[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for spne4:ACF55997.1

[Show Plain Result]


## Summary of Sequence Search
    1::53
   31::71      1e-04  35%  102 aa  CEBA_BACAM RecName: Full=BamHI control element;
   15::55      6e-04  32%   84 aa  YSMA_SERMA RecName: Full=Uncharacterized HTH-type transcriptional
    4::39      7e-04  39%   71 aa  Y1627_ARCFU RecName: Full=Uncharacterized HTH-type
    3::41      7e-04  41%  144 aa  RPC_BPPH1 RecName: Full=Immunity repressor protein;
    5::41      0.001  35%  139 aa  RGHRB_BACSU RecName: Full=Uncharacterized HTH-type
    1::53

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxVGKRIKELRISSNLTQDKIAEYLSLNQSMIAKMEKGERNITxxxx
CEBA_BACAM      ---------GQKVRQIRLSSNMSQEKLAFECDLHRTYISDIERGTRNVS----
YSMA_SERMA      --------LAENVRSYRNINNLSQEQLAEISGLHRTYIGSVERKERNVT----
Y1627_ARCFU     -----------RIKEFRAKFNMTQEELAKRVGVRRETIVFLEKGKYN------
RPC_BPPH1       --------VGQRIKAIRKERKLTQVQLAEKANLSRSYLADIERDRYN------
RGHRB_BACSU     ---------GQQLRELRRARKLTVNQLAVYSGISSATISKIENGKR-------