PELCD      ----------------------------------------------------------------------
UVRB_CHLL2      ------------------------------------------------------------------TLTK
UVRB_BACTN      ------------------------------------------------------------------TLTK
UVRB_BACFR      ------------------------------------------------------------------TLTK
UVRB_BACFN      ------------------------------------------------------------------TLTK
UVRB_LEGPL      ------------------------------------------------------------------TLTK
UVRB_LEGPH      ------------------------------------------------------------------TLTK
UVRB_LEGPC      ------------------------------------------------------------------TLTK
UVRB_LEGPA      ------------------------------------------------------------------TLTK
UVRB_CHLCH      ------------------------------------------------------------------TLTK
RECG_STAAW      ----------------------------------------------------------------------
RECG_STAAS      ----------------------------------------------------------------------
RECG_STAAN      ----------------------------------------------------------------------
RECG_STAAM      ----------------------------------------------------------------------
RECG_STAAC      ----------------------------------------------------------------------
RECG_STAA8      ----------------------------------------------------------------------
UVRB_THIDA      ----------------------------------------------------------------------
UVRB_SHIFL      ------------------------------------------------------------------TLTK
UVRB_SHIF8      ------------------------------------------------------------------TLTK
UVRB_DESVM      ------------------------------------------------------------------TLTK
UVRB_CHLPB      ------------------------------------------------------------------TLTK
MFD_BACSU       ---------------------------------------------------------------------E
UVRB_LACSS      ----------------------------------------------------------------------
UVRB_YERPY      ----------------------------------------------------------------------
UVRB_YERPS      ----------------------------------------------------------------------
UVRB_YERPP      ----------------------------------------------------------------------
UVRB_YERPN      ----------------------------------------------------------------------
UVRB_YERPG      ----------------------------------------------------------------------
UVRB_YERPE      ----------------------------------------------------------------------
UVRB_YERPB      ----------------------------------------------------------------------
UVRB_YERPA      ----------------------------------------------------