[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for spne4:ACF56069.1

[Show Plain Result]


## Summary of Sequence Search
    1::335
    1::335       0.0 100%  335 aa  K6PF_STRPI RecName: Full=6-phosphofructokinase;       
    1::335       0.0 100%  335 aa  K6PF_STRP7 RecName: Full=6-phosphofructokinase;       
    1::335       0.0 100%  335 aa  K6PF_STRP4 RecName: Full=6-phosphofructokinase;       
    1::335       0.0 100%  335 aa  K6PF_STRZT RecName: Full=6-phosphofructokinase;       
    1::335       0.0 100%  335 aa  K6PF_STRZP RecName: Full=6-phosphofructokinase;       
    1::335       0.0 100%  335 aa  K6PF_STRZJ RecName: Full=6-phosphofructokinase;       
    1::335       0.0 100%  335 aa  K6PF_STRPN RecName: Full=6-phosphofructokinase;       
    1::335       0.0 100%  335 aa  K6PF_STRPJ RecName: Full=6-phosphofructokinase;       
    1::335       0.0  99%  335 aa  K6PF_STRPS RecName: Full=6-phosphofructokinase;       
    1::335     e-179  99%  335 aa  K6PF_STRR6 RecName: Full=6-phosphofructokinase;       
    1::335     e-179  99%  335 aa  K6PF_STRP2 RecName: Full=6-phosphofructokinase;       
    1::335     e-167  92%  336 aa  K6PF_STRGC RecName: Full=6-phosphofructokinase;       
    1::335     e-167  91%  336 aa  K6PF_STRSV RecName: Full=6-phosphofructokinase;       
    1::335     e-160  87%  336 aa  K6PF_STRSY RecName: Full=6-phosphofructokinase;       
    1::336     e-144  79%  337 aa  K6PF_STRPZ RecName: Full=6-phosphofructokinase;       
    1::336     e-144  79%  337 aa  K6PF_STRPM RecName: Full=6-phosphofructokinase;       
    1::336     e-144  79%  337 aa  K6PF_STRPG RecName: Full=6-phosphofructokinase;       
    1::336     e-144  79%  337 aa  K6PF_STRPD RecName: Full=6-phosphofructokinase;       
    1::336     e-144  79%  337 aa  K6PF_STRPC RecName: Full=6-phosphofructokinase;       
    1::336     e-144  79%  337 aa  K6PF_STRPB RecName: Full=6-phosphofructokinase;       
    1::336     e-144  79%  337 aa  K6PF_STRP8 RecName: Full=6-phosphofructokinase;       
    1::336     e-144  79%  337 aa  K6PF_STRP6 RecName: Full=6-phosphofructokinase;       
    1::336     e-144  79%  337 aa  K6PF_STRP1 RecName: Full=6-phosphofructokinase;       
    1::336     e-143  79%  337 aa  K6PF_STRP3 RecName: Full=6-phosphofructokinase;       
    1::336     e-143  79%  339 aa  K6PF_STRTR RecName: Full=6-phosphofructokinase;       
    1::336     e-143  79%  339 aa  K6PF_STRTD RecName: Full=6-phosphofructokinase;       
    1::336     e-143  79%  337 aa  K6PF_STRS7 RecName: Full=6-phosphofructokinase;       
    1::336     e-143  79%  337 aa  K6PF_STRPF RecName: Full=6-phosphofructokinase;       
    1::336     e-142  79%  337 aa  K6PF_STREM RecName: Full=6-phosphofructokinase;       
    1::336     e-142  79%  337 aa  K6PF_STRE4 RecName: Full=6-phosphofructokinase;       
    1::322     e-142  80%  340 aa  K6PF_STRA5 RecName: Full=6-phosphofructokinase;       
    1::322     e-142  80%  340 aa  K6PF_STRA3 RecName: Full=6-phosphofructokinase;       
    1::322     e-142  80%  340 aa  K6PF_STRA1 RecName: Full=6-phosphofructokinase;       
    1::336     e-140  76%  337 aa  K6PF_STRMU RecName: Full=6-phosphofructokinase;       
    1::336     e-140  76%  337 aa  K6PF_STRU0 RecName: Full=6-phosphofructokinase;       
    1::326     e-132  77%  340 aa  K6PF_LACLS RecName: Full=6-phosphofructokinase;       
    1::326     e-132  77%  340 aa  K6PF_LACLM RecName: Full=6-phosphofructokinase;       
    1::326     e-132  77%  340 aa  K6PF_LACLA RecName: Full=6-phosphofructokinase;       
    1::319     e-111  64%  320 aa  K6PF_ENTFA RecName: Full=6-phosphofructokinase;       
    1::297     e-111  66%  319 aa  K6PF_ANOFW RecName: Full=6-phosphofructokinase;       
    1::296     e-110  67%  319 aa  K6PF_LISW6 RecName: Full=6-phosphofructokinase;       
    1::296     e-110  67%  319 aa  K6PF_LISMO RecName: Full=6-phosphofructokinase;       
    1::296     e-110  67%  319 aa  K6PF_LISMF RecName: Full=6-phosphofructokinase;       
    1::296     e-110  67%  319 aa  K6PF_LISMC RecName: Full=6-phosphofructokinase;       
    1::296     e-110  67%  319 aa  K6PF_LISIN RecName: Full=6-phosphofructokinase;       
    1::296     e-110  67%  319 aa  K6PF_LISMH RecName: Full=6-phosphofructokinase;       
    1::296     e-109  65%  319 aa  K6PF_GEOKA RecName: Full=6-phosphofructokinase;       
    1::318     e-109  63%  319 aa  K6PF_BACST RecName: Full=6-phosphofructokinase;       
    1::318     e-107  62%  319 aa  K6PF_BACCN RecName: Full=6-phosphofructokinase;       
