[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for spne4:ACF56022.1

[Show Plain Result]


## Summary of Sequence Search
    1::424
   64::444     3e-16  32%  445 aa  Y161_MYCPN RecName: Full=Uncharacterized protein MG148 homolog;
   58::393     2e-15  29%  409 aa  Y148_MYCGE RecName: Full=Uncharacterized protein MG148;
  113::459     9e-09  21%  692 aa  MYSP_DERFA RecName: Full=Paramyosin;AltName: Full=Antigen
  243::420     2e-08  34%  564 aa  M12_STRPY RecName: Full=M protein, serotype 12;Flags: Precursor;
  624::984     5e-08  25% 1438 aa  CLIP1_HUMAN RecName: Full=CAP-Gly domain-containing linker protein
  582::870     4e-07  25%  967 aa  KINH_LOLPE RecName: Full=Kinesin heavy chain;
  355::740     4e-07  26% 1818 aa  HMW2_MYCPN RecName: Full=Cytadherence high molecular weight protein
  204::604     5e-07  23%  876 aa  MYSP_SARSC RecName: Full=Paramyosin;
  479::865     5e-07  25% 1679 aa  GCC2_MOUSE RecName: Full=GRIP and coiled-coil domain-containing
  899::1241    7e-07  20% 1955 aa  PUMA_PARUN RecName: Full=227 kDa spindle- and centromere-associated
  751::1047    9e-07  24% 1387 aa  KIF15_MOUSE RecName: Full=Kinesin-like protein KIF15;AltName:
  783::1114    1e-06  26% 1875 aa  MLP1_YEAST RecName: Full=Protein MLP1;AltName: Full=Myosin-like
  246::456     3e-06  29%  757 aa  PIBF1_HUMAN RecName: Full=Progesterone-induced-blocking factor 1;
  394::584     3e-06  30%  944 aa  NUF1_YEAST RecName: Full=Protein NUF1;AltName: Full=Spindle poly
  935::1286    3e-06  26% 1364 aa  KTN1_CHICK RecName: Full=Kinectin;
  339::476     3e-06  26% 2230 aa  GOGA4_HUMAN RecName: Full=Golgin subfamily A member 4;AltName:
  713::1060    3e-06  20% 1110 aa  CC150_MOUSE RecName: Full=Coiled-coil domain-containing protein 150;
  410::613     6e-06  25%  676 aa  IFT81_HUMAN RecName: Full=Intraflagellar transport protein 81
  613::792     8e-06  30%  954 aa  CCD46_MOUSE RecName: Full=Coiled-coil domain-containing protein 46;
  614::793     8e-06  28%  955 aa  CCD46_HUMAN RecName: Full=Coiled-coil domain-containing protein 46;
  660::922     1e-05  18% 1233 aa  SMC1A_MOUSE RecName: Full=Structural maintenance of chromosomes
 1621::1772    1e-05  28% 2205 aa  KIF1_DICDI RecName: Full=Kinesin-related protein 1;AltName:
   29::108     1e-05  30%  284 aa  TPM2_SCHMA RecName: Full=Tropomyosin-2;AltName: Full=Tropomyosin
 1115::1502    1e-05  26% 1805 aa  HMW2_MYCGE RecName: Full=Cytadherence high molecular weight protein
 1452::1820    2e-05  22% 2701 aa  CENPE_HUMAN RecName: Full=Centromere-associated protein E;AltName:
  309::415     2e-05  27%  688 aa  SCLT1_RAT RecName: Full=Sodium channel and clathrin linker
  157::413     2e-05  25%  615 aa  NF70_LOLPE RecName: Full=70 kDa neurofilament protein;AltName:
  157::413     2e-05  25%  511 aa  NF60_LOLPE RecName: Full=60 kDa neurofilament protein;AltName:
  552::719     2e-05  26% 1931 aa  HMW2_MYCGA RecName: Full=Cytadherence high molecular weight protein
  383::773     2e-05  25% 1583 aa  GCC2_HUMAN RecName: Full=GRIP and coiled-coil domain-containing
  704::796     2e-05  35% 1164 aa  CP135_DANRE RecName: Full=Centrosomal protein of 135 kDa;       
  662::807     3e-05  31%  830 aa  ODFP2_MOUSE RecName: Full=Outer dense fiber protein 2;AltName:
  941::1079    3e-05  27% 1966 aa  MYO4_CAEEL RecName: Full=Myosin-4;AltName: Full=Myosin heavy chain B;
  405::516     3e-05  38%  721 aa  LRRF2_HUMAN RecName: Full=Leucine-rich repeat
 1130::1474    4e-05  19% 1790 aa  USO1_YEAST RecName: Full=Intracellular protein transport protein
  688::904     4e-05  20% 1232 aa  SMC1A_XENLA RecName: Full=Structural maintenance of chromosomes
  657::802     4e-05  31%  825 aa  ODFP2_RAT RecName: Full=Outer dense fiber protein 2;AltName:
    9::101     5e-05  28%  229 aa  VPS60_YEAST RecName: Full=Vacuolar protein-sorting-associated
  184::300     5e-05  29%  390 aa  TUFT1_BOVIN RecName: Full=Tuftelin;AltName: Full=Enamelin;
  141::270     5e-05  23%  648 aa  MAD1_KLULA RecName: Full=Spindle assembly checkpoint component
  842::963     6e-05  30% 1033 aa  Y474_MYCPN RecName: Full=Uncharacterized protein MG328 homolog;
  461::856     6e-05  23% 1957 aa  SPO15_SCHPO RecName: Full=Sporulation-specific protein 15;
  418::526     6e-05  32% 1286 aa  RPGR1_HUMAN RecName: Full=X-linked retinitis pigmentosa GTPase
  417::567     6e-05  26% 1388 aa  ROCK2_BOVIN RecName: Full=Rho-associated protein kinase 2;       
  333::442     6e-05  28%  572 aa  MOES_LYTVA RecName: Full=Moesin;
  878::972     6e-05  34% 1492 aa  LRRX1_DICDI RecName: Full=Putative leucine-rich repeat-containing
  102::285     8e-05  21%  749 aa  MAD1_YEAST RecName: Full=Spindle assembly checkpoint component
  476::597     8e-05  31% 1367 aa  DYNA_NEUCR RecName: Full=Dynactin, 150 kDa isoform;AltName:
   19::211     8e-05  26%  541 aa  CEP63_PONAB RecName: Full=Centrosomal protein of 63 kDa;       
  673::788     8e-05  34% 1460 aa  CE164_HUMAN RecName: Full=Centrosomal protein of 164 kDa;       
  688::920     1e-04  19% 1233 aa  SMC1A_RAT RecName: Full=Structural maintenance of chromosomes
  688::920     1e-04  19% 1233 aa  SMC1A_HUMAN RecName: Full=Structural maintenance of chromosomes
  688::920     1e-04  19% 1233 aa  SMC1A_BOVIN RecName: Full=Structural maintenance of chromosomes
  280::382     1e-04  28%  484 aa  RUD3_YEAST RecName: Full=GRIP domain-containing protein
  417::567     1e-04  26% 1388 aa  ROCK2_MOUSE RecName: Full=Rho-associated protein kinase 2;       
  149::413     1e-04  23%  846 aa  NFM_RAT RecName: Full=Neurofilament medium polypeptide;       
  149::415     1e-04  26%  875 aa  MYSP_BLOTA RecName: Full=Paramyosin;AltName: Allergen=Blo t 11;
  826::1194    1e-04  27% 1679 aa  MLP2_YEAST RecName: Full=Protein MLP2;AltName: Full=Myosin-like
  616::728     1e-04  20% 1094 aa  CN145_HUMAN RecName: Full=Uncharacterized protein C14orf145;
  855::1087    1e-04  23% 1433 aa  CLIP1_CHICK RecName: Full=CAP-Gly domain-containing linker protein
  194::303     1e-04  34%  496 aa  Y4393_ANASP RecName: Full=Uncharacterized protein alr4393;Flags:
  700::777     1e-04  34%  878 aa  SYA_NATTJ RecName: Full=Alanyl-tRNA synthetase;       
  148::412     1e-04  23%  848 aa  NFM_MOUSE RecName: Full=Neurofilament medium polypeptide;       
  537::666     1e-04  29% 1491 aa  MUKB_VIBCM RecName: Full=Chromosome partition protein mukB;AltName:
  537::666     1e-04  29% 1491 aa  MUKB_VIBCH RecName: Full=Chromosome partition protein mukB;AltName:
  111::247     1e-04  29%  767 aa  GOGA1_HUMAN RecName: Full=Golgin subfamily A member 1;AltName:
  882::970     1e-04  27% 1469 aa  DPY27_CAEEL RecName: Full=Chromosome condensation protein
  495::584     1e-04  34%  716 aa  CEP63_DANRE RecName: Full=Centrosomal protein of 63 kDa;       
  246::347     1e-04  28%  692 aa  CCD41_RAT RecName: Full=Coiled-coil domain-containing protein 41;
   17::359     1e-04  22%  678 aa  CASP_PONAB RecName: Full=Protein CASP;
   17::359     1e-04  22%  678 aa  CASP_HUMAN RecName: Full=Protein CASP;
    1::94      2e-04  33%   96 aa  RS6_GLOVI RecName: Full=30S ribosomal protein S6;
  417::567     2e-04  24% 1388 aa  ROCK2_HUMAN RecName: Full=Rho-associated protein kinase 2;       
  332::439     2e-04  34%  452 aa  NUF2_YARLI RecName: Full=Probable kinetochore protein NUF2;
  150::414     2e-04  23%  926 aa  NFM_BOVIN RecName: Full=Neurofilament medium polypeptide;       
  828::1002    2e-04  26% 1498 aa  GOGA3_HUMAN RecName: Full=Golgin subfamily A member 3;AltName:
  258::327     2e-04  33% 1412 aa  FHAD1_HUMAN RecName: Full=Forkhead-associated domain-containing
  284::369     2e-04  27% 1265 aa  DCTN1_DROME RecName: Full=Dynactin subunit 1;AltName: Full=150 kDa
  307::448     2e-04  33%  985 aa  ANR24_MOUSE RecName: Full=Ankyrin repeat domain-containing protein
  203::378     2e-04  25%  656 aa  RASEF_CAEEL RecName: Full=RAS and EF-hand domain-containing protein
  155::293     2e-04  27% 1920 aa  PCNT_MOUSE RecName: Full=Pericentrin;
  154::320     2e-04  27%  455 aa  NFM_PIG RecName: Full=Neurofilament medium polypeptide;       
  150::414     2e-04  23%  916 aa  NFM_HUMAN RecName: Full=Neurofilament medium polypeptide;       
  943::1080    2e-04  28% 1969 aa  MYO3_CAEBR RecName: Full=Myosin-3;AltName: Full=Myosin heavy chain A;
  537::666     2e-04  29% 1491 aa  MUKB_VIBC3 RecName: Full=Chromosome partition protein mukB;AltName:
   22::136     2e-04  26%  388 aa  LEKR1_HUMAN RecName: Full=Leucine-, glutamate- and lysine-rich
  495::614     2e-04  31%  723 aa  HOOK_BRAFL RecName: Full=Protein Hook homolog;
   19::211     2e-04  26%  703 aa  CEP63_HUMAN RecName: Full=Centrosomal protein of 63 kDa;       
   80::509     2e-04  21%  692 aa  CCD41_MOUSE RecName: Full=Coiled-coil domain-containing protein 41;
   32::200     2e-04  24%  375 aa  CASC4_CHICK RecName: Full=Protein CASC4;AltName: Full=Cancer
  419::498     3e-04  35%  968 aa  SLA2_YEAST RecName: Full=Protein SLA2;AltName: Full=Transmembrane
  408::558     3e-04  24% 1379 aa  ROCK2_RAT RecName: Full=Rho-associated protein kinase 2;       
  804::924     3e-04  27% 1064 aa  RBGP1_MOUSE RecName: Full=Rab GTPase-activating protein 1;AltName:
  230::323     3e-04  29%  740 aa  RASEF_HUMAN RecName: Full=RAS and EF-hand domain-containing
  448::627     3e-04  27% 1312 aa  RAD50_RAT RecName: Full=DNA repair protein RAD50;       
  957::1080    3e-04  28% 1969 aa  MYO3_CAEEL RecName: Full=Myosin-3;AltName: Full=Myosin heavy chain A;
 1063::1182    3e-04  31% 1959 aa  MYH9_CHICK RecName: Full=Myosin-9;AltName: Full=Myosin heavy chain
  121::285     3e-04  29%  582 aa  BPS2_ACIAM RecName: Full=Protein bps2;
  412::540     4e-04  25%  782 aa  YL139_YARLI RecName: Full=Uncharacterized protein YALI0A18139g;
  917::1080    4e-04  30% 1935 aa  MYSS_CYPCA RecName: Full=Myosin heavy chain, fast skeletal muscle;
 1169::1282    4e-04  21% 1774 aa  KI20B_MOUSE RecName: Full=Kinesin-like protein KIF20B;AltName:
  441::804     4e-04  23% 1873 aa  GRDN_MOUSE RecName: Full=Girdin;AltName: Full=Girders of actin
    7::348     4e-04  22% 1505 aa  CUX1_HUMAN RecName: Full=Homeobox protein cut-like 1;AltName:
  142::249     4e-04  29% 2022 aa  ANT1_ONCVO RecName: Full=Major antigen;AltName: Full=Myosin-like
 1044::1219    4e-04  29% 1397 aa  AN30A_HUMAN RecName: Full=Ankyrin repeat domain-containing protein
 1597::1711    5e-04  29% 1837 aa  NU211_SCHPO RecName: Full=Nucleoporin nup211;AltName: Full=Nuclear
 1740::1866    5e-04  28% 2035 aa  NIN_MOUSE RecName: Full=Ninein;
   75::415     5e-04  22%  866 aa  MYSP_SCHJA RecName: Full=Paramyosin;AltName: Full=Antigen Sj97;
  281::388     5e-04  33%  520 aa  K2C78_HUMAN RecName: Full=Keratin, type II cytoskeletal 78;AltName:
  111::247     5e-04  28%  758 aa  GOGA1_MOUSE RecName: Full=Golgin subfamily A member 1;AltName:
  140::327     5e-04  20% 1468 aa  CE290_BOVIN RecName: Full=Centrosomal protein of 290 kDa;       
   14::130     7e-04  29%  188 aa  TUFT1_PIG RecName: Full=Tuftelin;Flags: Fragment;
   43::174     7e-04  31%  605 aa  SPDLY_MACFA RecName: Full=Protein Spindly;AltName: Full=Coiled-coil
  119::212     7e-04  30%  627 aa  RASEF_MOUSE RecName: Full=RAS and EF-hand domain-containing protein
  630::745     7e-04  35%  883 aa  RAD50_HALSA RecName: Full=DNA double-strand break repair rad50
 1230::1351    7e-04  27% 1829 aa  MYO5A_CHICK RecName: Full=Myosin-Va;AltName: Full=Dilute myosin heavy