    1::301     e-106  63%  319 aa  K6PF_BACSU RecName: Full=6-phosphofructokinase;       
    1::302     e-106  62%  319 aa  K6PF_BACLD RecName: Full=6-phosphofructokinase;       
    1::297     e-106  64%  319 aa  K6PF_BACWK RecName: Full=6-phosphofructokinase;       
    1::297     e-106  64%  319 aa  K6PF_BACHK RecName: Full=6-phosphofructokinase;       
    1::297     e-106  64%  319 aa  K6PF_BACCZ RecName: Full=6-phosphofructokinase;       
    1::297     e-106  64%  319 aa  K6PF_BACCQ RecName: Full=6-phosphofructokinase;       
    1::297     e-106  64%  319 aa  K6PF_BACCE RecName: Full=6-phosphofructokinase;       
    1::297     e-106  64%  319 aa  K6PF_BACC7 RecName: Full=6-phosphofructokinase;       
    1::297     e-106  64%  319 aa  K6PF_BACC3 RecName: Full=6-phosphofructokinase;       
    1::297     e-106  64%  319 aa  K6PF_BACC1 RecName: Full=6-phosphofructokinase;       
    1::297     e-106  64%  319 aa  K6PF_BACC0 RecName: Full=6-phosphofructokinase;       
    1::297     e-106  64%  319 aa  K6PF_BACAN RecName: Full=6-phosphofructokinase;       
    1::297     e-106  64%  319 aa  K6PF_BACAH RecName: Full=6-phosphofructokinase;       
    1::297     e-106  64%  319 aa  K6PF_BACAC RecName: Full=6-phosphofructokinase;       
    1::297     e-106  64%  319 aa  K6PF_BACAA RecName: Full=6-phosphofructokinase;       
    1::301     e-106  62%  319 aa  K6PF_BACA2 RecName: Full=6-phosphofructokinase;       
    1::318     e-105  61%  319 aa  K6PF_BACHD RecName: Full=6-phosphofructokinase;       
    1::297     e-105  64%  319 aa  K6PF_BACC4 RecName: Full=6-phosphofructokinase;       
    1::297     e-105  64%  319 aa  K6PF_BACC2 RecName: Full=6-phosphofructokinase;       
    1::297     e-104  63%  319 aa  K6PF_BACCR RecName: Full=6-phosphofructokinase;       
    1::318     e-104  61%  319 aa  K6PF_GEOSW RecName: Full=6-phosphofructokinase;       
    1::297     e-103  62%  319 aa  K6PF_BACP2 RecName: Full=6-phosphofructokinase;       
    1::318     e-102  60%  319 aa  K6PF_LACGA RecName: Full=6-phosphofructokinase;       
    1::318     e-102  60%  319 aa  K6PF_LACJO RecName: Full=6-phosphofructokinase;       
    1::296     e-101  60%  319 aa  K6PF_LACCB RecName: Full=6-phosphofructokinase;       
    1::296     e-101  60%  319 aa  K6PF_LACC3 RecName: Full=6-phosphofructokinase;       
    1::315     e-100  57%  320 aa  K6PF_LACS1 RecName: Full=6-phosphofructokinase;       
    1::321     6e-99  59%  322 aa  K6PF_PEDPA RecName: Full=6-phosphofructokinase;       
    1::318     2e-96  61%  319 aa  K6PF_LACDE RecName: Full=6-phosphofructokinase;       
    1::318     4e-96  61%  320 aa  K6PF_LACAC RecName: Full=6-phosphofructokinase;       
    1::318     8e-96  58%  319 aa  K6PF_BACSK RecName: Full=6-phosphofructokinase;       
    1::318     1e-95  57%  319 aa  K6PF_BACSH RecName: Full=6-phosphofructokinase;       
    1::297     5e-95  63%  320 aa  K6PF_LACH4 RecName: Full=6-phosphofructokinase;       
    2::302     3e-91  55%  320 aa  K6PF_SERP5 RecName: Full=6-phosphofructokinase;       
    2::302     1e-90  55%  320 aa  K6PF_VIBPA RecName: Full=6-phosphofructokinase;       
    2::302     1e-90  55%  320 aa  K6PF_VIBCH RecName: Full=6-phosphofructokinase;       
    1::318     2e-90  53%  320 aa  K6PF_LACPL RecName: Full=6-phosphofructokinase;       
    2::302     7e-90  55%  320 aa  K6PF_PECCP RecName: Full=6-phosphofructokinase;       
    2::302     1e-89  55%  320 aa  K6PF_ERWCT RecName: Full=6-phosphofructokinase;       
    2::302     4e-89  53%  320 aa  K6PF_EDWI9 RecName: Full=6-phosphofructokinase;       
    2::302     6e-89  55%  320 aa  K6PF_VIBVY RecName: Full=6-phosphofructokinase;       
    2::302     6e-89  55%  320 aa  K6PF_VIBVU RecName: Full=6-phosphofructokinase;       
    1::297     1e-88  54%  322 aa  K6PF_STAES RecName: Full=6-phosphofructokinase;       
    1::297     1e-88  54%  322 aa  K6PF_STAEQ RecName: Full=6-phosphofructokinase;       
    2::302     1e-88  53%  320 aa  K6PF_PHOPR RecName: Full=6-phosphofructokinase;       
    1::295     2e-88  59%  322 aa  K6PF_STACT RecName: Full=6-phosphofructokinase;       
    1::291     8e-88  56%  319 aa  K6PF_MACCJ RecName: Full=6-phosphofructokinase;       
    1::321     7e-87  53%  322 aa  K6PF_STAAW RecName: Full=6-phosphofructokinase;       
    1::321     7e-87  53%  322 aa  K6PF_STAAT RecName: Full=6-phosphofructokinase;       
    1::321     7e-87  53%  322 aa  K6PF_STAAS RecName: Full=6-phosphofructokinase;       
    1::321     7e-87  53%  322 aa  K6PF_STAAR RecName: Full=6-phosphofructokinase;       