  561::644     7e-04  36% 1711 aa  MRCKB_HUMAN RecName: Full=Serine/threonine-protein kinase MRCK
  227::296     7e-04  31%  876 aa  LIPB2_HUMAN RecName: Full=Liprin-beta-2;AltName: Full=Protein
  475::624     7e-04  26%  729 aa  GOGA5_MOUSE RecName: Full=Golgin subfamily A member 5;AltName:
  491::594     7e-04  32%  731 aa  GOGA5_HUMAN RecName: Full=Golgin subfamily A member 5;AltName:
   71::442     7e-04  24%  478 aa  GAS8_BOVIN RecName: Full=Growth arrest-specific protein 8;       
 2400::2777    7e-04  25% 3210 aa  CENPF_HUMAN RecName: Full=Centromere protein F;AltName:
 2037::2260    7e-04  25% 3214 aa  BPA1_HUMAN RecName: Full=Bullous pemphigoid antigen 1, isoforms
  533::654     0.001  25%  825 aa  WAP_ARATH RecName: Full=WPP domain-associated protein;
  975::1049    0.001  40% 1430 aa  TGO1_DROME RecName: Full=Transport and Golgi organization protein
  541::733     0.001  24% 1335 aa  SOJO_XENLA RecName: Full=Cytoskeletal protein Sojo;AltName:
  556::784     0.001  26%  821 aa  SLK19_YEAST RecName: Full=Kinetochore protein SLK19;AltName:
 2037::2134    0.001  27% 2677 aa  SETX_HUMAN RecName: Full=Probable helicase senataxin;       
  742::913     0.001  25% 1022 aa  PMFBP_MOUSE RecName: Full=Polyamine-modulated factor 1-binding
 1037::1160    0.001  27% 1175 aa  PLCB4_HUMAN RecName: Full=1-phosphatidylinositol-4,5-bisphosphate
  900::1092    0.001  27% 1962 aa  MYSA_DROME RecName: Full=Myosin heavy chain, muscle;
  438::532     0.001  26%  539 aa  MYS3_HYDAT RecName: Full=Myosin heavy chain, clone 203;Flags:
  579::693     0.001  33% 1713 aa  MRCKB_RAT RecName: Full=Serine/threonine-protein kinase MRCK beta; 
 2282::2353    0.001  31% 2779 aa  LVA_DROME RecName: Full=Protein lava lamp;
  612::749     0.001  27% 1327 aa  KTN1_MOUSE RecName: Full=Kinectin;
  304::412     0.001  26%  449 aa  KRT37_HUMAN RecName: Full=Keratin, type I cuticular Ha7;AltName:
  481::623     0.001  22%  728 aa  GOGA5_RAT RecName: Full=Golgin subfamily A member 5;AltName:
  650::781     0.001  29% 1216 aa  FKB15_MOUSE RecName: Full=FK506-binding protein 15;AltName:
  304::417     0.001  24%  586 aa  EZRI_RABIT RecName: Full=Ezrin;AltName: Full=p81;AltName:
 1502::1834    0.001  26% 2474 aa  CENPE_MOUSE RecName: Full=Centromere-associated protein E;AltName:
    1::424

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MNEIKCPNCGEVFTVNESQYAELLSQVRTTEFDKELHDRMRQELALAEQKAMNEQQTKLAQKDQEIAQLQ
Y161_MYCPN      -----------------------------TKLAKELSEK--DNTFLKQKAAWNQHNTQIQQLYQQITNLE
Y148_MYCGE      ---------------------------------------------------------------QFINQQN
MYSP_DERFA      ----------------------------------------------SHKQRLSQENTELIK---EVHEVK
M12_STRPY       -----------------AKIAELESKLADAKKDFEL-------AALGHQHAHNEYQAKLAEKDGQIKQLE
CLIP1_HUMAN     --------------------------------------KSKLETAIASQQAMEELKVSLGTETAEFAELK
KINH_LOLPE      ----------EEFTVARLYISKMKSEVKTVSRNNQLENTQQDNFKKIEEKDLSNCKLLIQQHEAKMASLQ
HMW2_MYCPN      -------------------------------------NRMEQENALFA-KHLEQQQYEFERKQQESLQLQ
MYSP_SARSC      -----------------------LSQ-ENTELIKEVHEKMQLDNALKQQLAQQLEDTKLEEEERKRASLE
GCC2_MOUSE      ---------------------------------REMMEILQTELGESAGKISQEFETMKQQQASDVHELQ
PUMA_PARUN      -------------------------------------DRLRAEMATVELKYQSEVEDERDQRSRDADSWK
KIF15_MOUSE     ----------------------------------EHHSTQMQELFSSERSDWTKQQQEHVT---QLSDLE
MLP1_YEAST      ----------------------MVTQLQTLQ--KEREDLLEETRKSCQKKALSELKKETSQKDHHIKQLE
PIBF1_HUMAN     ------------------ELADTKQLIQQGDYRQENYDKVKSERDALEQEVIE------LRRKHEILEAS
NUF1_YEAST      ----------------ESKLNQRDSQLGSREEEKKTNDKLQKDIRIAREETVS--------KDERIIDLQ
KTN1_CHICK      ---------------------------------QDLESRLR-----GEEEQISKLKAVLEEKEREIASQV
GOGA4_HUMAN     -----------------AEKTKLITQLRDA---KNLIEQLEQDKGMVIAETKRQMHETLEMKEEEIAQLR
CC150_MOUSE     ------------------------------------------------QGALEKVQIELGRRDSEIAGLK
IFT81_HUMAN     -----------VFKKKHQIIAELKAEFRTEELLKQRHENIQQQLQTMEEKKGISGYSYTQEELERVSALK
CCD46_MOUSE     ---------------SEKVYGEMKEQMEKVEAD------------LTRSKSLREKQSKLWQLEDAKQRYE
CCD46_HUMAN     ---------------SEKVYAEMKEQMEKVEAD------------LTRSKSLREKQSKLWQLEDIRQRYE
SMC1A_MOUSE     -------------------------KAKARRWDEKAVDKLKEKKGRLTEEL--KEQMKAKRKEAELRQVQ
KIF1_DICDI      -------------------------------------------------------------KDEELRTAK
TPM2_SCHMA      ---------------------------------------------------LREKELEMQTKDEEVAEVL
HMW2_MYCGE      ----------------------------------QLNSQIRQFLLERKQRFSNEANAKKAFL---IKRLR
CENPE_HUMAN     ----------EVLQSESDQLKENIKEIVAKHLETEEELKVAHCCLKEQEETINELRVNLSEKETEISTIQ
SCLT1_RAT       ----------------EKQIKELQAKCSESENEKEAISRARDSMQLLEEANIKQNQILLEEKQKEV----
NF70_LOLPE      --------------IDATNKEKITLDVRVTELIDQLE---RQQKDLEESRTYHQDQEQIARQNQQLADLE
NF60_LOLPE      --------------IDATNKEKITLDVRVTELIDQLE---RQQKDLEESRTYHQDQEQIARQNQQLADLE
HMW2_MYCGA      --------------------------IRKIQLDVESERADLQRILLIERKKNDERQQELLQYERDIKRQQ
GCC2_HUMAN      ---------------------------------REIMEILQTELGESAGKISQEFESMKQQQASDVHELQ
CP135_DANRE     -----------------------------------------QQIDKLEEKIADLSRHGSSQKD-EVVILQ
ODFP2_MOUSE     -----------------------LSQ-KVDELERKLEATSAQNVEFLQEEAIHQAQLRLEEKTRECGSLA
MYO4_CAEEL      ---------------NEDRTADVQRAKKKIEAEVEALKKQIQDLEMSLRKAESEKQS----KDHQIRSLQ
LRRF2_HUMAN     ----------DVIEEQEEQMAEFYRE--NEEKSKEL-ERQKHMCSVLQHK-MEELKEGLRQRDELIEEKQ
USO1_YEAST      ----------------EKEATETKQQLNSLRANLESLEKEHEDLAAQLKKYEEQIANKERQYNEEISQLN
SMC1A_XENLA     -------------------------------------------------------QMKAKRKEAELRQVQ
ODFP2_RAT       -----------------------LSQ-KVDELERKLEATSTQNVEFLQEEAIHQAQLRLEEKTRECGSLA
VPS60_YEAST     --------------------------------NKKSHDQLLQESNQSMNQAQQSLSNRISQLDTQIAQLN
TUFT1_BOVIN     ------------------QEAEQQHQSDCSAFKVTLSQYQRE--AKQSQVALQRAEDRAEQKEAEVGELQ
MAD1_KLULA      --KLEIEGSGNILHQHETQINKHVEEIRYLQQELKEKENLISELRSVQTSASHRNNS--TEELQDLAVLN
Y474_MYCPN      LNEIQITNLNEA----NAQYQDLLSAYELLQSN---HNKLKQELQVLNQVNLEKQQQSLSQTHAELTQLQ
SPO15_SCHPO     -------------------------------------EKIEQDLRACLNSSSNELKEKSAKKDQELNNLR
RPGR1_HUMAN     --------------------------------DAELEDKRKVLLELSREKAQNEEVTNILQKHKQEVEL-
ROCK2_BOVIN     ----------------------------------------RENLLLSDSPSCKENDSIQSRKNEESQEIQ
MOES_LYTVA      ----------------EEKYKRLQQQIREKELEKNREDLKREEESRAMQEKLKQQQMESEEYQSKVAAME
LRRX1_DICDI     ------------------------------------------------QSSSDELQSKLNEKHQEINELQ
MAD1_YEAST      ---------------------ELEKALNDTKYLYESNDKLEQELKSLKERSANSMN----DKDKCIEELR
DYNA_NEUCR      ---------------NNERLREALIRLRTQQQEEELKDQIKSEEDLREFETIKEQHTKLAQTEAIVEDLR
CEP63_PONAB     -----------------------------TSCEAELQELMKQDIMVAHKKSEWEGRTHALEREQELKSLR
CE164_HUMAN     ----------------------LRAQVQSSTQADEDQIRAEQEASLQKEELESQQKAERASLEQKNRQML
SMC1A_RAT       -------------------------------------------------------QMKAKRKEAELRQVQ
SMC1A_HUMAN     -------------------------------------------------------QMKAKRKEAELRQVQ
SMC1A_BOVIN     -------------------------------------------------------QMKAKRKEAELRQVQ
RUD3_YEAST      ---------------------ELRQALESHEKEKAVLKNSLNDLELKIEEVDNKREEEARERDQEVKSLR
ROCK2_MOUSE     ----------------------------------------RENLLLSDSPPCRENQTRKSEESQEIQKKL
NFM_RAT         -------------------YDQEIRELRAT-LEMVNHEKAQVQL---DSDHLEEDIHRLKERFEEEARLR
MYSP_BLOTA      ----------------QAEVFELLAQVETANKDKLVAQKTVEKLEYTVHELVTAHRQRLSQENKEVHEYK
MLP2_YEAST      ---------------------------------------------------MKSLLTELSNKETTIEKLS
CN145_HUMAN     --------------IAELKKSQAQDKAKLLEMQESIKDLSAIRADLANKLAEEERAKKAVLKDLSDLTAQ
CLIP1_CHICK     ------------------------------------------------QRAMQETINKLNQKEEQFALMS
Y4393_ANASP     -------------------YAEAKKAIE--QRDRELANR-QQAIEQRDRELANRQQA-LQQRDQKISQLD
SYA_NATTJ       -------------------------------------------------------QHALEYLDQKAEQIQ
NFM_MOUSE       -------------------YDQEIRELRAT-LEMVNHEKAQVQL---DSDHLEEDIHRLKERFEEEARLR
MUKB_VIBCM      ----------ELATQYHKQHRVVLDDAATVELERERHSALLEELE-TEQENCREQRGQLRHQEQE---LQ
MUKB_VIBCH      ----------ELATQYHKQHRVVLDDAATVELERERHSALLEELE-TEQENCREQRGQLRHQEQE---LQ
GOGA1_HUMAN     ----------ETFQANRAKMAEGLALALARK-DQEWSEKMDQNILTAQLQEMKNQSMNLFQRRDEMDELE
DPY27_CAEEL     --------------VEESQKSSAKIKQQIEQYKRKM-DRMFMELVQKNKDSIEQAKDRMGQLEQDIARQT
CEP63_DANRE     ---------------------------------KSLEEENRQRLEMTELRARMEASNQTWQDKYERALLQ
CCD41_RAT       ------------------QLAEMQATLRSLEAEKQ-SAKLQAERLEKELQSSNEQNTKLHKADREISTLT
CASP_PONAB      ----------------------------------------------------------LQQLQRELDATA
CASP_HUMAN      ----------------------------------------------------------LQQLQRELDATA
RS6_GLOVI       ----------------------------------------------------------------------
ROCK2_HUMAN     ----------------------------------------RENLLLSDSPSCRENDSIQSRKNEESQEIQ
NUF2_YARLI      ---------------------ELLEHVGINSRQAERRDVLQQEIEAAESKIARIQQDMSEQTSRRMEELR
NFM_BOVIN       -------------------YDQEIRELRAT-LEMVNHEKAQVQL---DSDHLEEDIHRLKERFEEEARLR
GOGA3_HUMAN     -------------------------QQETAALKKQMQKIKEQFL---QQKVMVEAYRRDASKDQLISELK
FHAD1_HUMAN     -------------------------------------------------------QNEVAELSQKVSETT
DCTN1_DROME     ---------------------------------------LQKELLRAKQEAKDAIEAK-EQHAQEMADLA
ANR24_MOUSE     ----------------------LLQKIRGLEQHKE---RRRKEPLEAEERQVQELQQMLAEKQEEKESLG
RASEF_CAEEL     -----------------------------------------QQLELTEMKARQEERDRLTKEKEEMRQMR
PCNT_MOUSE      ----------EMLNGRRAQELALLQSRQQCELEREQHAREKEEMALRSGQEAAELKEKLRSEMEKNAQIE
NFM_PIG         -------------------------EIRELRATLELVNHEKAQVQL-DSDHLEEDIHRLKERFEEEARLR
NFM_HUMAN       -------------------YDQEIRELRAT-LEMVNHEKAQVQL---DSDHLEEDIHRLKERFEEEARLR
MYO3_CAEBR      ----------------QERHEDLTRQKKKTE--QELSDTKKQDLELTLRKAEQEKQS----RDHQIRSLQ
MUKB_VIBC3      ----------ELATQYHKQHMVALDDAATVELERERHSALLEELE-TEQENCREQRGQLRHQEQE---LQ
LEKR1_HUMAN     ----------EELTVKEKQEEDIKRRINLAENELEITKTLLNQTREEVLTLKNERELMLISHQKSIEQLQ
HOOK_BRAFL      ------------------------------------------------QARTNELETENRLANQRILELQ
CEP63_HUMAN     -----------------------------TSCEAELQELMKQDIMVAHKKSEWEGRTHALEREQELKSLR
CCD41_MOUSE     ----------------EDLRGELVEKARDIEKMK-LQVLTPQKLELVKAQLQQELEAPMRERDEEVERYR
CASC4_CHICK     -----CWNAASRQAVLREELAELQSQAKRTEVARGRLEKRNSDLL----GRVDSHRKQLEQKEADYSQLS
SLA2_YEAST      -------------------------------------------IALTNQ--YEKDQALLQQYDQRVQQLE
ROCK2_RAT       ----------------------------------------RENLLLSDSPPCRENQTRKSEESQEIQKKL
RBGP1_MOUSE     -----------------------ISQKKLKKFEKEYHTMREQQAQQEENRRLQEANMRLEQENDDLAHLR
RASEF_HUMAN     ---------------------EALSDLRR-QYETEVGDL---QVTIKKLRKLEEQSKRVSQKE-DVAALK
RAD50_RAT       ----------EILTKKQTELRNVRNELQQLEGSSDRILELDQELTKAERELSK------AEKNSSIETLK
MYO3_CAEEL      --------------------------------DQELSDTKKQDLELSLRKAEQEKQS----RDHNIRSLQ
MYH9_CHICK      ----------------------------------------------------------------QIAELQ
BPS2_ACIAM      ----------EWFISATSKINELKS--KKEEMETKLHNLQAEIDDLRKHKEAIELQTKIKQIEDEIARLE
YL139_YARLI     --------------MSEEQLFEVICKLTTQLDQSQARVREVEELVQQCSEQLNERSVEIGEKEMLVGQLE
MYSS_CYPCA      --EAKLKETNERLEDEEEINAELTAKKRKSELKKDIDDL---ELTLAKEKEKHATENKVKNLTEEMASQD
KI20B_MOUSE     ---------------NDLSAKEVKFREEVTRLANNLHDTKQLLQSKEEENEISRQETE--KLKEELAANS
GRDN_MOUSE      ------------------------------------------ELAEAPQKSLGHEVNELTSSKLLKLEME
CUX1_HUMAN      -----------------------------------------------------------ARLKRELDATA