    1::321     7e-87  53%  322 aa  K6PF_STAAN RecName: Full=6-phosphofructokinase;       
    1::321     7e-87  53%  322 aa  K6PF_STAAM RecName: Full=6-phosphofructokinase;       
    1::321     7e-87  53%  322 aa  K6PF_STAAE RecName: Full=6-phosphofructokinase;       
    1::321     7e-87  53%  322 aa  K6PF_STAAC RecName: Full=6-phosphofructokinase;       
    1::321     7e-87  53%  322 aa  K6PF_STAAB RecName: Full=6-phosphofructokinase;       
    1::321     7e-87  53%  322 aa  K6PF_STAA9 RecName: Full=6-phosphofructokinase;       
    1::321     7e-87  53%  322 aa  K6PF_STAA2 RecName: Full=6-phosphofructokinase;       
    1::293     9e-87  55%  319 aa  K6PF_OCEIH RecName: Full=6-phosphofructokinase;       
    1::292     2e-86  57%  319 aa  K6PF_NATTJ RecName: Full=6-phosphofructokinase;       
    2::299     6e-85  53%  321 aa  K6PF_HAEI8 RecName: Full=6-phosphofructokinase;       
    2::299     4e-84  53%  321 aa  K6PF_HAEIN RecName: Full=6-phosphofructokinase;       
    2::299     4e-84  53%  321 aa  K6PF_HAEIE RecName: Full=6-phosphofructokinase;       
    2::297     4e-84  53%  320 aa  K6PF_BUCAT RecName: Full=6-phosphofructokinase;       
    2::297     4e-84  53%  320 aa  K6PF_BUCAI RecName: Full=6-phosphofructokinase;       
    2::297     4e-84  53%  320 aa  K6PF_BUCA5 RecName: Full=6-phosphofructokinase;       
    2::299     2e-83  52%  321 aa  K6PF_HAEPS RecName: Full=6-phosphofructokinase;       
    2::299     2e-83  53%  321 aa  K6PF_ACTSZ RecName: Full=6-phosphofructokinase;       
    2::302     2e-83  52%  320 aa  K6PF_TOLAT RecName: Full=6-phosphofructokinase;       
    5::302     2e-83  51%  324 aa  K6PF_HAEDU RecName: Full=6-phosphofructokinase;       
    2::297     3e-83  53%  320 aa  K6PF_BUCAP RecName: Full=6-phosphofructokinase;       
    2::302     6e-83  53%  320 aa  K6PF_KLEP7 RecName: Full=6-phosphofructokinase;       
    2::302     6e-83  53%  320 aa  K6PF_KLEP3 RecName: Full=6-phosphofructokinase;       
    2::302     1e-82  52%  320 aa  K6PF_ENTS8 RecName: Full=6-phosphofructokinase;       
    2::302     1e-82  49%  320 aa  K6PF_TERTT RecName: Full=6-phosphofructokinase;       
    2::302     2e-82  53%  320 aa  K6PF_ENTCL RecName: Full=6-phosphofructokinase;       
    2::299     3e-82  52%  321 aa  K6PF_MANSM RecName: Full=6-phosphofructokinase;       
    2::302     4e-82  53%  320 aa  K6PF_ESCF3 RecName: Full=6-phosphofructokinase;       
    5::302     4e-82  49%  324 aa  K6PF_ACTPJ RecName: Full=6-phosphofructokinase;       
    5::302     4e-82  49%  324 aa  K6PF_ACTP7 RecName: Full=6-phosphofructokinase;       
    5::302     4e-82  49%  324 aa  K6PF_ACTP2 RecName: Full=6-phosphofructokinase;       
    2::299     7e-82  51%  321 aa  K6PF_PASMU RecName: Full=6-phosphofructokinase;       
    2::302     7e-82  53%  320 aa  K6PF_ECO27 RecName: Full=6-phosphofructokinase;       
    2::302     7e-82  53%  320 aa  K6PF1_ECOL6 RecName: Full=6-phosphofructokinase;       
    2::302     1e-81  53%  320 aa  K6PF_SHISS RecName: Full=6-phosphofructokinase;       
    2::302     1e-81  53%  320 aa  K6PF_SHIDS RecName: Full=6-phosphofructokinase;       
    2::302     1e-81  53%  320 aa  K6PF_SHIBS RecName: Full=6-phosphofructokinase;       
    2::302     1e-81  53%  320 aa  K6PF_SHIB3 RecName: Full=6-phosphofructokinase;       
    2::299     1e-81  51%  321 aa  K6PF_HAES2 RecName: Full=6-phosphofructokinase;       
    2::299     1e-81  51%  321 aa  K6PF_HAES1 RecName: Full=6-phosphofructokinase;       
    2::302     1e-81  53%  320 aa  K6PF_ECOSM RecName: Full=6-phosphofructokinase;       
    2::302     1e-81  53%  320 aa  K6PF_ECOSE RecName: Full=6-phosphofructokinase;       
    2::302     1e-81  53%  320 aa  K6PF_ECOLU RecName: Full=6-phosphofructokinase;       
    2::302     1e-81  53%  320 aa  K6PF_ECOLC RecName: Full=6-phosphofructokinase;       
    2::302     1e-81  53%  320 aa  K6PF_ECOL5 RecName: Full=6-phosphofructokinase;       
    2::302     1e-81  53%  320 aa  K6PF_ECOHS RecName: Full=6-phosphofructokinase;       
    2::302     1e-81  53%  320 aa  K6PF_ECODH RecName: Full=6-phosphofructokinase;       
    2::302     1e-81  53%  320 aa  K6PF_ECOBW RecName: Full=6-phosphofructokinase;       
    2::302     1e-81  53%  320 aa  K6PF_ECO8A RecName: Full=6-phosphofructokinase;       
    2::302     1e-81  53%  320 aa  K6PF_ECO81 RecName: Full=6-phosphofructokinase;       
    2::302     1e-81  53%  320 aa  K6PF_ECO7I RecName: Full=6-phosphofructokinase;       
    2::302     1e-81  53%  320 aa  K6PF_ECO5E RecName: Full=6-phosphofructokinase;       
    2::302     1e-81  53%  320 aa  K6PF_ECO55 RecName: Full=6-phosphofructokinase;       
    2::302     1e-81  53%  320 aa  K6PF_ECO45 RecName: Full=6-phosphofructokinase;       
    2::302     1e-81  53%  320 aa  K6PF_ECO24 RecName: Full=6-phosphofructokinase;       
    2::302     1e-81  53%  320 aa  K6PF1_SHIFL RecName: Full=6-phosphofructokinase isozyme 1;       
    2::302     1e-81  53%  320 aa  K6PF1_ECOLI RecName: Full=6-phosphofructokinase isozyme 1;       
    2::302     1e-81  53%  320 aa  K6PF1_ECO57 RecName: Full=6-phosphofructokinase isozyme 1;       
    2::302     1e-81  51%  320 aa  K6PF_VIBFM RecName: Full=6-phosphofructokinase;       
    2::302     1e-81  51%  320 aa  K6PF_VIBF1 RecName: Full=6-phosphofructokinase;       
    2::302     3e-81  53%  320 aa  K6PF_SALTY RecName: Full=6-phosphofructokinase;       
    2::302     3e-81  53%  320 aa  K6PF_SALTI RecName: Full=6-phosphofructokinase;       
    2::302     3e-81  53%  320 aa  K6PF_SALSV RecName: Full=6-phosphofructokinase;       
    2::302     3e-81  53%  320 aa  K6PF_SALPK RecName: Full=6-phosphofructokinase;       
    2::302     3e-81  53%  320 aa  K6PF_SALPC RecName: Full=6-phosphofructokinase;       
    2::302     3e-81  53%  320 aa  K6PF_SALPB RecName: Full=6-phosphofructokinase;       
    2::302     3e-81  53%  320 aa  K6PF_SALPA RecName: Full=6-phosphofructokinase;       
    2::302     3e-81  53%  320 aa  K6PF_SALNS RecName: Full=6-phosphofructokinase;       
    2::302     3e-81  53%  320 aa  K6PF_SALHS RecName: Full=6-phosphofructokinase;       
    2::302     3e-81  53%  320 aa  K6PF_SALEP RecName: Full=6-phosphofructokinase;       
    2::302     3e-81  53%  320 aa  K6PF_SALDC RecName: Full=6-phosphofructokinase;       
    2::302     3e-81  53%  320 aa  K6PF_SALCH RecName: Full=6-phosphofructokinase;       
    2::302     3e-81  53%  320 aa  K6PF_SALAR RecName: Full=6-phosphofructokinase;       
    2::302     3e-81  53%  320 aa  K6PF_SALA4 RecName: Full=6-phosphofructokinase;       
    2::302     3e-81  52%  320 aa  K6PF_ENT38 RecName: Full=6-phosphofructokinase;       
    2::302     3e-81  52%  320 aa  K6PF_CITK8 RecName: Full=6-phosphofructokinase;       
    2::302     3e-81  53%  320 aa  K6PF_SALG2 RecName: Full=6-phosphofructokinase;       
    3::295     3e-81  56%  322 aa  K6PF_BACMC RecName: Full=6-phosphofructokinase;       
    1::298     4e-81  54%  321 aa  K6PF_THETN RecName: Full=6-phosphofructokinase;       
    1::296     4e-81  56%  319 aa  K6PF_CLONN RecName: Full=6-phosphofructokinase;       
    2::302     6e-81  51%  320 aa  K6PF_ALISL RecName: Full=6-phosphofructokinase;       
    2::302     1e-80  51%  320 aa  K6PF_SODGM RecName: Full=6-phosphofructokinase;       
    1::296     3e-80  56%  319 aa  K6PF_CLOBL RecName: Full=6-phosphofructokinase;       
    1::296     3e-80  56%  319 aa  K6PF_CLOBK RecName: Full=6-phosphofructokinase;       
    1::296     3e-80  56%  319 aa  K6PF_CLOBJ RecName: Full=6-phosphofructokinase;       
    1::296     3e-80  56%  319 aa  K6PF_CLOBH RecName: Full=6-phosphofructokinase;       
    1::296     3e-80  56%  319 aa  K6PF_CLOB1 RecName: Full=6-phosphofructokinase;       
    2::297     3e-80  50%  320 aa  K6PF_BAUCH RecName: Full=6-phosphofructokinase;       
    2::302     4e-80  51%  320 aa  K6PF_ERWT9 RecName: Full=6-phosphofructokinase;       
    1::296     8e-80  55%  319 aa  K6PF_CLOBM RecName: Full=6-phosphofructokinase;       
    1::296     8e-80  55%  319 aa  K6PF_CLOB6 RecName: Full=6-phosphofructokinase;       
    1::305     1e-79  58%  332 aa  K6PF_HALOH RecName: Full=6-phosphofructokinase;       
    1::297     1e-79  51%  320 aa  K6PF_CLOBB RecName: Full=6-phosphofructokinase;       
    1::310     2e-79  50%  319 aa  K6PF_CLOD6 RecName: Full=6-phosphofructokinase;       
    1::296     2e-79  51%  319 aa  K6PF_ALKOO RecName: Full=6-phosphofructokinase;       
    2::302     3e-79  51%  320 aa  K6PF_VIBHB RecName: Full=6-phosphofructokinase;       
    1::296     4e-79  52%  319 aa  K6PF_CLOTE RecName: Full=6-phosphofructokinase;       
    2::297     6e-78  49%  320 aa  K6PF_BLOFL RecName: Full=6-phosphofructokinase;       
    1::293     1e-77  51%  319 aa  K6PF_BREBN RecName: Full=6-phosphofructokinase;       
    1::279     3e-77  53%  320 aa  K6PF_CLOBA RecName: Full=6-phosphofructokinase;       
    1::296     1e-76  55%  319 aa  K6PF_ALKMQ RecName: Full=6-phosphofructokinase;       
    1::296     2e-75  49%  319 aa  K6PF1_CLOPE RecName: Full=6-phosphofructokinase 1;       
    1::298     2e-75  51%  321 aa  K6PF_THEPX RecName: Full=6-phosphofructokinase;       