ANT1_ONCVO      -----------------------MEEISDVDFPNQLEDERRR----AEDLAIQLQQERL-QNDQEIQRLR
AN30A_HUMAN     -----------------------------------LNEKIREELGRIEEQHRKELEVK--------QQLE
NU211_SCHPO     --------------------SELVAEKEKTELENQLNEKSQRIKELEEQAQKNSSENTHDNIDDMIKQLK
NIN_MOUSE       ---------------------------------EEQSESLKSQLAVSQAKVQNLEDV-LQNVNLQMAEIE
MYSP_SCHJA      -----------------------------------------------------QTQELLKRREMEINKLR
K2C78_HUMAN     -----------IITEVRARYEEI---ARSSKAEAELYQTKYQELQVSAQDRMQETKVQISQLHQEIQRLQ
GOGA1_MOUSE     ----------ETFQASRAKMAEGLALALARK-DQEWSEKMEQRFLTSQLQEVKNQSLSLFQKRDEIDELE
CE290_BOVIN     -------------SVTNSEIVSISKKITMLEM-KELNERQRAEHS---QKMYEHVKTSLQQVEERNFELE
TUFT1_PIG       ------------------QEAERQHQSERVDFEATLSRYQRE----AEQSALQRAEDRVEQKEAEVEELQ
SPDLY_MACFA     ----KCRN--EMMTMTESYEQEKY----TLQREVELKSRMLESLS-CECEAIKQQQKMHLEKGQEVNELK
RASEF_MOUSE     ---------------------EALTDLRR-QYETEVGDL---QVTIKRLKKLEEQSRQISQK-QDVTALK
RAD50_HALSA     --------------------SELRERKRTSEFDADRIETARADKDRAEDY-LEQVEPKLQALREDRDDLQ
MYO5A_CHICK     LTETRAP---EVTAPGAPAYRVLLDQL--TSVSEELEVRKEEVLILRSQ--LVSQKEAIQPKEDKNTMTD
MRCKB_HUMAN     ---------------------------------KELKDAHQQKLALQEFSELNERMAELRAQKQKVSR--
LIPB2_HUMAN     ----------------------------------------------------NQYEWKLKATKAEVAQLQ
GOGA5_MOUSE     --------------MQKEEIQKLMGQMH--QLRSELQDMEAQQVSEAESA-----REQLQDLQDQIAKQR
GOGA5_HUMAN     --------------------------------------QLRSELQDMEAQQVNEAESQLQDLHDQIAGQK
GAS8_BOVIN      ----------------EEKKAELRNKDREME---EAEERHQVEIKVYKQKVKHEHQSSLTEMKAELAQKE
CENPF_HUMAN     -------------------------------------EKLRARLEADEKKQLCVLQ-QLKESEHHADLLK
BPA1_HUMAN      -----------------------------------------------ELESLNHEKGKLQREEKNIQHLN
WAP_ARATH       ---------------------------------------MEECCSVIYKEAVKEAHKKIVELNLHVTEKE
TGO1_DROME      ----------------------------------------------SELKTLQEDNYEL---EMEKSKLQ
SOJO_XENLA      ----------QVYSAAEARNAGLEEKLKNYKDQVNLEDNINKELALERSKDIHQDQQKELMKQIEHLQLQ
SLK19_YEAST     ----------EIDSLN-SEMDELKKQI-TSKDDEFKMWQSKYETVEDEAKIRNAEVTELLHLEETITELE
SETX_HUMAN      -------NCGDINLVRLGPEKSINSEVLKFSLDSQVNHRMKKELAMHKRKEFLDYQLDELSRQRALCRGG
PMFBP_MOUSE     --------------VSKEAYEELVRKSGNCQDDTQALEKLTQ--ATSETKSLNQTQERKAQLEDEIAAYE
PLCB4_HUMAN     ----------EIRDLHLSQQCELLKKLLINA-----HEQQTQQLKLSESKEMRAHQAKISMENSKAISQD
MYSA_DROME      -------------------YQERNAKLTAQKNDLENQLRDIQERLTQEEDARNQLFQQKKKADQEISGLK
MYS3_HYDAT      -----------------------LDQIKKQKTNSDKNSRMLEE-------QINELNSKLAQVDELHSQSE
MRCKB_RAT       ----------------------------------ELNERMAE---LRSQKQKVSRQLRDKEEEMEVAMQK
LVA_DROME       -----------------------------------------QQLSVDMASRNDEQMAQLQEKESEIVHLK
KTN1_MOUSE      ----------------------------------------------------------IAEKDKQLKQTE
KRT37_HUMAN     ---LQAMSCSEELQCCQSEILELRCTVNALEVERQAQHTLKDCL----QNSLCEAEDRYGT---ELAQMQ
GOGA5_RAT       ---------------------KLMGQIH--QLRSELQDMEAQQVSEAEREQLQDLQDQIAKQRASKQELE
FKB15_MOUSE     --------------VSHLQLKMTAHQKKETELQLQLTDNLKEQADLSELREASEQQTKFKSEKQSRRQLE
EZRI_RABIT      ---------------------QMKAQAREEKHQKQL-ERQQLESEKKRREAVEQEKEQMLREKEE---LM
CENPE_MOUSE     --------------------------------------------------ALHVESEQQKESMKEISSKL


                         .         .         *         .         .         .         .:140
query           SQIQNFDTEKELAKKEVEQTSHQALLAKDKEVQALENQLATLRLEHENQLQKTLSDLEKERNQVXXXXXX
Y161_MYCPN      NQVNNIKRETE-SKKDNEY---------QQQIVKLETQLQSIKKETESQ-----KDLEYERKA-----NK
Y148_MYCGE      ELIKNFEIEI-IKLKTMLNDKEQALLLKTK-------------LELQNQFQKQIENYINEINKLKLTNKE
MYSP_DERFA      LQLDNANHLKTQIAQQLEDTRHR-LEEEERKRASLENHAHTLEVELES-----LKVQLDEESEARLELER
M12_STRPY       EQKQILDASRKGTARDLEAV-RQAKKATEAELNNLKAELA--KVTEQKQIKGTARDLEAVRK--------
CLIP1_HUMAN     TQIERLDYQHEIENLQNQQDSERA--AHAKEMEALRAKLMKVIKEKENSLEAIRSKLDKAEDQHLVEMED
KINH_LOLPE      EAIKDSENKKEYAKLKAQEQMHLAALSREKETEVLEKQMEMHREQHQKQLQ-SLRDEISEKQATVDNLKD
HMW2_MYCPN      KRIGEFKIESE-AKSEALLIQERELLEKRREIDDLLTQ-ASLEYEQQRRTNQVLKEKHRQVQQHFQNLVH
MYSP_SARSC      NHAHTLEVELESLKVQLDEES-EARLELERQLTKANGDAASWKSKYEAELQAHADEVEELRRKMAQKISE
GCC2_MOUSE      QKLRSAFNEKDALLETVNQGENEKLLSQQELVPELESTIKNLQADNSGQKDTMLQELEAK----------
PUMA_PARUN      VTSEELRSKISFMEKMLEEAKHRETVLREEESLKLRNEIERIRSDAEEDIQKWKKDVHMAQNEL------
KIF15_MOUSE     KQLQDAQTKNEFLKCEVHDL-RIVLNSADKELSLVKLEYSTFKENHE----KELSQLSERHVQVQLQLDN
MLP1_YEAST      SNIEWYQNKIEALKKDYESVI-TSVDSKQTDIEKLQYKVKSLEKE-----------IEEDKIRLHTYNVM
PIBF1_HUMAN     HMIQTKE-RSELSKEVVTLEQTVTLLQKDKEYLNRQNMELSVRCAHEERLQAQLEESKKAREEM------
NUF1_YEAST      KKVKQLENDLFVIKKESKTITDNELESKDKLIKILENDLKVAQ-EKYSKMEKELSKLEDEKNLAAENSQL
KTN1_CHICK      KQLQTMQSENESFKVQIQELKQQVVAGKEKEIASLQNELACQRNAFEQQRKKN-NDL-REKN--------
GOGA4_HUMAN     SRIKQMTTQGEELREQKEKSERAAFEELEKALQKTEEARRKLKAEMDEQIKTIEKTSEEERISL------
CC150_MOUSE     KERSLNQQRVQKLEAEVDQWQARMLIVEAQHGSEIE------------PLQKSL-DITREDNRKLAMSLE
IFT81_HUMAN     SEVRTLDDMSEMVKKLYSLVSEKALASVIKELRQLRQKYQELTQECDEKLESNRSKLEQEVRRLREECLQ
CCD46_MOUSE     QQIVELKLEHEQEKTHLLQ-QHSAVRDHDREIENLEKQLRAANMEHENQIQES----KKRDAQVIADMEA
CCD46_HUMAN     QQIVELKLEHEQEKTHLLQNAEKDSLVRDREIENLEKQLRAANMEHENQIQQVIADMEAQVHKLREELIN
SMC1A_MOUSE     SQAHGLQMRLKYSQSDLEQTKTRHLALNLQEKSKLESELANFRINDIKRIEREMKDLKEKMNQV-EDEVF
KIF1_DICDI      QQIEKSSSQLDQIKSQL-QTGQQIVLAKQKEIEELTNTISQLQLEKEDEIQNRDEELEQYKSQKLENVTQ
TPM2_SCHMA      KKIQQVDTDKETAQTQLAETNTK-LEETDKRATEAEAEVASLQRQLEDELESTETRLQE-----------
HMW2_MYCGE      SFASNLKLQKELAIQKLE-------FDKRDEQQKKELQQATLQLE-QFKFEKQNFDIEKQRQLVAIKTQC
CENPE_HUMAN     KQLEAINDKLQNKIQEIYEKEEQFNIKQISEVQEKVNELKQFK-EHRKAKDSALQSIESKMLELTNRLXX
SCLT1_RAT       --------EREKMKKTISHLIQDAAIKARKEVESTKKQYEVLILQLKEELSALQMDCDEKQGQI------
NF70_LOLPE      GEISMLRRSIELEKEKMRQSNILAKMNDEMEKMRMDLNNETINLDAENRRQTLEEELEFQRDTTAENREF
NF60_LOLPE      GEISMLRRSIELEKEKMRQSNILAKMNDEMEKMRMDLNNETINLDAENRRQTLEEELEFQRDTTAENREF
HMW2_MYCGA      TDFENTVNQKKLSQREKEKDGYEQLQLKQSEVQELNEEINRAQKSKQNSLQKLKSDLEHSKNYLDKQQEE
GCC2_HUMAN      QKLRTAFTEKDALLETVNQGENEKLLSQQELVPELENTIKNLQLLSLSQRDTMLKELEGKIN--------
CP135_DANRE     NTIASLDREKDTLQDAVDQKTESVVLLQQKEETLLEVRLTVTDLENSNQLQAVLSSRERE----------
ODFP2_MOUSE     RQLES---AIEDARRQVEQTKEQA-LSKERAAQSLETQLSRTKTE-LGQLRRTRDDADR-RYQSRLQDLK
MYO4_CAEEL      DEMQQQD--EAIAKLNKEKKHQEEINRKLMEDLQSEEDKGNHQNKVKAKLEQTLDDLEDSLER-------
LRRF2_HUMAN     RMQQKIDT----MTKEVFDL-QETLLWKDKKIGALEKQIACLRNERD-MLREELADLQE-----------
USO1_YEAST      DEITSTQQENESIKKKMKSTSEEQSNLKKSEIDALNLQIKELKKKNETNEASLLESIKSVESETVKIKEL
SMC1A_XENLA     SQAHGLQMRLKYSQSDLEQTKTRHLAMNMQEKSKLESELANFRINDIKRIDREMKDLKEKMNQV-EDEVF
ODFP2_RAT       RQLES---AIEDARRQVEQTKEQA-LSKERAAQSLETQLSRTKTE-LGQLRRTRDDVDR-RYQSRLQDLK
VPS60_YEAST     FQLQNIQKNLQRSNNKQPSLRKQALKILNKRKQ-LENMKDSLDSQSWSMTQAQLTN--------------
TUFT1_BOVIN     RRLQGMETEYQLAKVREGETALEELRSKNVDCQAEQEKAANLEKEVAGLREKILDDMLKSQQR-------
MAD1_KLULA      KTLEQLNYAKELEDMNLKQATELKKLRQNNDVQSLENELLQSKLDQLNSLQKKFESLEME----------
Y474_MYCPN      AAYNNLQATPPVSDELLEQ-FNQVQLEKQRLLQ--QNLALVHELQYFNELNSS-----------------
SPO15_SCHPO     EQIKERDILNEKKKHEVYESQLNELKGEQTEIEHLSSQLSTLAAEKEAAV-ATNNELSESKNSLQTLCNA
RPGR1_HUMAN     --LQNAATISQPPDRQSEPATHPAVLQENTQIEPSENQEEKKLSQVLNELQETTLELEKTRDML------
ROCK2_BOVIN     KKLEHLSTEIQ-AKEELEQKCKSVNTRLEKVAKELEEEI-TLR----KNVESTLRQLEREKALLQHKNAE
MOES_LYTVA      MQMNEATLEREMTAQEKEEMR--------ARVEALAEEKARLEQSREESLKESAEFAEKLR---------
LRRX1_DICDI     SKLNEKQNKINELVENNESSSDEKLIQLSDQLQEKENQLKSFRDEKLNQLQSKLNEKQNEIDQI------
MAD1_YEAST      TTLQNKDLEMETLRQQYDSKLSKVTNQCDHFKLEAESS-HSLLMKYEKEIKRQSVDIKDLQHQVMEKDDE
DYNA_NEUCR      EQLNNALGAEEIIESLTEQTMNQS--EEIKELRAVIDDLESLK-EINDELEINHVQNEKEMQE-------
CEP63_PONAB     SQLDVTHKEVGMLHQQVEEIKQEMTMEYKQELKKLHEELGILKRSYEKLQKKQMREFREDRSEIERLTAK
CE164_HUMAN     EQLKE--------EIEASEKSEQAALAKEKALQQLREQLATLEKEHSAELERLCSSLEAKHREV------
SMC1A_RAT       SQAHGLQMRLKYSQSDLEQTKTRHLALNLQEKSKLESELANFRINDIKRIEREMKDLKEKMNQV-EDEVF
SMC1A_HUMAN     SQAHGLQMRLKYSQSDLEQTKTRHLALNLQEKSKLESELANFRINDIKRIEREMKDLKEKMNQV-EDEVF
SMC1A_BOVIN     SQAHGLQMRLKYSQSDLEQTKTRHLALNLQEKSKLESELANFRINDIKRIEREMKDLKEKMNQV-EDEVF
RUD3_YEAST      SQLHNNDTEAESMKKQLEAMKEDASMKEKYEEESKQHILQIGKLRHE-----------------------
ROCK2_MOUSE     YALEEHLSSEVQAKEELEQKCKSINTRLEKTAKELEEEI-TLR----KSVESTLRQLEREKALLQHKNAE
NFM_RAT         D-----DTEAAIVRKDIEESS-MVKVELDKKVQSLQDEVAFLRSNHEEEVADLLAQIQASHITV-----E
MYSP_BLOTA      ISLDNANHLKGQIAQQLEDTRHR-LEDEERKRSSLENHAHTLEVELES-----LKVXXXXXXXXXXXXXX
MLP2_YEAST      SEIENLD-------KELRKTKFQKFLDQNSDASTLE---PTLRKELE-QIQVQLKDANSQYEEIISSNEN
CN145_HUMAN     AKSRDEETATIITQLKLERDVHQ------RELKDLTSSLQSVKTKHEQNIQELMKHFKKEKSE-------
CLIP1_CHICK     SELEQLKTVMETKLKEREEREQQLTEAKVK----LENDIAEIMKDSSAQLMKMNDELRLKERQLEQIQLE
Y4393_ANASP     KIIQN--RNLEIAQREEVIAKRESRL-KELETQQLEQEVARLEKYYQSYRDLRLGKLALVRGQV------
SYA_NATTJ       DIAELLKTEEN---KVVEKTQEEDFKAKDKEIEKLKNQIFTFKVDDLLAQSKDISDFKLVANQL------
NFM_MOUSE       D-----DTEAAIRRKDIEESS-MVKVELDKKVQSLQDEVAFLRSNHEEEVADLLAQIQASHITV-----E
MUKB_VIBCM      TQIARFESGAELADSQSVMAHMQQVLELEKAQSMAKDKLAERRTKLDSEIERLAS---------------
MUKB_VIBCH      TQIARFESGAELADSQSVMAHMQQVLELEKAQSMAKDKLAERRTKLDSEIERLAS---------------
GOGA1_HUMAN     SKIKHMLLKKELGKMEQELEARTRELSRTQEELMNSNQMSSDLSQKLEELQRHYSTLEEQRDHV------
DPY27_CAEEL     AIIENNPSHLEQAEKKLSELEHMC-LEKRSEADAL-----------------------------------
CEP63_DANRE     NQNKNHLYNEQNRADEDVQRRHQ------EELQAMETQMQERASHYEEQIQTLLTQLE------------
CCD41_RAT       SQVKELKHANKLEITDVKLEAARAKSELERERNKIQSELDGLQSDNE-----------------------
CASP_PONAB      TVLANRQDESEQSRKRLIEQSREF---KKNTPEDLRKQVAPLLKSFQGEID-ALSKRSKEAEAAFLNVYK
CASP_HUMAN      TVLANRQDESEQSRKRLIEQSREF---KKNTPEDLRKQVAPLLKSFQGEID-ALSKRSKEAEAAFLNVYK
RS6_GLOVI       ----------------------------------------------------------------------
ROCK2_HUMAN     KKLYTLESNEMQAKEELEQKCKSVNTRLEKTAKELEEEI-TLR----KSVESALRQLEREKALLQHKNAE
NUF2_YARLI      RQIGTLDAERALV---VQQNN-----TAQKRLAELENDMATERDRYEAQLKMAREEAEKLQTQ-------
NFM_BOVIN       D-----DTEAAIRRKDIEESS-LVKVELDKKVQSLQDEVAFLRSNHEEEVADLLAQIQASHITV-----E
GOGA3_HUMAN     ATRKRLDSELKELRQELMQV-HGEKRTAEAELSRLHREVAQVR-QHMADLEGHLQSAQKERDEMETHLQS
FHAD1_HUMAN     TSRQN---EKEISQKC--QVLDEDIDAKQKEIQSLKSQISALQKGYSKVLCQTLSERNSE----------
DCTN1_DROME     DNVEMITLDKEMAEEKAD-TLQLELESSKERIEELEVDLELLRSEMQNKAESAIGNI-------------
ANR24_MOUSE     REVESLQSRLSLLENERENTSYDVATLQDEEVASLQEQVAQLTRQNQELLEKVLEEFEKDEAQM------
RASEF_CAEEL     NNIERLQKMEKALERENERLNHQKELSKLKVVNEENNDLRQNLAENHLELAMIKSELQKQDELSARRGIL
PCNT_MOUSE      TLKQDWESEREL---------------------CLENLRQELSLKHQSEMEGLQSQFQKELSEQKVELEK
NFM_PIG         D-----DTEAAIRRKDIEEAS-LVKVELDKKVQSLQDEVAFLRSNHEEEVADLLAQIQASHITV-----E
NFM_HUMAN       D-----DTEAAIRRKDIEEAS-LVKVELDKKVQSLQDEVAFLRSNHEEEVADLLAQIQASHITV-----E
MYO3_CAEBR      DEMANQDSVAKLNKEKKHQEESNRKLNEDLQSEEDKNHLEKIRNKLEQQMDELEETIDREKRS-------
MUKB_VIBC3      TQIARFESGAELADSQSVMAHMQQVLELEKAQSMAKDKLAERRAKLDSEIERLAS---------------
LEKR1_HUMAN     ETLRQKLLSDDNWKEKIE-----AELAKERAQHLVEFEEQALLFKEETKLQ---LDIEKEKHQ-------
HOOK_BRAFL      GQLEDMQTEQE----EVGSP------AKDQDSVALRKKLE----EHMEKLKDADSQLQKKKEYI------
CEP63_HUMAN     SQLDVTHKEVGMLHQQVEEIKQEMTMEYKQELKKLHEELCILKRSYEKLQKKQMREFREDRSEIERLTAK
CCD41_MOUSE     AEYNKLRYEYTFLKSEFEHQKEEFTRVSEEEKMKYKSEVARLEKDKENQLLSVDPTRDSKRMEQLVREKT
CASC4_CHICK     SQLQARDGQKRCEDSRVKLQNNISYQMAD--IHRLKEQLAELRQEFIRQ-EDQLHEYKKNNTYLTRRLEY
SLA2_YEAST      SEITTMDSSKQLANKDEQLTALQDQLVWERKYESLAKLYSQLRQEHLNLLPR------------------