    1::298     2e-75  51%  321 aa  K6PF_THEP3 RecName: Full=6-phosphofructokinase;       
    2::297     2e-75  48%  320 aa  K6PF_BUCBP RecName: Full=6-phosphofructokinase;       
    1::296     3e-75  52%  319 aa  K6PF_FINM2 RecName: Full=6-phosphofructokinase;       
    3::298     5e-74  50%  322 aa  K6PF_FUSNN RecName: Full=6-phosphofructokinase;       
    2::306     1e-73  55%  331 aa  K6PF_YERE8 RecName: Full=6-phosphofructokinase;       
    1::296     2e-72  49%  319 aa  K6PF_CLOAB RecName: Full=6-phosphofructokinase;       
    9::312     6e-72  52%  329 aa  K6PF_DEIRA RecName: Full=6-phosphofructokinase;       
    2::302     1e-71  55%  327 aa  K6PF_YERPP RecName: Full=6-phosphofructokinase;       
    2::302     1e-71  55%  327 aa  K6PF_YERPN RecName: Full=6-phosphofructokinase;       
    2::302     1e-71  55%  327 aa  K6PF_YERPG RecName: Full=6-phosphofructokinase;       
    2::302     1e-71  55%  327 aa  K6PF_YERPE RecName: Full=6-phosphofructokinase;       
    2::302     1e-71  55%  327 aa  K6PF_YERPA RecName: Full=6-phosphofructokinase;       
    2::302     1e-71  55%  327 aa  K6PF_YERP3 RecName: Full=6-phosphofructokinase;       
    2::302     2e-71  54%  327 aa  K6PF_YERPY RecName: Full=6-phosphofructokinase;       
    2::302     2e-71  54%  327 aa  K6PF_YERPS RecName: Full=6-phosphofructokinase;       
    2::302     2e-71  54%  327 aa  K6PF_YERPB RecName: Full=6-phosphofructokinase;       
    2::302     4e-71  49%  327 aa  K6PF_HAMD5 RecName: Full=6-phosphofructokinase;       
    1::303     3e-70  48%  328 aa  K6PF_CYTH3 RecName: Full=6-phosphofructokinase;       
    2::302     6e-70  48%  326 aa  K6PF_MYCCT RecName: Full=6-phosphofructokinase;       
    1::301     2e-69  49%  324 aa  K6PF_PERMH RecName: Full=6-phosphofructokinase;       
    1::298     5e-69  52%  319 aa  K6PF_THENN RecName: Full=6-phosphofructokinase;       
    1::270     1e-68  52%  322 aa  K6PF_THET2 RecName: Full=6-phosphofructokinase;       
    1::270     1e-68  52%  322 aa  K6PF1_THET8 RecName: Full=6-phosphofructokinase isozyme 1;       
    4::302     5e-66  45%  326 aa  K6PF2_BACTN RecName: Full=6-phosphofructokinase 2;       
    1::301     9e-66  46%  324 aa  K6PF_SULSY RecName: Full=6-phosphofructokinase;       
    4::301     5e-64  48%  326 aa  K6PF_COXBU RecName: Full=6-phosphofructokinase;       
    2::281     6e-64  53%  321 aa  K6PF_AQUAE RecName: Full=6-phosphofructokinase;       
    2::282     1e-63  43%  320 aa  K6PF_BUCCC RecName: Full=6-phosphofructokinase;       
    2::300     1e-63  42%  326 aa  K6PF_MYCPU RecName: Full=6-phosphofructokinase;       
    1::298     2e-62  48%  319 aa  K6PF_THESQ RecName: Full=6-phosphofructokinase;       
    1::298     2e-62  48%  319 aa  K6PF_THEP1 RecName: Full=6-phosphofructokinase;       
    4::305     2e-62  43%  327 aa  K6PF1_BACTN RecName: Full=6-phosphofructokinase 1;       
    1::298     3e-62  48%  319 aa  K6PF_THEMA RecName: Full=6-phosphofructokinase;       
    3::299     1e-57  43%  325 aa  K6PF_MYCMO RecName: Full=6-phosphofructokinase;       
    3::309     2e-57  41%  322 aa  K6PF_MYCH7 RecName: Full=6-phosphofructokinase;       
    3::293     3e-57  41%  322 aa  K6PF_MYCH2 RecName: Full=6-phosphofructokinase;       
    3::293     6e-57  40%  322 aa  K6PF_MYCHJ RecName: Full=6-phosphofructokinase;       
    2::299     2e-56  39%  327 aa  K6PF_SPICI RecName: Full=6-phosphofructokinase;       
    2::310     3e-56  44%  341 aa  K6PF3_STRCO RecName: Full=6-phosphofructokinase 3;       
    6::325     6e-56  43%  356 aa  K6PF_CHLSY RecName: Full=6-phosphofructokinase;       
    6::325     6e-56  44%  356 aa  K6PF_CHLAD RecName: Full=6-phosphofructokinase;       
    6::325     6e-56  43%  356 aa  K6PF_CHLAA RecName: Full=6-phosphofructokinase;       
    2::325     5e-55  41%  341 aa  K6PF2_STRCO RecName: Full=6-phosphofructokinase 2;       
    2::319     3e-54  43%  342 aa  K6PF1_STRCO RecName: Full=6-phosphofructokinase 1;       
    2::314     3e-54  43%  341 aa  PFP_AMYME RecName: Full=Pyrophosphate--fructose 6-phosphate
    2::314     1e-53  42%  341 aa  PFP_AMYMD RecName: Full=Pyrophosphate--fructose 6-phosphate
   16::322     1e-52  48%  775 aa  K6PF2_ASPOR RecName: Full=6-phosphofructokinase subunit beta;      
    2::326     2e-52  37%  336 aa  K6PF3_BACTN RecName: Full=6-phosphofructokinase 3;       
    5::332     4e-52  41%  366 aa  K6PF2_CLOPE RecName: Full=6-phosphofructokinase 2;       
   18::355     9e-52  43%  788 aa  K6PF_DROME RecName: Full=6-phosphofructokinase;       