ROCK2_RAT       YALEEHLSSEVQAKEELEQKCKSINTRLEKTAKELEEEIT-----FRKNVESTLRQLEREKALLQHKNAE
RBGP1_MOUSE     KDLDNAEEKADALNKELLMTKQKLIDAED-EKRRLEEESAQLKEMCRRELDKAESEIKK-----------
RASEF_HUMAN     KQIYDLSMENQKVKKD--------LLEAQTNIAFLQSELDALKSDYADQSLNTERDLE------------
RAD50_RAT       AEILNLQSEKNLRKQEMEQLNHHTMLTKDKTDK--DEQIRKIKSRHSDELKKQLEDWLHSKSKEINQTRD
MYO3_CAEEL      DEMANQDVAKLNKEKKHQEESNRKLNEDLQSEEDKVNHLEKIRNKLEQQMDELEENIDREKRS-------
MYH9_CHICK      AQIA--ELKIQLSKKEEEL---QAALARVEEEAAQKNMALKKIRELESQITELQEDLESERAS-RNKAEK
BPS2_ACIAM      K-------EKE-SDKVLNKTTQTISITNENKLRDIKEKIEVKKRELED-LQNRIARLDQE----------
YL139_YARLI     EQLKRVSEEKDVATERMEKELNDVTATKDHEIQQLKQQVQDLTIQLSS---ATVSDVKTLR---------
MYSS_CYPCA      ESIAKLTKEKKAL-----QEAHQQTL---DDLQAEEDKVNTL-TKAKTKLEQQVDDLEGSLEQ-------
KI20B_MOUSE     ILTQNLKADLQKKEEDCAELKEKFIDAK-KQIEQVQREVSVMR-DEEKLLRIKINELEKKKNQ-------
GRDN_MOUSE      NQSLTKTVEELRSTADSAAGSTSKILKVEKEVEILENEIIQEKQSLQN-CQNLSKDLMKEKAQL------
CUX1_HUMAN      TVLANRQDESEQSRKRLIEQSREF---KKNTPEDLRKQVAPLLKSFQGEID-ALSKRSKEAEAAFLNVYK
ANT1_ONCVO      QQFGICIRDKERIYQTRERNFTRFLGEEQRKMMELWSELQRVRKQCAEYREQTERDLENQRNE-------
AN30A_HUMAN     QALRIQDIELKSVESNLNQVSHNYLLHENKEIAMLKLEIATLKHQYQEKENKYFEDIKKEKN---AELQM
NU211_SCHPO     ENSANFDVKLKKVVAETEFRSKAKISVYEKKTRDLQNKITQLEETIEN-LNKQLSNPEK-----------
NIN_MOUSE       SDLQVTRQEKEALKQEVMSLHRQLQNAIDKDVSETAPHLSGLRGQQRRLSWDKLDHLMNEEPQL------
MYSP_SCHJA      KDLENANASLELAETSMRRRHQTAL-----------NELS---LEVEN-LQKQKGKAEKDKSHLIMEVDN
K2C78_HUMAN     SQTENLKKQNQAAITDAEQRGELALKDAQAKVDELE---AALRMAKQN----------------------
GOGA1_MOUSE     SKVKHMLLKKELGKMEQELDARTRELNRTQEELVTSNQLSSDLNERLEELQRHCSTLEEQRDHL------
CE290_BOVIN     TKFANLEAQKQMLRDELADSVSKTVSDADRQ-HILELEKSEMELKVEVSKLKEISDIAKRQVEILNAQQQ
TUFT1_PIG       KRLLGMETEHQLAKVREGVTALEELRGKNSDCRAEQEKAANLEKEVAGLREKILDDMLKSQQR-------
SPDLY_MACFA     SKIEKLKVELDEARLSEKQLKHQVLSCKSEELRVMSERVQESMSSEMLALQIELTEME------------
RASEF_MOUSE     KQIHDLTMENQKLKKE--------LLEAQTNVAFLQSELDALKSDYADQSLNSERDLE------------
RAD50_HALSA     AKIENAIAELESLREEHEQSRHQDLQAVHDEVTALETMYGELRAELR---QQNVSKLERLLNE-------
MYO5A_CHICK     STILLEDVQKMKDKGEIAQ----AYIGLKETNRLLESQLQSQKKSHENELESLRGEIQSLKEE-------
MRCKB_HUMAN     -QLRDKEEEMEVATQKVD--------AMRQEMRRAEK----LRKELEAQLDDAVAEASKER---------
LIPB2_HUMAN     EQVALKDAEIERLHSQLSRTASESHTERDQEIQRLKMGMETLLLANEDK---------------------
GOGA5_MOUSE     TSKQELETELERMKQETKNTLQSRIKDREEEIQKLRNQLTNKTLSNSSQ-----SELESRLHQL-TETLI
GOGA5_HUMAN     ASKQELETELERLKQETKNTLQSRIKDRDEEIQKLRNQLTNKTLSNSSQ-----SELENRLHQL------
GAS8_BOVIN      HRAQEGTLRRDMRALKVE--------LKEQEL-ANEVMVKNLRLKHTEEITKMRNDFERQVREI------
CENPF_HUMAN     GRVENLERELEIARTNQEHAALEAENSKTQSLRGLELDVVTIRSEKENELQKRISELESSFENILXXXXX
BPA1_HUMAN      SQIHSFRDEKELERLQICQRKSDHL--KEQFEKSHEQLLQNIKAEKENKIQRLNEELEKSNECAEMLKQK
WAP_ARATH       GTLRSEMVDKERLKEEIHRL---GCLVKEKEVQTAENNLATERKKIEQQINDLQSQVERQETEIQDKIEA
TGO1_DROME      TRLQEIETESELAK---------ALEARNYEMQKLQNQIVELTVKWERELQTSLAKIE------------
SOJO_XENLA      LEMKNLHAGEQ---KHTITILQQETLWHEQQLESVNHLLTQARKELEIQTKNTSAAMKSLQNQVLTVCKE
SLK19_YEAST     NKVHKLENECELEKQKFEKTSHENLISLQNELKISSDRITTLTKENEVLMEQTLSNDQKDRDD------E
SETX_HUMAN      REIQRQELDENISKVSKER---QELASKIKEVQ-------------------------------------
PMFBP_MOUSE     ERMKKLNMEKKL--QGFQQQSEQEVHNFDKKLEEMSNQV----LQWQRQHQSDLKMLAAKESQLREFQEE
PLCB4_HUMAN     KSIKN-KAERERRVRELNSSNTKKFLEERKRLAMKQDQLKKVQLEHLEFLEKQ-NEQAKEMQQM------
MYSA_DROME      KDIE--DLELNVQKAEQDKAT------KDHQIRNLNDEIA-----HQDELINKLNKEKKETNQKTGEELQ
MYS3_HYDAT      SKNSKVNSELLALNSQLSESEHNLGIA-TKNIKTLESQLAESKNFNEAESKAKLEN--------------
MRCKB_RAT       IDSMRQDIRKEKSRKELEARLEDAVAEASKESKQMERELETLKLEHQQEISKIRSELEKK----------
LVA_DROME       QRIEELMREDQTEKLVFE------ILTKNQELQLLRMQVKQLEEDKEDQ---------------------
KTN1_MOUSE      DSLAN--EQDHLASKEEEQNMNFLLKAEVQKWQALANEQAATAHEVE-KMQKSIHVKEDEIRLLEEQLQH
KRT37_HUMAN     SLISNLEEQLSEIRADLERQNQEYQVLLDVKAR-LENEIATYRLESED----------------------
GOGA5_RAT       TELDRMKQEFHYVEEDLHRTKNSRIKDREEEIQKLRNQLTNKTLSNSSQ-----SELESRLHQL-TETLI
FKB15_MOUSE     LKVTSL--EEELTDLRAEKTSLEKNLSERKKKSAQEREMDEIRKSHQEELDRLRQLLKKAR---------
EZRI_RABIT      MRLQDYEQKTKKAEKELSDQIQRALQLEDERKRAQEDRVAALRAKEE--LERQAADQIKSQEQL------
CENPE_MOUSE     QELQNKEYEC-LAMKTINETQGSRC-EMDHLNQQLEAQKSTLKVEMENRLHETLEEMRKERDELW-----


                         +         .         .         .         .         *         .:210
query           XXXXXXXSLASVKQNYEAQLKAASEQVEFYKNFKAQQSTKAIGESLEQYAESEFNKVRSFAFPNAYFEKD
Y161_MYCPN      TKXXXXXXXXXXXXYFLEQLEQAQKDIEELKTREERFSKWAIGKELEKWCWEAYKNYEEL-FQNCVFAPY
Y148_MYCGE      LEITNQKQLESSRNEFEEKINQQNLTIEKLKIQQARSSIWAVGNELEKWCENQYESYAD-SFENCQFTRY
MYSP_DERFA      QLTKANGDAASWKSKYEAELQAHADEVEELRRKMAQKISE-----YEEQLEALLNKCSSLE------KQK
M12_STRPY       ----------SKKQQVEAALKQLEEQ-----NKISEASRKGLRRDLDTSREAKKQVEKDLANLTAELDKE
CLIP1_HUMAN     TLNKLQEAEIKVKELEVLQAK-CNEQTKVIDNFTSQ--LKATEEKLSSEGKSEMKKLRQEAAEKQIKHLE
KINH_LOLPE      DNQRLSLALEKLQADYEKAAKLADLSLQIDRREQAKQDLKGLEETVAKELQTLHNLRKLFV-----QDLQ
HMW2_MYCPN      AKKKLDQKLAEQKRIDEEQIKIATERRELEKLYLVKKQKQDQKENDLLIFEKQLRQYQA-DFENEIEEKQ
MYSP_SARSC      YEEQLEASLAKQKSRLQSEVEVLIMDLE-KATTHAQQLEKRVAQXXXXXXXXXXXXXXXXXXXXXXXXXX
GCC2_MOUSE      -----ISSLAKEKDDFISKIKTSHEEMDHQKWEREQRLSVELREAAGQAAQHN-------------SELR
PUMA_PARUN      ------KNLERVCETLRSQLTAANDRVASL-NTTINEQTSKIRESHEHRLEEDLSRATSSAIENDLGNAT
KIF15_MOUSE     ARLENEKLLES-----QACLQDSYDNLQEVMKFEIDQLSKNLQNCKQENETLKSDLHNLVELFEAEKERN
MLP1_YEAST      DETINDDSLRKELEKSKINLTDAYSQIKEYKDLTTSQSLQQTNSKLDESFKDFTNQIKNLT--------D
PIBF1_HUMAN     -YEKYVASRDHYKTEYENKLHDELEQIRLKTNQEIDQLRNA---SREMY-ERENRNLRE-ARDNAVAEKE
NUF1_YEAST      KNKIEDNSTATMKENYEKQLESLRKDIEEYKE-SAKDSEDKIEELKIRIAEN------------------
KTN1_CHICK      --WKAMEALASTEKLLQDKVNKTAKE--------KQQHVEA--------AEVETRELLQKLFPNVSFEKM
GOGA4_HUMAN     -----QQELSRVKQEVVDVMKKSSEE--------------------------------------------
CC150_MOUSE     QALQTNGHLQSKLDHLQEKLESKERERQSLEAFKEQ-----VAEESKVEAELHAERIEAL---RKQFQTE
IFT81_HUMAN     EESRYHYTNCMIK-NLEVQLRRATDEMKAYISSDQQEKRKAIREQYTKNTAEQEN---------------
CCD46_MOUSE     QVHKLREELISVNSQRKQQLRAAKDHETAVKKLKAESERVKMELKKTHAAETE-----------------
CCD46_HUMAN     VNSQRKQQLVELGLLREEEKQRATREHEIVVNLKAESEKMKIELKKTHAAETE-----------------
SMC1A_MOUSE     EEFCREIGVRNIREFEEEKVKRQNEIAKKRLEFENQKTRLGIQLDFEKNQLKE-DQDKVHMWEQTVKKDE
KIF1_DICDI      EKELTIGSLSSTLNNTNQIIELINEQSKSYKNV-AEMEIESLRDETTQLRET------------------
TPM2_SCHMA      ----------------------------------------------------------------------
HMW2_MYCGE      EKLSDEKKLKNLSQTYKAEYSQQQLQQKYTNLLDLKENLERTKDQLDKKHRSIFARLTKFA-NDLRFEKK
CENPE_HUMAN     XXXXXXXXXXXXXXXXRVQEALQIERDQLKEN------TKEIVAKMKESQEKEYQFLKMTAV-NETQEKM
SCLT1_RAT       ----------------------------------------------------------------------
NF70_LOLPE      WRNELAQAIRDIQQEYDAKCDQMRGDIEAYYNLKVQEFRTG---ATKQNMEVTRNK-----------EEN
NF60_LOLPE      WRNELAQAIRDIQQEYDAKCDQMRGDIEAYYNLKVQEFRTG---ATKQNMEVTRNK-----------EEN
HMW2_MYCGA      LNQKSDKMIEDLKV-FERDLKRQKEDLSIYEKSLQQKEASLI----------------------------
GCC2_HUMAN      -------SLTEEKDDFINKLKNSHEEMDFHKKCEREERILELGKKVEQ--TIQYNS-----------ELE
CP135_DANRE     ----------------------------------------------------------------------
ODFP2_MOUSE     DRLEQSESTNRSMQNYVQFLKASYANV-------------------------------------------
MYO4_CAEEL      -EKRARADLDKQKRKVEGELKIAQENID------------------------------------------
LRRF2_HUMAN     ----------------------------------------------------------------------
USO1_YEAST      QDECNFKE----KEVSELEDKLKASEDKNSKYLELQKESEKIKEELDAKTTELKIQLEKITNXXXXXXXX
SMC1A_XENLA     EEFCREIGVRNIREFEEEKVKRQNEIAKKRLEFENQKTRLGIQLDYEKQLKEDQGKVQT--WEQSVKKDD
ODFP2_RAT       DRLEQSESTNRSMQNYVQFLKSSYANV-------------------------------------------
VPS60_YEAST     ----------------------------------------------------------------------
TUFT1_BOVIN     ----------------------------------------------------------------------
MAD1_KLULA      ----------------------------------------------------------------------
Y474_MYCPN      ----------------------------------------------------------------------
SPO15_SCHPO     FQEKLAKSVMQLKEN---EQNFSSLDTSFKKLNESHQELENNHQTITKQLKDTSSKLQQLQLERANFEKE
RPGR1_HUMAN     ----------------------------------------------------------------------
ROCK2_BOVIN     YQRKADHE-ADKKRNLENDVNSLKDQLEDLKNQNSQISTEKVNQLQRQLDET------------------
MOES_LYTVA      ----------------------------------------------------------------------
LRRX1_DICDI     ----------------------------------------------------------------------
MAD1_YEAST      LSSVKASKMINSHPNYSTE--EFNELTEMNKMIQDQQYTKEL-ELANMQQANELKKLKQSQDTSTFWKLE
DYNA_NEUCR      ----------------------------------------------------------------------
CEP63_PONAB     IEEFRQKSLDWEKQSLEAQRKALAEQSEIIQAQLANRKQKL--ESVELSSQSEIQHLSS-----------
CE164_HUMAN     ----------------------------------------------------------------------
SMC1A_RAT       EEFCREIGVRNIREFEEEKVKRQNEIAKKRLEFENQKTRLGIQLDFEKNQLKE-DQDKVHMWEQTVKKDE
SMC1A_HUMAN     EEFCREIGVRNIREFEEEKVKRQNEIAKKRLEFENQKTRLGIQLDFEKNQLKE-DQDKVHMWEQTVKKDE
SMC1A_BOVIN     EEFCREIGVRNIREFEEEKVKRQNEIAKKRLEFENQKTRLGIQLDFEKNQLKE-DQDKVHMWEQTVKKDE
RUD3_YEAST      ----------------------------------------------------------------------
ROCK2_MOUSE     YQRKADHE-ADKKRNLENDVNSLKDQLEDLKNQSSQISTEKVNQLQKQLDEA------------------
NFM_RAT         RKDYLKTDISTALKEIRSQLECHSDQ----NMHQAEEWFKCRYAKLTEAAEQNKEAIRSAKEEIAEYRRQ
MYSP_BLOTA      XXTKANGDAASWKSKYEAELQAHVDEVEELRR-KMAQKISEYGEQL----EALLNKCSALEKQKARLQSE
MLP2_YEAST      ALIELKNELAKTKENYDAKIELEKKE----KWAREEDLSRLRGELGEIRAEGALHFVQQSEKLRNEVERI
CN145_HUMAN     ----------------------------------------------------------------------
CLIP1_CHICK     LTKANEKAVQLQKNVEQTAQKAEQSQQETLKTH--QEELKKMQDQLTDMKKQMETSQNQYKDLQAKYEKE
Y4393_ANASP     ----------------------------------------------------------------------
SYA_NATTJ       ----------------------------------------------------------------------
NFM_MOUSE       RKDYLKTDISTALKEIRSQLECHSDQ----NMHQAEEWFKCRYAKLTEAAEQNKEAIRSAKEEIAEYRRQ
MUKB_VIBCM      ----------------------------------------------------------------------
MUKB_VIBCH      ----------------------------------------------------------------------
GOGA1_HUMAN     ----------------------------------------------------------------------
DPY27_CAEEL     ----------------------------------------------------------------------
CEP63_DANRE     ----------------------------------------------------------------------
CCD41_RAT       ----------------------------------------------------------------------
CASP_PONAB      RLIDVPDPVPALDLGQQLQLKVQ-------RLHDIETENQKLRETLEEY-NKEFAEV-----------KN
CASP_HUMAN      RLIDVPDPVPALDLGQQLQLKVQ-------RLHDIETENQKLRETLEEY-NKEFAEV-----------KN
RS6_GLOVI       ----------------------------------------------------------------------
ROCK2_HUMAN     YQRKADHE-ADKKRNLENDVNSLKDQLEDLKNQNSQISTEKVNQLQRQLDET------------------
NUF2_YARLI      ----------------------------------------------------------------------
NFM_BOVIN       RKDYLKTDISTALKEIRSQLESHSDQ----NMHQAEEWFKCRYAKLTEAAEQNKEAIRSAKEEIAEYRRQ
GOGA3_HUMAN     LQFDKEQMVAVTEANEALKKQIEELQQEARKAITEQQKMRRLGSDLTS-AQKEM-KTKHKAYENA-----
FHAD1_HUMAN     ----------------------------------------------------------------------
DCTN1_DROME     ----------------------------------------------------------------------
ANR24_MOUSE     ----------------------------------------------------------------------
RASEF_CAEEL     FQLEPINSLSSSDQASHATEESESVRKQLQLLFDANRKLHETNESLRDALDSRASVLRQF----------
PCNT_MOUSE      IFQAKHEAEVSLK-NLEAQHQAAIKKLQ------------------------------------------
NFM_PIG         RKDYLKTDISSALKEIRSQLECHSDQEEWFKTEAAQENKEAIRSAKEEIAE-------------------
NFM_HUMAN       RKDYLKTDISTALKEIRSQLESHSDQ----NMHQAEEWFKCRYAKLTEAAEQNKEAIRSAKEEIAEYRRQ
MYO3_CAEBR      -----RSDIEKSKRKVEGDLKVAQENID------------------------------------------
MUKB_VIBC3      ----------------------------------------------------------------------
LEKR1_HUMAN     ----------------------------------------------------------------------
HOOK_BRAFL      -------------DNLEPKVSSSAEKIQQLQEMKKDDDMKAMEERYKRYLEKAKSVIRT-----------
CEP63_HUMAN     IEEFRQKSLDWEKQSLEAQRKALAEQSEIIQAQLVNRKQKL--ESVELSSQSEIQHLSS-----------
CCD41_MOUSE     HLLQKLKSLEAEVAELRAEKENSGAQVENVQRIQVRQLAEMQATLRSLEAEKQSAKLQAERL-------E
CASC4_CHICK     DSLQCGQQIKEMRIQHEENIKKLMDQI-----VREQKATQRIQSS-------------------------
SLA2_YEAST      ----------------------------------------------------------------------
ROCK2_RAT       YQRKADHE-ADKKRNLENDVNSLKDQLEDLKNQSSQISTEKVNQLQKQLDEA------------------
RBGP1_MOUSE     ----------------------------------------------------------------------
RASEF_HUMAN     ----------------------------------------------------------------------
RAD50_RAT       RLAKLNKELASAEQNINNELKKKEEQLSSYED--------------------------------------
MYO3_CAEEL      -----RGDIEKAKRKVEGDLKVAQENID------------------------------------------
MYH9_CHICK      QKRDLGEELEALKTELEDTLDSTAAQQEL--RSKREQEVTVLKKTLEDEAKT------------------
BPS2_ACIAM      --IKNKESLASIRQSYERQLQEINAQLQTAQRNEAEIEIRLLEKVLDQIRESE-----------------
YL139_YARLI     ----------------------------------------------------------------------
MYSS_CYPCA      -EKKLRMDLERAKRKLEGDLKLAQESIMDLENEKQQSDEK------------------------------
KI20B_MOUSE     ----------------------------------------------------------------------
GRDN_MOUSE      -----EKTIETLRENSERQIKILEQE-----NEHLNQTVSSLRQRSQISAEARVKDI----------EKE
CUX1_HUMAN      RLIDVPDPVPALDLGQQLQLKVQ-------RLHDIETENQKLRETLEEY-NKEFAEV-----------KN
ANT1_ONCVO      ----------------------------------------------------------------------
AN30A_HUMAN     TLKLKEESLTKRASQYSGQLKVIAENTMLTSKLKEKQDK----EILEAEIESHHPRLAS-----AVQDHD
NU211_SCHPO     ----------------------------------------------------------------------
NIN_MOUSE       -LCQESKRLQTVVQNTQADLTHSREKV-------------------------------------------
MYSP_SCHJA      VLGQLDGAL-KAKQSAESKLEGLDSQLNRLKTLDLQRQLTELNNAKSRLTSENFELLHINQDYEAQILNY
K2C78_HUMAN     ----------------------------------------------------------------------
GOGA1_MOUSE     ----------------------------------------------------------------------
CE290_BOVIN     SREKEVESLRTQLLDYQAQSDEKALIAKLHQHVVSLQASEAAALGKVESVASKLQKVEA-----------
TUFT1_PIG       ----------------------------------------------------------------------
SPDLY_MACFA     ----------------------------------------------------------------------
RASEF_MOUSE     ----------------------------------------------------------------------
RAD50_HALSA     ----------------------------------------------------------------------
MYO5A_CHICK     ----------------------------------------------------------------------
MRCKB_HUMAN     ----------------------------------------------------------------------
LIPB2_HUMAN     ----------------------------------------------------------------------
GOGA5_MOUSE     QKQTMLESLSTEKNSLVFQLERLEQQV-------------------------------------------
GOGA5_HUMAN     ----------------------------------------------------------------------
GAS8_BOVIN      -EAKYDKKMKMLRDELDLRRKTEIHEVEERKNGQMQRHEEAFTDIKNYYNDITLN---NLALINSLKE--
CENPF_HUMAN     XXXXXXXXSSTAMEMLQTQLKELNERVAALHN--DQEACKAKEQNLSSQVECELEKAQLLQ---------
BPA1_HUMAN      VEEL-------TRQNNETKLMMQRIQAESENIVLEKQTIQQRCEALKIQADGFKDQLRS---TNEHLHKQ
WAP_ARATH       LSVVSARELEKVK-GYETKI--------------------------------------------------
TGO1_DROME      ----------------------------------------------------------------------
SOJO_XENLA      ELALYLHELEDNREQFENQIKTKSEELWCLQN-EIKLRTQSLQETSEE----------------------
SLK19_YEAST     KIKSLGKQVQDWKEKYEARLKLLAEDLYIQYSSKHEQKVKLLKKGYENKYQNKFDQL-------------
SETX_HUMAN      ----------------------------------------------------------------------
PMFBP_MOUSE     MATLRESLLADEKEPYSPPAKLTPKE-----TCRHHRENDQIMNNVEQWAKEQ-----------------
PLCB4_HUMAN     ----------------------------------------------------------------------
MYSA_DROME      AAEDKINHLNKVKAKLEQTLDELEDSLEREKKVRVEKSKRKVEGDLEAVADLERNKKE---LEQTIQRKD
MYS3_HYDAT      ----------------------------------------------------------------------
MRCKB_RAT       ----------------------------------------------------------------------
LVA_DROME       ----------------------------------------------------------------------
KTN1_MOUSE      EVASKMEELKILSE----QNKALQSEVRKLQTAVSQQPNKDVVEQMEKCIQEKDEKLRT-----------
KRT37_HUMAN     ----------------------------------------------------------------------
GOGA5_RAT       QKQTLLESLSTEKNSLVFQLERLEQQL-------------------------------------------
FKB15_MOUSE     ----------------------------------------------------------------------
EZRI_RABIT      ----------------------------------------------------------------------
CENPE_MOUSE     -------SMEERLTVERDQLKKSLEET-VTKGMEKEEELRVAHVHLEEHQET-INKLRKMV-------SD


                         .         .         .         +         .         .         .:280
query           NKVSSRGSKGDFIFRECDENGVEIISIMFEMKNEADGTEKKHKNADFYKELDKDRREKNCEYAVLVTMLE
Y161_MYCPN      SELSNINEKADFIFQVFNPNNDKFFSICCEMKTEFTESKSRTKNEDHVKKLIADAKRAKCQYGFLVSELE
Y148_MYCGE      DENDFPNEKADYIFSFFGENKIPFLSICCEMKSEFNDSKHKSKNKDHISKLVRDAKRANCKYAFLISELE
MYSP_DERFA      SRLQS-----------------EVEVLIMDLEKATRHAQQLEKRVAQLEKINLDLKNKLEEVTMLMEQAQ
M12_STRPY       KQISDASRQG------------------------------------------------------------
CLIP1_HUMAN     IEKNAESSKASSITRELQGRELKLTNLQENLSEVSQVKETLEKELQILKEKFAEASEE--AVSVQRSMQE
KINH_LOLPE      NKVKKSCSKTEEEDEDTGGNAAQKQKISF-LENNLEQLTKVH------KQLVRDNADLRCELPKLEKRLR
HMW2_MYCPN      NELFASQKSLQKSFTQLKNKEAELNQKAQKIAEDAHLKQNKHHHADLEIFLEGEQQEKH-------KLLE
MYSP_SARSC      HEYEKLRDQRDALARE----NKKLTDDLAECKSQLNDAHRRHEQEIEIKRLENEREELSAAYKEAETLRE
GCC2_MOUSE      QRVSELTGKLDELVREKSQNDQSITVQMKTMTEDQEALSSKIKS--LYEENNRLHSEK-AQLSRDLEALQ
PUMA_PARUN      GRLRSSEEHNAILQSENRKSKTEIEALKHQIDTIMNTKESCESEVERLXXXXXXXXXXXXEQNEKIEKLR
KIF15_MOUSE     NKLSLQ-------FEEDKENSKEILKVL-----ETVRQEKQKEMAKCEKQMAKIQKLEESLLATVISSLE
MLP1_YEAST      EKTSL-------------EDKISLLEQMFNLNNELDLQKKEKEKADFKKR---------------ISILQ
PIBF1_HUMAN     RAVMA----------------------------EKDALEKHDQLLDRYRELQLSTESKVTEF--------
NUF1_YEAST      ----------------------------------------------------------------------
KTN1_CHICK      AKEYLRGASGDIKVMEQKLKEAEELHILLQLECE------KYKSVGILQRLQRSVEEEESKWKIKVEESQ
GOGA4_HUMAN     ----------------------------------------------------------------------
CC150_MOUSE     RETAKKASQREVLKKALDEANFRSVEV------SRANRELRHKATELEKVVNSNKEKLKNQRAQIKLHLK
IFT81_HUMAN     ----------------------------------------------------------------------
CCD46_MOUSE     ----------------------------------------------------------------------
CCD46_HUMAN     ----------------------------------------------------------------------
SMC1A_MOUSE     NEIEKLKKEEQRHMKIIDETMAQLQDLKNQLAKKSEVNDKNHEMEEIRKKLNKEMTHLQKEVTAIETKLE
KIF1_DICDI      ----------------------------------------------------------------------
TPM2_SCHMA      ----------------------------------------------------------------------
HMW2_MYCGE      QLLKAQRIVDDKLLKE-NERNLHFLSNETERKDQISYFEKQRKQADAILASHKEVKKKEGELQKLLVELE
CENPE_HUMAN     CEIEH--LKEQFETQKLNLENIETENIRL--------TQILHENLEEMRSVTKERDDRSVEETLKVERDQ
SCLT1_RAT       ----------------------------------------------------------------------
NF70_LOLPE      TKLKS--------------NMTEIRNRLADL--EARNAQLERTNQDLLRDLEKDRQNESCQYKEEITKLR
NF60_LOLPE      TKLKS--------------NMTEIRNRLADL--EARNAQLERTNQDLLRDLEKDRQNESCQYKEEITKLR
HMW2_MYCGA      ----------------------------------------------------------------------
GCC2_HUMAN      QKVNXXXXXXXXXXXXXDQNDQKLEKLMVQMKVLSEDKEVLSAEVSLYEENNKLSSEKKQLSRDLEVFLS
CP135_DANRE     ----------------------------------------------------------------------
ODFP2_MOUSE     ----------------------------------------------------------------------
MYO4_CAEEL      ----------------------------------------------------------------------
LRRF2_HUMAN     ----------------------------------------------------------------------
USO1_YEAST      XXXXXXXXXXXXXXRKNAEEQLEKLKNEIQIKNQAFEKERKLLN-EGSSTITQEYSEKINTLEDELIRLQ
SMC1A_XENLA     NEIEKLKKEEQRHMKIIDETMAQLQDLKNQLAKKSEVNDKNHLMEDIRKKLGSANKE-------------
ODFP2_RAT       ----------------------------------------------------------------------
VPS60_YEAST     ----------------------------------------------------------------------
TUFT1_BOVIN     ----------------------------------------------------------------------
MAD1_KLULA      ----------------------------------------------------------------------
Y474_MYCPN      ----------------------------------------------------------------------
SPO15_SCHPO     STLSDENND----LRTXXXXXXXXXXXXXXXQEDVDSLEKN------IQTLKEDLRKS--EEALRFSKLE
RPGR1_HUMAN     ----------------------------------------------------------------------
ROCK2_BOVIN     ----------------------------------------------------------------------
MOES_LYTVA      ----------------------------------------------------------------------
LRRX1_DICDI     ----------------------------------------------------------------------
MAD1_YEAST      NE--------------------------------------------------------------------
DYNA_NEUCR      ----------------------------------------------------------------------
CEP63_PONAB     ----------------------------------------------------------------------
CE164_HUMAN     ----------------------------------------------------------------------
SMC1A_RAT       NEIEKLKKEEQRHMKIIDETMAQLQDLKNQLAKKSEVNDKNHEMEEIRKKLNKEMTHLQKEVTAIETKLE
SMC1A_HUMAN     NEIEKLKKEEQRHMKIIDETMAQLQDLKNQLAKKSEVNDKNHEMEEIRKKLNKEMTHLQKEVTAIETKLE
SMC1A_BOVIN     NEIEKLKKEEQRHMKIIDETMAQLQDLKNQLAKKSEVNDKNHEMEEIRKKLNKEMTHLQKEVTAIETKLE
RUD3_YEAST      ----------------------------------------------------------------------
ROCK2_MOUSE     ----------------------------------------------------------------------
NFM_RAT         LQSKSRGTKESLQLSDIEERHNHDLSTIQQLENELRGTKEMARHLREYQDLLNVKMALDIEIAAYRKLLE
MYSP_BLOTA      VEV-----------------------LIMDLEKATAHAQALEKRVSQLEKINLDLKSKLEEVSMLLEQTQ
MLP2_YEAST      QKMIEKIEKMSTIVQLCKKKEMQYQSTMKENKDQAELTKTKSSLYSAQDLLDKHEREEKADYEELISNIE
CN145_HUMAN     ----------------------------------------------------------------------
CLIP1_CHICK     HDADIKGFKQNLLLKAAQKKNDELETQAEELKKQAEQAKADKRAEEVLQTMEKVTKEKD-----------
Y4393_ANASP     ----------------------------------------------------------------------
SYA_NATTJ       ----------------------------------------------------------------------
NFM_MOUSE       LQSKSRGTKESLQLSDIEERHNHDLSTIQQLENELRGTKEMARHLREYQDLLNVKMALDIEIAAYRKLLE
MUKB_VIBCM      ----------------------------------------------------------------------
MUKB_VIBCH      ----------------------------------------------------------------------
GOGA1_HUMAN     ----------------------------------------------------------------------
DPY27_CAEEL     ----------------------------------------------------------------------
CEP63_DANRE     ----------------------------------------------------------------------