    5::327     2e-51  39%  346 aa  PFP_DICTH RecName: Full=Pyrophosphate--fructose 6-phosphate
    5::318     5e-51  42%  346 aa  K6PF_COREF RecName: Full=6-phosphofructokinase;       
   25::335     1e-50  46%  784 aa  K6PP_HUMAN RecName: Full=6-phosphofructokinase type C;       
    2::320     3e-50  41%  343 aa  K6PF_MYCTU RecName: Full=6-phosphofructokinase;       
    2::320     3e-50  41%  343 aa  K6PF_MYCBO RecName: Full=6-phosphofructokinase;       
   25::335     4e-50  46%  791 aa  K6PP_RABIT RecName: Full=6-phosphofructokinase type C;       
   25::335     4e-50  46%  784 aa  K6PP_PONAB RecName: Full=6-phosphofructokinase type C;       
   20::328     5e-50  47%  781 aa  K6PF_SCHMA RecName: Full=6-phosphofructokinase;       
   16::327     7e-50  45%  780 aa  K6PF_HUMAN RecName: Full=6-phosphofructokinase, muscle type;       
   16::327     1e-49  45%  782 aa  K6PF_CANFA RecName: Full=6-phosphofructokinase, muscle type;       
   16::327     1e-49  45%  780 aa  K6PF_MOUSE RecName: Full=6-phosphofructokinase, muscle type;       
   16::327     2e-49  46%  780 aa  K6PF_RABIT RecName: Full=6-phosphofructokinase, muscle type;       
   15::326     6e-49  45%  779 aa  K6PF_BOVIN RecName: Full=6-phosphofructokinase, muscle type;       
   24::357     7e-49  43%  784 aa  K6PP_MOUSE RecName: Full=6-phosphofructokinase type C;       
   16::327     7e-49  45%  780 aa  K6PF_PIG RecName: Full=6-phosphofructokinase, muscle type;       
    2::320     7e-49  41%  343 aa  K6PF_MYCLE RecName: Full=6-phosphofructokinase;       
   16::327     1e-48  44%  780 aa  K6PF_RAT RecName: Full=6-phosphofructokinase, muscle type;       
   16::327     1e-48  44%  780 aa  K6PF_PONAB RecName: Full=6-phosphofructokinase, muscle type;       
   16::327     1e-48  44%  780 aa  K6PF_MACFA RecName: Full=6-phosphofructokinase, muscle type;       
   16::326     2e-48  45%  780 aa  K6PF_HORSE RecName: Full=6-phosphofructokinase, muscle type;       
   25::358     6e-48  42%  788 aa  K6PP_RAT RecName: Full=6-phosphofructokinase type C;       
   52::385     6e-48  40%  834 aa  K6PF_DICDI RecName: Full=6-phosphofructokinase;       
    1::286     8e-48  38%  319 aa  K6PF_SULDN RecName: Full=6-phosphofructokinase;       
   14::352     1e-47  42%  783 aa  K6PF_ASPNG RecName: Full=6-phosphofructokinase;       
    1::280     2e-47  42%  327 aa  K6PF_SULNB RecName: Full=6-phosphofructokinase;       
  206::539     2e-47  43%  987 aa  K6PF1_YEAST RecName: Full=6-phosphofructokinase subunit alpha;     
   14::348     4e-47  42%  785 aa  K6PF1_ASPOR RecName: Full=6-phosphofructokinase subunit alpha;     
   14::353     9e-47  42%  808 aa  K6PF_ASPFU RecName: Full=6-phosphofructokinase;       
  228::566     2e-46  40%  987 aa  K6PF1_CANAL RecName: Full=6-phosphofructokinase subunit alpha;     
    6::319     3e-46  41%  369 aa  K6PF_THEEB RecName: Full=6-phosphofructokinase;       
   16::315     1e-45  45%  780 aa  K6PL_PONAB RecName: Full=6-phosphofructokinase, liver type;        
    1::316     2e-45  35%  322 aa  K6PF_MYCPE RecName: Full=6-phosphofructokinase;       
  183::518     4e-45  43%  946 aa  K6PF2_CANAL RecName: Full=6-phosphofructokinase subunit beta;      
   16::326     6e-45  44%  780 aa  K6PL_RAT RecName: Full=6-phosphofructokinase, liver type;       
   16::326     8e-45  44%  780 aa  K6PL_MOUSE RecName: Full=6-phosphofructokinase, liver type;        
    5::318     1e-44  39%  346 aa  K6PF_CORGL RecName: Full=6-phosphofructokinase;       
  212::561     1e-44  38%  990 aa  K6PF1_PICPA RecName: Full=6-phosphofructokinase;       
    7::294     3e-44  33%  328 aa  K6PF_MYCPN RecName: Full=6-phosphofructokinase;       
  184::517     5e-44  39%  992 aa  K6PF1_KLULA RecName: Full=6-phosphofructokinase subunit alpha;     
  176::515     1e-43  40%  938 aa  K6PF2_KLULA RecName: Full=6-phosphofructokinase subunit beta;      
   34::341     2e-43  42%  789 aa  K6PF_HAECO RecName: Full=6-phosphofructokinase;       
    2::285     4e-43  35%  319 aa  K6PF_WOLSU RecName: Full=6-phosphofructokinase;       
  197::532     4e-43  40%  959 aa  K6PF2_YEAST RecName: Full=6-phosphofructokinase subunit beta;      
   16::326     8e-43  43%  780 aa  K6PL_HUMAN RecName: Full=6-phosphofructokinase, liver type;        
   16::326     7e-42  43%  780 aa  K6PL_BOVIN RecName: Full=6-phosphofructokinase, liver type;        
   13::320     9e-42  39%  756 aa  K6PF_CAEEL RecName: Full=Probable 6-phosphofructokinase;       
  184::489     2e-40  40%  953 aa  K6PF1_YARLI RecName: Full=6-phosphofructokinase subunit alpha;     
  195::501     1e-39  38%  942 aa  K6PF_SCHPO RecName: Full=6-phosphofructokinase;       