CCD41_RAT       ----------------------------------------------------------------------
CASP_PONAB      QEVTIKALKEKIRYEQTLKNQAETIALEKEQKLQNDFAEKERKLQETQMSTTSKLEEAEHKVQSLQTALE
CASP_HUMAN      QEVTIKALKEKIRYEQTLKNQAETIALEKEQKLQNDFAEKERKLQETQMSTTSKLEEAEHKVQSLQTALE
RS6_GLOVI       ----------------------------------------------------------------------
ROCK2_HUMAN     ----------------------------------------------------------------------
NUF2_YARLI      ----------------------------------------------------------------------
NFM_BOVIN       LQSKSRGTKESLQLSDIEERHNHDLSTIQQLENELRGTKEMARHLREYQDLLNVKMALDIEIAAYRKLLE
GOGA3_HUMAN     ----------------------------------------------------------------------
FHAD1_HUMAN     ----------------------------------------------------------------------
DCTN1_DROME     ----------------------------------------------------------------------
ANR24_MOUSE     ----------------------------------------------------------------------
RASEF_CAEEL     ----------------------------------------------------------------------
PCNT_MOUSE      ----------------------------------------------------------------------
NFM_PIG         ----------------------------------------------------------------------
NFM_HUMAN       LQSKSRGTKESLQLSDIEERHNHDLSTIQQLENELRGTKEMARHLREYQDLLNVKMALDIEIAAYRKLLE
MYO3_CAEBR      ----------------------------------------------------------------------
MUKB_VIBC3      ----------------------------------------------------------------------
LEKR1_HUMAN     ----------------------------------------------------------------------
HOOK_BRAFL      ----------------------------------------------------------------------
CEP63_HUMAN     ----------------------------------------------------------------------
CCD41_MOUSE     KELQSSNEQNTCLISKLHRADREISTLASEVKNKLEITDIKLEAARAKSELERERNKIQSELDGLQSILK
CASC4_CHICK     ----------------------------------------------------------------------
SLA2_YEAST      ----------------------------------------------------------------------
ROCK2_RAT       ----------------------------------------------------------------------
RBGP1_MOUSE     ----------------------------------------------------------------------
RASEF_HUMAN     ----------------------------------------------------------------------
RAD50_RAT       ----------------------------------------------------------------------
MYO3_CAEEL      ----------------------------------------------------------------------
MYH9_CHICK      ----------------------------------------------------------------------
BPS2_ACIAM      ----------------------------------------------------------------------
YL139_YARLI     ----------------------------------------------------------------------
MYSS_CYPCA      ----------------------------------------------------------------------
KI20B_MOUSE     ----------------------------------------------------------------------
GRDN_MOUSE      NKILHESIK---------ETCGKLSKIEFEKRQMXXXXXXXXXXXXRAEELENELNHLGKENELLITNLK
CUX1_HUMAN      QEVTIKALKEKIRYEQTLKNQAETIALEKEQKLQNDFAEKERKLQETQMSTTSKLEEAEHKVQSLQTALE
ANT1_ONCVO      ----------------------------------------------------------------------
AN30A_HUMAN     QIVTSRKSQ-------------------------------------------------------------
NU211_SCHPO     ----------------------------------------------------------------------
NIN_MOUSE       ----------------------------------------------------------------------
MYSP_SCHJA      SKASSLESQVDDLKRSLDDNRFNLQAQLTSLQMDYDNLQAKYEESEEASNLRNQVSKFNADIAALKSKFE
K2C78_HUMAN     ----------------------------------------------------------------------
GOGA1_MOUSE     ----------------------------------------------------------------------
CE290_BOVIN     ----------------------------------------------------------------------
TUFT1_PIG       ----------------------------------------------------------------------
SPDLY_MACFA     ----------------------------------------------------------------------
RASEF_MOUSE     ----------------------------------------------------------------------
RAD50_HALSA     ----------------------------------------------------------------------
MYO5A_CHICK     ----------------------------------------------------------------------
MRCKB_HUMAN     ----------------------------------------------------------------------
LIPB2_HUMAN     ----------------------------------------------------------------------
GOGA5_MOUSE     ----------------------------------------------------------------------
GOGA5_HUMAN     ----------------------------------------------------------------------
GAS8_BOVIN      -QMEDMGKKEEHLEKEMTE-------VAMQNRRLADPLQKREEMSDMQKKLGSYERDKQCTKARLLKSLR
CENPF_HUMAN     ---GLDEAKNNYIVLQSSVNGL--------IQEVEDGKQKLEKKDEEISRL-KNQIQDQEQLVSKLSQVE
BPA1_HUMAN      TKTEQDFQRK---IKCLEEDLAKSQNLVSEFKQKCDNTKKEVRNLN--AELNASKEEK------------
WAP_ARATH       ----------------------------------------------------------------------
TGO1_DROME      ----------------------------------------------------------------------
SOJO_XENLA      ----------------------------------------------------------------------
SLK19_YEAST     ----------------------------------------------------------------------
SETX_HUMAN      ----------------------------------------------------------------------
PMFBP_MOUSE     ----------------------------------------------------------------------
PLCB4_HUMAN     ----------------------------------------------------------------------
MYSA_DROME      KELSSITAK-------------------------------------------------------------
MYS3_HYDAT      ----------------------------------------------------------------------
MRCKB_RAT       ----------------------------------------------------------------------
LVA_DROME       ----------------------------------------------------------------------
KTN1_MOUSE      ----------------------------------------------------------------------
KRT37_HUMAN     ----------------------------------------------------------------------
GOGA5_RAT       ----------------------------------------------------------------------
FKB15_MOUSE     ----------------------------------------------------------------------
EZRI_RABIT      ----------------------------------------------------------------------
CENPE_MOUSE     YTDEISHTQGD----------LKHTNAVVEAQNQ-DLREKEHQ----LSQVKADLRETVDQMEQLKKKLE


                         .         *         .         .         .         .         +:350
query           ADNDYFNTGIVDVSHEYEKMYVVRPQFFIQLIGLLRNAALNSLKYKQELALVREQNIDITHFEEDLDAFK
Y161_MYCPN      TEND-VQVQRMHTSNSEVEVYLVRPMFFIVMLRLF-----------YFLAKKMFAQVDVNSEYLDKEALN
Y148_MYCGE      TEND-IQVRLMPTLESGVEVYLVRPMFFIXXXXXXXXXXXXXXXXN------RFQSVEL------IDKNK
MYSP_DERFA      KELRVKIAELQKLQHEYEKLRDQRDQLARENKKLTDDLAEAKSQLNDAHRRIHEQEIEIKRLENERDELS
M12_STRPY       ----------------------------------------------------------------------
CLIP1_HUMAN     T---------VNKLHQKEEQFNMLSS---DLEKLRENLADMEAKFREK----DEREEQLIKAKEKLENDI
KINH_LOLPE      A---------------------------------------------------------------------
HMW2_MYCPN      ARTQFDNVSLLSARFKQKQAELVKQKQSLEQL----TAAFN----KEQEAVERDWKDRLANLEKQKEMLG
MYSP_SARSC      AKNQRLTAELAQVRHDYEKIEALRKQYQIEIEQLNMRLAEAEAKLKTEIALKKKYQAQITELELSLDAAN
GCC2_MOUSE      AQQDFAHKEHV---AEFEKKLQLMVEERDDLNKLLENEQVQKSFVKTQLEYLKQLRASILEENEEEDVVK
PUMA_PARUN      IEHDHLERDYREKTKEVDRLKEVEKTFELKV-----NRARQELEFSKKLIVTETERNAISGEAQKLDKEV
KIF15_MOUSE     KSRESDKELVTNLMNQIQELRISIGEKSETIATLKQELQDINCKYNASLALIRRQEVDILELKETL----
MLP1_YEAST      NN----NKEVEAVKSEYEKLSKIQNDLDQQTI--YANTAQNN--YEQELQKHADVSKTISELREQLHTYK
PIBF1_HUMAN     ----------------------------------------------------------------------
NUF1_YEAST      ----------------------------------------------------------------------
KTN1_CHICK      KELKQMRSSVASLEHEVERL-------------------------KEEIKEVETLKKEREHLESELEKAE
GOGA4_HUMAN     ----------------------------------------------------------------------
CC150_MOUSE     ANNAQNMERMKQIEMELRQMEIIKDQYYEQSLSIQRFVSMNTLQKEMELLTKSQYETSARNKQQEL---R
IFT81_HUMAN     ----------------------------------------------------------------------
CCD46_MOUSE     ----------------------------------------------------------------------
CCD46_HUMAN     ----------------------------------------------------------------------
SMC1A_MOUSE     QE--------------------------------------------------------------------
KIF1_DICDI      ----------------------------------------------------------------------
TPM2_SCHMA      ----------------------------------------------------------------------
HMW2_MYCGE      TRKTKLNNDFAKFSRQREEFENQRXXXXXXXXXXXXXXNSNNFKTKA----IQEIENSYKRGMEELNFQK
CENPE_HUMAN     LKENLRETITRDLEKQEEHMHLKEHQETIDKLRGIVSEKTNEISNMQK---------DLEHSNDALKAQD
SCLT1_RAT       ----------------------------------------------------------------------
NF70_LOLPE      GE--------------------------------------------------------------------
NF60_LOLPE      GE--------------------------------------------------------------------
HMW2_MYCGA      ----------------------------------------------------------------------
GCC2_HUMAN      QKEDVI---LKEHITQLEKKLQLMVEEQDNLNKLLENEQVQKLFVKTQLGFLKEMGXXXXXXXXXXXXXX
CP135_DANRE     ----------------------------------------------------------------------
ODFP2_MOUSE     ----------------------------------------------------------------------
MYO4_CAEEL      ----------------------------------------------------------------------
LRRF2_HUMAN     ----------------------------------------------------------------------
USO1_YEAST      NENELKAKEIDNTRSELEKVSLSNDELLEEKQNTIKSLQDEILSYKDKLSIERDNKRDLESLKEQLRA--
SMC1A_XENLA     ----------------------------------------------------------------------
ODFP2_RAT       ----------------------------------------------------------------------
VPS60_YEAST     ----------------------------------------------------------------------
TUFT1_BOVIN     ----------------------------------------------------------------------
MAD1_KLULA      ----------------------------------------------------------------------
Y474_MYCPN      ----------------------------------------------------------------------
SPO15_SCHPO     AKN--LREVIDNLKGKHETLEAQRNDLHSSLSDAKNTNAILSSELTKSSEDVKRLTANVETLTQDSKAMK
RPGR1_HUMAN     ----------------------------------------------------------------------
ROCK2_BOVIN     ----------------------------------------------------------------------
MOES_LYTVA      ----------------------------------------------------------------------
LRRX1_DICDI     ----------------------------------------------------------------------
MAD1_YEAST      ----------------------------------------------------------------------
DYNA_NEUCR      ----------------------------------------------------------------------
CEP63_PONAB     ----------------------------------------------------------------------
CE164_HUMAN     ----------------------------------------------------------------------
SMC1A_RAT       ----------------------------------------------------------------------
SMC1A_HUMAN     ----------------------------------------------------------------------
SMC1A_BOVIN     ----------------------------------------------------------------------
RUD3_YEAST      ----------------------------------------------------------------------
ROCK2_MOUSE     ----------------------------------------------------------------------
NFM_RAT         GEETRFST--------------------------------------------------------------