    1::296     1e-38  30%  323 aa  K6PF_MYCGE RecName: Full=6-phosphofructokinase;       
    3::343     1e-34  34%  357 aa  K6PF_ANAVT RecName: Full=6-phosphofructokinase;       
    4::331     2e-34  38%  361 aa  K6PF1_SYNY3 RecName: Full=6-phosphofructokinase 1;       
    3::343     2e-34  34%  357 aa  K6PF2_ANASP RecName: Full=6-phosphofructokinase 2;       
    5::330     2e-32  38%  359 aa  K6PF1_ANASP RecName: Full=6-phosphofructokinase 1;       
    4::353     2e-27  34%  384 aa  K6PF2_SYNY3 RecName: Full=6-phosphofructokinase 2;       
   43::184     2e-19  41%  184 aa  K6PF_CALFI RecName: Full=6-phosphofructokinase;       
   96::345     6e-19  34%  489 aa  K6PF3_ARATH RecName: Full=6-phosphofructokinase 3;       
   94::321     2e-17  33%  462 aa  K6PF6_ARATH RecName: Full=6-phosphofructokinase 6;       
  181::507     6e-17  30%  537 aa  K6PF5_ARATH RecName: Full=6-phosphofructokinase 5, chloroplastic;  
   11::280     7e-17  25%  321 aa  K6PF_UREPA RecName: Full=6-phosphofructokinase;       
  144::388     4e-16  30%  530 aa  K6PF4_ARATH RecName: Full=6-phosphofructokinase 4, chloroplastic;  
   78::305     5e-16  35%  444 aa  K6PF2_ARATH RecName: Full=6-phosphofructokinase 2;       
   97::449     1e-15  31%  473 aa  K6PF1_ARATH RecName: Full=6-phosphofructokinase 1;       
   96::320     1e-13  31%  485 aa  K6PF7_ARATH RecName: Full=6-phosphofructokinase 7;       
    2::202     3e-09  30%  404 aa  PFP_PROFR RecName: Full=Pyrophosphate--fructose 6-phosphate
   82::323     4e-09  32%  552 aa  PFPB_SOLTU RecName: Full=Pyrophosphate--fructose 6-phosphate
    1::25      1e-07  92%   25 aa  K6PF2_THET8 RecName: Full=6-phosphofructokinase isozyme 2;       
  213::331     3e-06  29%  616 aa  PFPA_SOLTU RecName: Full=Pyrophosphate--fructose 6-phosphate
  213::341     6e-06  30%  617 aa  PFPA_RICCO RecName: Full=Pyrophosphate--fructose 6-phosphate
    1::335

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKRIAVLTSGGDAPGMNAAIRAVVRQAISEGMEVFGIYDGYAGMVAGEIHPLDAASVGDIISRGGTFLHS
K6PF_STRPI      MKRIAVLTSGGDAPGMNAAIRAVVRQAISEGMEVFGIYDGYAGMVAGEIHPLDAASVGDIISRGGTFLHS
K6PF_STRP7      MKRIAVLTSGGDAPGMNAAIRAVVRQAISEGMEVFGIYDGYAGMVAGEIHPLDAASVGDIISRGGTFLHS
K6PF_STRP4      MKRIAVLTSGGDAPGMNAAIRAVVRQAISEGMEVFGIYDGYAGMVAGEIHPLDAASVGDIISRGGTFLHS
K6PF_STRZT      MKRIAVLTSGGDAPGMNAAIRAVVRQAISEGMEVFGIYDGYAGMVAGEIHPLDAASVGDIISRGGTFLHS
K6PF_STRZP      MKRIAVLTSGGDAPGMNAAIRAVVRQAISEGMEVFGIYDGYAGMVAGEIHPLDAASVGDIISRGGTFLHS
K6PF_STRZJ      MKRIAVLTSGGDAPGMNAAIRAVVRQAISEGMEVFGIYDGYAGMVAGEIHPLDAASVGDIISRGGTFLHS
K6PF_STRPN      MKRIAVLTSGGDAPGMNAAIRAVVRQAISEGMEVFGIYDGYAGMVAGEIHPLDAASVGDIISRGGTFLHS
K6PF_STRPJ      MKRIAVLTSGGDAPGMNAAIRAVVRQAISEGMEVFGIYDGYAGMVAGEIHPLDAASVGDIISRGGTFLHS
K6PF_STRPS      MKRIAVLTSGGDAPGMNAAIRAVVRQAISEGMEVFGIYDGYAGMVAGEIHPLDAASVGDIISRGGTFLHS
K6PF_STRR6      MKRIAVLTSGGDAPGMNAAIRAVVRQAISEGMEVFGIYDGYAGMVAGEIHPLDAASVGDIISRGGTFLHS
K6PF_STRP2      MKRIAVLTSGGDAPGMNAAIRAVVRQAISEGMEVFGIYDGYAGMVAGEIHPLDAASVGDIISRGGTFLHS
K6PF_STRGC      MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGMEVFGIYDGYAGMVAGSIQPLTAASVGDIISRGGTFLHS
K6PF_STRSV      MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGMEVYGIYDGYAGMVAGEIYPLDATSVGDIISRGGTFLHS
K6PF_STRSY      MKRIAVLTSGGDAPGMNAAIRAVVRQAISEGMEVYGINEGYAGMVAGDIHELSARSVGDIISRGGTFLCS
K6PF_STRPZ      MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGMEVYGINRGYAGMVDGDIFPLGSKEVGDKISRGGTFLYS
K6PF_STRPM      MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGMEVYGINRGYAGMVDGDIFPLGSKEVGDKISRGGTFLYS
K6PF_STRPG      MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGMEVYGINRGYAGMVDGDIFPLGSKEVGDKISRGGTFLYS
K6PF_STRPD      MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGMEVYGINRGYAGMVDGDIFPLGSKEVGDKISRGGTFLYS
K6PF_STRPC      MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGMEVYGINRGYAGMVDGDIFPLGSKEVGDKISRGGTFLYS
K6PF_STRPB      MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGMEVYGINRGYAGMVDGDIFPLGSKEVGDKISRGGTFLYS
K6PF_STRP8      MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGMEVYGINRGYAGMVDGDIFPLGSKEVGDKISRGGTFLYS
K6PF_STRP6      MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGMEVYGINRGYAGMVDGDIFPLGSKEVGDKISRGGTFLYS
K6PF_STRP1      MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGMEVYGINRGYAGMVDGDIFPLGSKEVGDKISRGGTFLYS
K6PF_STRP3      MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGMEVYGINRGYAGMVDGDIFPLGSKEVGDKISRGGTFLYS
K6PF_STRTR      MKRIAVLTSGGDAPGMNAAVRAVVLKAISEGIEVFGINRGYAGMVEGDIFKLDAKRVENILSRGGTFLQS
K6PF_STRTD      MKRIAVLTSGGDAPGMNAAVRAVVLKAISEGIEVFGINRGYAGMVEGDIFKLDAKRVENILSRGGTFLQS