MYSP_BLOTA      KDLRVKIADLQKLQHEYEKL--------------------------------------------------
MLP2_YEAST      QTESLRVENSVLIEKVDDTAANNGDKDHLKLVSLFSNLRRNSLETKRELAFVKQKNDSLEKTINDLQRTQ
CN145_HUMAN     ----------------------------------------------------------------------
CLIP1_CHICK     ----------------------------------------------------------------------
Y4393_ANASP     ----------------------------------------------------------------------
SYA_NATTJ       ----------------------------------------------------------------------
NFM_MOUSE       GEETRFST--------------------------------------------------------------
MUKB_VIBCM      ----------------------------------------------------------------------
MUKB_VIBCH      ----------------------------------------------------------------------
GOGA1_HUMAN     ----------------------------------------------------------------------
DPY27_CAEEL     ----------------------------------------------------------------------
CEP63_DANRE     ----------------------------------------------------------------------
CCD41_RAT       ----------------------------------------------------------------------
CASP_PONAB      KTR----TELFDLKTKYDEETTAKADEIEMIMTDLERANQRAEVAQREAETLREQLSSANHSLQL--ASQ
CASP_HUMAN      KTR----TELFDLKTKYDEETTAKADEIEMIMTDLERANQRAEVAQREAETLREQLSSANHSLQL--ASQ
RS6_GLOVI       ------------MSTKYETMYILRPDLTDEIIDQTITR-YQTLLAEQGAAPVETQHRGKRRLAYELKKFK
ROCK2_HUMAN     ----------------------------------------------------------------------
NUF2_YARLI      ----------------------------------------------------------------------
NFM_BOVIN       GEETRFST--------------------------------------------------------------
GOGA3_HUMAN     ----------------------------------------------------------------------
FHAD1_HUMAN     ----------------------------------------------------------------------
DCTN1_DROME     ----------------------------------------------------------------------
ANR24_MOUSE     ----------------------------------------------------------------------
RASEF_CAEEL     ----------------------------------------------------------------------
PCNT_MOUSE      ----------------------------------------------------------------------
NFM_PIG         ----------------------------------------------------------------------
NFM_HUMAN       GEETRFST--------------------------------------------------------------
MYO3_CAEBR      ----------------------------------------------------------------------
MUKB_VIBC3      ----------------------------------------------------------------------
LEKR1_HUMAN     ----------------------------------------------------------------------
HOOK_BRAFL      ----------------------------------------------------------------------
CEP63_HUMAN     ----------------------------------------------------------------------
CCD41_MOUSE     STVEHHKALLVEKDRELRKVQAAKEEGYQKLMVLLENRLSDLEKMKVERDVWRQSEKE--QCEEKLRASQ
CASC4_CHICK     ----------------------------------------------------------------------
SLA2_YEAST      ----------------------------------------------------------------------
ROCK2_RAT       ----------------------------------------------------------------------
RBGP1_MOUSE     ----------------------------------------------------------------------
RASEF_HUMAN     ----------------------------------------------------------------------
RAD50_RAT       ----------------------------------------------------------------------
MYO3_CAEEL      ----------------------------------------------------------------------
MYH9_CHICK      ----------------------------------------------------------------------
BPS2_ACIAM      ----------------------------------------------------------------------
YL139_YARLI     ----------------------------------------------------------------------
MYSS_CYPCA      ----------------------------------------------------------------------
KI20B_MOUSE     ----------------------------------------------------------------------
GRDN_MOUSE      ITCEKLET-LEQENSELER----ENRKFKKTLDSFKNLTFQLESLEKENSQLDEENLELRRSVESLKCAS
CUX1_HUMAN      KTR----TELFDLKTKYDEETTAKADEIEMIMTDLERANQRAEVAQREAETLREQLSSANHSLQL--ASQ
ANT1_ONCVO      ----------------------------------------------------------------------
AN30A_HUMAN     ----------------------------------------------------------------------
NU211_SCHPO     ----------------------------------------------------------------------
NIN_MOUSE       ----------------------------------------------------------------------
MYSP_SCHJA      RE-------LMSKTEEFEEMKRKLTMRITELEDVAERERLKAVSXXXXXXXXXXXXXDLQSEIESLNGEL
K2C78_HUMAN     ----------------------------------------------------------------------
GOGA1_MOUSE     ----------------------------------------------------------------------
CE290_BOVIN     ----------------------------------------------------------------------
TUFT1_PIG       ----------------------------------------------------------------------
SPDLY_MACFA     ----------------------------------------------------------------------
RASEF_MOUSE     ----------------------------------------------------------------------
RAD50_HALSA     ----------------------------------------------------------------------
MYO5A_CHICK     ----------------------------------------------------------------------
MRCKB_HUMAN     ----------------------------------------------------------------------
LIPB2_HUMAN     ----------------------------------------------------------------------
GOGA5_MOUSE     ----------------------------------------------------------------------
GOGA5_HUMAN     ----------------------------------------------------------------------
GAS8_BOVIN      WEHEVLEQRFIKVQQERDDLY---HKFTSAILEVQQKAGFRNLVLERKVALVAAVEKKEVQFNEVLAASN
CENPF_HUMAN     GEHQLWKEQNLEL-----RNLTVELEQKIQVLQSKNASLQDTLEVLQSSYKNLENELELTKMD------K
BPA1_HUMAN      ----------------------------------------------------------------------
WAP_ARATH       ----------------------------------------------------------------------
TGO1_DROME      ----------------------------------------------------------------------
SOJO_XENLA      ----------------------------------------------------------------------
SLK19_YEAST     ----------------------------------------------------------------------
SETX_HUMAN      ----------------------------------------------------------------------
PMFBP_MOUSE     ----------------------------------------------------------------------
PLCB4_HUMAN     ----------------------------------------------------------------------
MYSA_DROME      ----------------------------------------------------------------------
MYS3_HYDAT      ----------------------------------------------------------------------
MRCKB_RAT       ----------------------------------------------------------------------
LVA_DROME       ----------------------------------------------------------------------
KTN1_MOUSE      ----------------------------------------------------------------------
KRT37_HUMAN     ----------------------------------------------------------------------
GOGA5_RAT       ----------------------------------------------------------------------
FKB15_MOUSE     ----------------------------------------------------------------------
EZRI_RABIT      ----------------------------------------------------------------------
CENPE_MOUSE     AQSSTLE------SREIEKLELTQ-----QLNENLKKITLDSLKIMDEA--LREERDQLRKSLQQTEARD


                         .         .         .         .         *         .         .:420
query           LAFAKNYNSASTNFGKAIDEIDKAIKRMEEVKKFLTTSENQLRLANNKLEDVSVKKLTRKNPTMKAKFEA
Y161_MYCPN      ASFSKTFTDLNKVFQNNIDELEKKLKAANELNSRLNNWEEKIRKFEFKLNKDIVKKL-------------
Y148_MYCGE      L--NEQFKQLKDNFTKTFLEIEKVCKSNLVDIETLEKAVVKLRVRNERVLDQLLNKWTKK----------
MYSP_DERFA      AAYAKNQRLIAELAQVRHDYEKRLAQKDEEIEALRKQYQIEIEQLNMRLAEAEA-KLKTEIARLKKKYQA
M12_STRPY       ----------------------------------------------------------------------
CLIP1_HUMAN     AEIMKMSGDNSSQLTKMNDELRLKERDVEELQLKLTKANENASFLQKSIEDMTV----------------
KINH_LOLPE      ----------------------------------------------------------------------
HMW2_MYCPN      -DKVHQFDENSLNISKKLAERELAIKFKE---KELEAAQKQLSLDNNNNAGLKLQKLSESLKTERLELEA
MYSP_SARSC      KA---NIDLQKTIKKQAL-QITELQAHYDEVHRQLQQAVDQLGVTQRRCQ--------------------
GCC2_MOUSE      LIQAEEEHNLVFEYDARVLELENKIKQCEELRTLVRDSEQEKILLRKELDAVTSAKLEMKNTNEKASLE-
PUMA_PARUN      QLVKEQLQYKSDEFHKALDELANAHRISEE----------------------------------------
KIF15_MOUSE     ----------------------------------------------------------------------
MLP1_YEAST      -GQVKTLNLSRDQLENALKENEKSWSSQKE------SLLEQLDLSNSRIEDLS-----------------
PIBF1_HUMAN     ----------------------------------------------------------------------
NUF1_YEAST      ----------------------------------------------------------------------
KTN1_CHICK      ISEVRELKDLLTELQKKLDDYSEAVRQNEELKMKLSETLSKLKVDQNERQKVA-----------------
GOGA4_HUMAN     ----------------------------------------------------------------------
CC150_MOUSE     LVAERKMRLELENRCKELEETIRHLKRCKE------ATENKLKEASVESEQITA-NLEEAHRWFKCRFDG
IFT81_HUMAN     ----------------------------------------------------------------------
CCD46_MOUSE     ----------------------------------------------------------------------
CCD46_HUMAN     ----------------------------------------------------------------------
SMC1A_MOUSE     ----------------------------------------------------------------------
KIF1_DICDI      ----------------------------------------------------------------------
TPM2_SCHMA      ----------------------------------------------------------------------
HMW2_MYCGE      KEFDKNKSRLYEYFRKMRDEIERKESQVKLVLKETQRKANLLEAQANKL-NIEKNTIDFKEKELKA----
CENPE_HUMAN     LKIQEELRIAHMHLKEQQETIDKLRGIVSEKTDKLSNMQKDLENSNAKLQE-------------------
SCLT1_RAT       ----------------------------------------------------------------------
NF70_LOLPE      ----------------------------------------------------------------------
NF60_LOLPE      ----------------------------------------------------------------------
HMW2_MYCGA      ----------------------------------------------------------------------
GCC2_HUMAN      XLQAVGESLAKINEEKCVLELEKEIKQCEELKSLLRDYEQEKVLLRKELEEIQSEKLEMKNANEKTRLE-
CP135_DANRE     ----------------------------------------------------------------------
ODFP2_MOUSE     ----------------------------------------------------------------------
MYO4_CAEEL      ----------------------------------------------------------------------
LRRF2_HUMAN     ----------------------------------------------------------------------
USO1_YEAST      ----------------------------------------------------------------------
SMC1A_XENLA     ----------------------------------------------------------------------
ODFP2_RAT       ----------------------------------------------------------------------
VPS60_YEAST     ----------------------------------------------------------------------
TUFT1_BOVIN     ----------------------------------------------------------------------
MAD1_KLULA      ----------------------------------------------------------------------
Y474_MYCPN      ----------------------------------------------------------------------
SPO15_SCHPO     QSFVNSYQSISNLYHELRDDMQSQNNTLLESESKLKTDCENLTQQNMTLID-NVQKLMHKHVNQESKVSE
RPGR1_HUMAN     ----------------------------------------------------------------------
ROCK2_BOVIN     ----------------------------------------------------------------------
MOES_LYTVA      ----------------------------------------------------------------------
LRRX1_DICDI     ----------------------------------------------------------------------
MAD1_YEAST      ----------------------------------------------------------------------
DYNA_NEUCR      ----------------------------------------------------------------------
CEP63_PONAB     ----------------------------------------------------------------------
CE164_HUMAN     ----------------------------------------------------------------------
SMC1A_RAT       ----------------------------------------------------------------------
SMC1A_HUMAN     ----------------------------------------------------------------------
SMC1A_BOVIN     ----------------------------------------------------------------------
RUD3_YEAST      ----------------------------------------------------------------------
ROCK2_MOUSE     ----------------------------------------------------------------------
NFM_RAT         ----------------------------------------------------------------------
MYSP_BLOTA      ----------------------------------------------------------------------
MLP2_YEAST      TLSEKEYQCSAV----IIDEFKDITKEVTQV---------NILKENNAILQKSLKNVTEKN---------
CN145_HUMAN     ----------------------------------------------------------------------
CLIP1_CHICK     ----------------------------------------------------------------------
Y4393_ANASP     ----------------------------------------------------------------------
SYA_NATTJ       ----------------------------------------------------------------------
NFM_MOUSE       ----------------------------------------------------------------------
MUKB_VIBCM      ----------------------------------------------------------------------
MUKB_VIBCH      ----------------------------------------------------------------------
GOGA1_HUMAN     ----------------------------------------------------------------------
DPY27_CAEEL     ----------------------------------------------------------------------
CEP63_DANRE     ----------------------------------------------------------------------
CCD41_RAT       ----------------------------------------------------------------------
CASP_PONAB      IQKAPDVEQAIEVLTRSSLEVELAAKEREIAQ--LVEDVQRLQASLTKLRENSAQQLSAKNSTLKQLEEK
CASP_HUMAN      IQKAPDVEQAIEVLTRSSLEVELAAKEREIAQ--LVEDVQRLQASLTKLRENSAQQLSAKNSTLKQLEEK
RS6_GLOVI       IYVQMNYDAPTT----AVAELEKAFRLSEEVIRFLTVRE-------------------------------
ROCK2_HUMAN     ----------------------------------------------------------------------
NUF2_YARLI      ----------------------------------------------------------------------
NFM_BOVIN       ----------------------------------------------------------------------
GOGA3_HUMAN     ----------------------------------------------------------------------
FHAD1_HUMAN     ----------------------------------------------------------------------
DCTN1_DROME     ----------------------------------------------------------------------
ANR24_MOUSE     ----------------------------------------------------------------------
RASEF_CAEEL     ----------------------------------------------------------------------
PCNT_MOUSE      ----------------------------------------------------------------------
NFM_PIG         ----------------------------------------------------------------------
NFM_HUMAN       ----------------------------------------------------------------------
MYO3_CAEBR      ----------------------------------------------------------------------
MUKB_VIBC3      ----------------------------------------------------------------------
LEKR1_HUMAN     ----------------------------------------------------------------------
HOOK_BRAFL      ----------------------------------------------------------------------
CEP63_HUMAN     ----------------------------------------------------------------------
CCD41_MOUSE     MAARRELQSTRLKLQQQIVNTEKAEKEKLENSELLTQSENDLLNSNHMLKDM-VERLKQECRNLRSQAE-
CASC4_CHICK     ----------------------------------------------------------------------
SLA2_YEAST      ----------------------------------------------------------------------
ROCK2_RAT       ----------------------------------------------------------------------
RBGP1_MOUSE     ----------------------------------------------------------------------
RASEF_HUMAN     ----------------------------------------------------------------------
RAD50_RAT       ----------------------------------------------------------------------
MYO3_CAEEL      ----------------------------------------------------------------------
MYH9_CHICK      ----------------------------------------------------------------------
BPS2_ACIAM      ----------------------------------------------------------------------
YL139_YARLI     ----------------------------------------------------------------------
MYSS_CYPCA      ----------------------------------------------------------------------
KI20B_MOUSE     ----------------------------------------------------------------------
GRDN_MOUSE      MRMAKELESEKEQLRKGLELMRASFKKTEEVSYQGLDTENQLENSNKKIQQLELQDLEMENQTLQKSLEE
CUX1_HUMAN      IQKAPDVEQAIEVLTRSSLEVELAAKEREIAQ--LVEDVQRLQASLTKLRENSAQQLSAKNSTLKQLEEK
ANT1_ONCVO      ----------------------------------------------------------------------
AN30A_HUMAN     ----------------------------------------------------------------------
NU211_SCHPO     ----------------------------------------------------------------------
NIN_MOUSE       ----------------------------------------------------------------------
MYSP_SCHJA      IRRAKSAESLASELQRRVDELTIEVNT-------LTSQNNQLESENMRLKSL-VNDLTDKNNALE-----
K2C78_HUMAN     ----------------------------------------------------------------------
GOGA1_MOUSE     ----------------------------------------------------------------------
CE290_BOVIN     ----------------------------------------------------------------------
TUFT1_PIG       ----------------------------------------------------------------------
SPDLY_MACFA     ----------------------------------------------------------------------
RASEF_MOUSE     ----------------------------------------------------------------------
RAD50_HALSA     ----------------------------------------------------------------------
MYO5A_CHICK     ----------------------------------------------------------------------
MRCKB_HUMAN     ----------------------------------------------------------------------
LIPB2_HUMAN     ----------------------------------------------------------------------
GOGA5_MOUSE     ----------------------------------------------------------------------
GOGA5_HUMAN     ----------------------------------------------------------------------
GAS8_BOVIN      LDPAA-LTLVSRKLEDVLESKNSAIKDLQELARVCKAHNDLLRTYEAKL---------------------
CENPF_HUMAN     MSFVEKVNKMTAKETELQREMHEMAQKTAELQEELSGEKNQLLLEEIKSSKDQLKELTLENSELKKSLDC
BPA1_HUMAN      ----------------------------------------------------------------------
WAP_ARATH       ----------------------------------------------------------------------
TGO1_DROME      ----------------------------------------------------------------------
SOJO_XENLA      ----------------------------------------------------------------------
SLK19_YEAST     ----------------------------------------------------------------------
SETX_HUMAN      ----------------------------------------------------------------------
PMFBP_MOUSE     ----------------------------------------------------------------------
PLCB4_HUMAN     ----------------------------------------------------------------------
MYSA_DROME      ----------------------------------------------------------------------
MYS3_HYDAT      ----------------------------------------------------------------------
MRCKB_RAT       ----------------------------------------------------------------------
LVA_DROME       ----------------------------------------------------------------------
KTN1_MOUSE      ----------------------------------------------------------------------
KRT37_HUMAN     ----------------------------------------------------------------------
GOGA5_RAT       ----------------------------------------------------------------------
FKB15_MOUSE     ----------------------------------------------------------------------
EZRI_RABIT      ----------------------------------------------------------------------
CENPE_MOUSE     LENQEKLRIAHMNLKEHQETIDRLMETMSEKTEEISNMKMELENVNMKLQEKVQELKTSERQRVKLKADA


                         .         .         +         .         .         .         .:490
query           LKGE
Y161_MYCPN      ----
Y148_MYCGE      ----
MYSP_DERFA      ----
M12_STRPY       ----
CLIP1_HUMAN     ----
KINH_LOLPE      ----
HMW2_MYCPN      SK--
MYSP_SARSC      ----
GCC2_MOUSE      ----
PUMA_PARUN      ----
KIF15_MOUSE     ----
MLP1_YEAST      ----
PIBF1_HUMAN     ----
NUF1_YEAST      ----
KTN1_CHICK      ----
GOGA4_HUMAN     ----
CC150_MOUSE     LQLE
IFT81_HUMAN     ----
CCD46_MOUSE     ----
CCD46_HUMAN     ----
SMC1A_MOUSE     ----
KIF1_DICDI      ----
TPM2_SCHMA      ----
HMW2_MYCGE      ----
CENPE_HUMAN     ----
SCLT1_RAT       ----
NF70_LOLPE      ----
NF60_LOLPE      ----
HMW2_MYCGA      ----
GCC2_HUMAN      ----
CP135_DANRE     ----
ODFP2_MOUSE     ----
MYO4_CAEEL      ----
LRRF2_HUMAN     ----
USO1_YEAST      ----
SMC1A_XENLA     ----
ODFP2_RAT       ----
VPS60_YEAST     ----
TUFT1_BOVIN     ----
MAD1_KLULA      ----
Y474_MYCPN      ----
SPO15_SCHPO     LK--
RPGR1_HUMAN     ----
ROCK2_BOVIN     ----
MOES_LYTVA      ----
LRRX1_DICDI     ----
MAD1_YEAST      ----
DYNA_NEUCR      ----
CEP63_PONAB     ----
CE164_HUMAN     ----
SMC1A_RAT       ----
SMC1A_HUMAN     ----
SMC1A_BOVIN     ----
RUD3_YEAST      ----
ROCK2_MOUSE     ----
NFM_RAT         ----
MYSP_BLOTA      ----
MLP2_YEAST      ----
CN145_HUMAN     ----
CLIP1_CHICK     ----
Y4393_ANASP     ----
SYA_NATTJ       ----
NFM_MOUSE       ----
MUKB_VIBCM      ----
MUKB_VIBCH      ----
GOGA1_HUMAN     ----
DPY27_CAEEL     ----
CEP63_DANRE     ----
CCD41_RAT       ----
CASP_PONAB      LKGQ
CASP_HUMAN      LKGQ
RS6_GLOVI       ----
ROCK2_HUMAN     ----
NUF2_YARLI      ----
NFM_BOVIN       ----
GOGA3_HUMAN     ----
FHAD1_HUMAN     ----
DCTN1_DROME     ----
ANR24_MOUSE     ----
RASEF_CAEEL     ----
PCNT_MOUSE      ----
NFM_PIG         ----
NFM_HUMAN       ----
MYO3_CAEBR      ----
MUKB_VIBC3      ----
LEKR1_HUMAN     ----
HOOK_BRAFL      ----
CEP63_HUMAN     ----
CCD41_MOUSE     ----
CASC4_CHICK     ----
SLA2_YEAST      ----
ROCK2_RAT       ----
RBGP1_MOUSE     ----
RASEF_HUMAN     ----
RAD50_RAT       ----
MYO3_CAEEL      ----
MYH9_CHICK      ----
BPS2_ACIAM      ----
YL139_YARLI     ----
MYSS_CYPCA      ----
KI20B_MOUSE     ----
GRDN_MOUSE      LK--
CUX1_HUMAN      LKGQ
ANT1_ONCVO      ----
AN30A_HUMAN     ----
NU211_SCHPO     ----
NIN_MOUSE       ----
MYSP_SCHJA      ----
K2C78_HUMAN     ----
GOGA1_MOUSE     ----
CE290_BOVIN     ----
TUFT1_PIG       ----
SPDLY_MACFA     ----
RASEF_MOUSE     ----
RAD50_HALSA     ----
MYO5A_CHICK     ----
MRCKB_HUMAN     ----
LIPB2_HUMAN     ----
GOGA5_MOUSE     ----
GOGA5_HUMAN     ----
GAS8_BOVIN      ----
CENPF_HUMAN     M---
BPA1_HUMAN      ----
WAP_ARATH       ----
TGO1_DROME      ----
SOJO_XENLA      ----
SLK19_YEAST     ----
SETX_HUMAN      ----
PMFBP_MOUSE     ----
PLCB4_HUMAN     ----
MYSA_DROME      ----
MYS3_HYDAT      ----
MRCKB_RAT       ----
LVA_DROME       ----
KTN1_MOUSE      ----
KRT37_HUMAN     ----
GOGA5_RAT       ----
FKB15_MOUSE     ----
EZRI_RABIT      ----
CENPE_MOUSE     ----