K6PF_STRS7      MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGMEVYGINRGYAGMVDGDIFPLGSKEVGDKISRGGTFLYS
K6PF_STRPF      MKRIAVFPSGGDAPGMNAAIRAVVRKAISEGMEVYGINRGYAGMVDGDIFPLGSKEVGDKISRGGTFLYS
K6PF_STREM      MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGMEVYGINRGYAGMVDGDIFPLGSKEVGDKISRGGTFLYS
K6PF_STRE4      MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGMEVYGINRGYAGMVDGDIFPLGSKEVGDKISRGGTFLYS
K6PF_STRA5      MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGMEVYGINQGYYGMVTGDIFPLDANSVGDTINRGGTFLRS
K6PF_STRA3      MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGMEVYGINQGYYGMVTGDIFPLDANSVGDTINRGGTFLRS
K6PF_STRA1      MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGMEVYGINQGYYGMVTGDIFPLDANSVGDTINRGGTFLRS
K6PF_STRMU      MKRIAVLTSGGDAPGMNAAVRAVVRKAISEGMEVCGINRGYAGMVEGDIFPLDAKGVSNILSRGGTFLQS
K6PF_STRU0      MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGMEVYGVNHGYAGLVAGDIFPISSKGVGDKISRGGTFLYS
K6PF_LACLS      MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGIEVYGINHGYAGMVAGDIFPLTSASVGDKIGRGGTFLYS
K6PF_LACLM      MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGIEVYGINHGYAGMVAGDIFPLTSASVGDKIGRGGTFLYS
K6PF_LACLA      MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGIEVYGINHGYAGMVAGDIFPLTSASVGDKIGRGGTFLYS
K6PF_ENTFA      MKRIGILTSGGDAPGMNAAIRAVVRKSIFDGIEVYGINYGFAGLVAGDIRRLDVADVGDKIQRGGTFLYS
K6PF_ANOFW      MKRIGVLTSGGDSPGMNAAIRAVVRKAIYHGLEVYGIYHGYAGLIAGQIKKLEIGDVGDIIHRGGTMLYT
K6PF_LISW6      MKRIAILTSGGDAPGMNAATRAVVRKAIYEGLEVYGINYGFLGLVNGDIRKLELGSVGDLLHRGGTFLYS
K6PF_LISMO      MKRIAILTSGGDAPGMNAATRAVVRKAIYEGLEVYGINYGFLGLVNGDIRKLELGSVGDLLHRGGTFLYS
K6PF_LISMF      MKRIAILTSGGDAPGMNAATRAVVRKAIYEGLEVYGINYGFLGLVNGDIRKLELGSVGDLLHRGGTFLYS
K6PF_LISMC      MKRIAILTSGGDAPGMNAATRAVVRKAIYEGLEVYGINYGFLGLVNGDIRKLELGSVGDLLHRGGTFLYS
K6PF_LISIN      MKRIAILTSGGDAPGMNAATRAVVRKAIYEGLEVYGINYGFLGLVNGDIRKLELGSVGDLLHRGGTFLYS
K6PF_LISMH      MKRIAILTSGGDAPGMNAATRAVVRKAIYEGLEVYGINYGFLGLVNGDIRKLELGSVGDLLHRGGTFLYS
K6PF_GEOKA      MKRIGVLTSGGDSPGMNAAIRAVVRKAIYHGVEVYGIYHGYAGLIAGNIKKLEVGDVGDIIHRGGTILYT
K6PF_BACST      MKRIGVLTSGGDSPGMNAAIRSVVRKAIYHGVEVYGVYHGYAGLIAGNIKKLEVGDVGDIIHRGGTILYT
K6PF_BACCN      MKRIGVLTSGGDSPGMNAAIRAVVRKAIYHDIEVYGIYHGYAGLISGHIEKLELGSVGDIIHRGGTKLYT
K6PF_BACSU      MKRIGVLTSGGDSPGMNAAVRAVVRKAIYHDVEVYGIYNGYAGLISGKIEKLELGSVGDIIHRGGTKLYT
K6PF_BACLD      MKRIGVLTSGGDSPGMNAAVRAVVRKAIYHDVEVYGIYNGYSGLISGKIEKLEIGSVGDIIHRGGTKLYT
K6PF_BACWK      MKRIGVLTSGGDSPGMNAAIRAVVRKAIFHDIEVYGIYHGYAGLISGHIEKLELGSVGDIIHRGGTKLYT
K6PF_BACHK      MKRIGVLTSGGDSPGMNAAIRAVVRKAIFHDIEVYGIYHGYAGLISGHIEKLELGSVGDIIHRGGTKLYT
K6PF_BACCZ      MKRIGVLTSGGDSPGMNAAIRAVVRKAIFHDIEVYGIYHGYAGLISGHIEKLELGSVGDIIHRGGTKLYT
K6PF_BACCQ      MKRIGVLTSGGDSPGMNAAIRAVVRKAIFHDIEVYGIYHGYAGLISGHIEKLELGSVGDIIHRGGTKLYT
K6PF_BACCE      MKRIGVLTSGGDSPGMNAAIRAVVRKAIFHDIEVYGIYHGYAGLISGHIEKLELGSVGDIIHRGGTKLYT
K6PF_BACC7      MKRIGVLTSGGDSPGMNAAIRAVVRKAIFHDIEVYGIYHGYAGLISGHIEKLELGSVGDIIHRGGTKLYT
K6PF_BACC3      MKRIGVLTSGGDSPGMNAAIRAVVRKAIFHDIEVYGIYHGYAGLISGHIEKLELGSVGDIIHRGGTKLYT
K6PF_BACC1      MKRIGVLTSGGDSPGMNAAIRAVVRKAIFHDIEVYGIYHGYAGLISGHIEKLELGSVGDIIHRGGTKLYT
K6PF_BACC0      MKRIGVLTSGGDSPGMNAAIRAVVRKAIFHDIEVYGIYHGYAGLISGHIEKLELGSVGDIIHRGGTKLYT
K6PF_BACAN      MKRIGVLTSGGDSPGMNAAIRAVVRKAIFHDIEVYGIYHGYAGLISGHIEKLELGSVGDIIHRGGTKLYT
K6PF_BACAH      MKRIGVLTSGGDSPGMNAAIRAVVRKAIFHDIEVYGIYHGYAGLISGHIEKLELGSVGDIIHRGGTKLYT
K6PF_BACAC      MKRIGVLTSGGDSPGMNAAIRAVVRKAIFHDIEVYGIYHGYAGLISGHIEKLELGSVGDIIHRGGTKLYT
K6PF_BACAA      MKRIGVLTSGGDSPGMNAAIRAVVRKAIFHDIEVYGIYHGYAGLISGHIEKLELGSVGDIIHRGGTKLYT
K6PF_BACA2      MKRIGVLTSGGDSPGMNAAVRAVVRKAIYHDVEVYGIYNGYSGLISGKIEKLELGSVGDIIHRGGTKLYT
K6PF_BACHD      MKRIGVLTSGGDSPGMNAAIRAVVRKAIYHGVEVYGIYQGYAGLISGDIRKMELGSVGDIIHRGGTILYT
K6PF_BACC4      MKRIGVLTSGGDSPGMNAAIRAVVRKAIFHDIEVYGIYHGYAGLISGHIEKLELGSVGDIIHRGGTKLYT
K6PF_BACC2      MKRIGVLTSGGDSPGMNAAIRAVVRKAIFHDIEVYGIYHGYAGLISGHIEKLELGSVGDIIHRGGTKLYT
K6PF_BACCR      MKRIGVLTSGGDSPGMNAAIRAVVRKAIFHDIEVYGIYHGYAGLISGHIEKLELGSVGDIIPRGGTKLYT
K6PF_GEOSW      MKRIGVLTSGGDSPGMNAAIRAVVRKAIYHGVEVFXXXXXXXXXXXXKIKKLEVGDVGDIIHRGGTILYT
K6PF_BACP2      MKRIGVLTSGGDSPGMNAAVRAVVRKAIYHNVEVYGIYNGYSGLINGKIEKLEIGSVGDIIHRGGTKLYT
K6PF_LACGA      MKRIGILTSGGDAPGMNAAIRAVTRTALANGIEVCGIRYGYAGLVAGDIFQMTSETVADKINRGGTFLYS
K6PF_LACJO      MKRIGILTSGGDAPGMNAAIRAVTRTALANGIEVCGIRYGYAGLVAGDIFQMTSETVADKISRGGTFLYS
K6PF_LACCB      MKRIGILTSGGDAPGMNAAVRAVARKAMHEGLEVYGINYGFAGLVAGDIFKMNESTVGDKIQRGGTMLYS
K6PF_LACC3      MKRIGILTSGGDAPGMNAAVRAVARKAMHEGLEVYGINYGFAGLVAGDIFKMNESTVGDKIQRGGTMLYS
K6PF_LACS1      MKRIGILTSGGDAAGMNAAVRAIARSAMNAGLEAYGINYGYKGLVEGNIFKMESTKLDEIINRGGTILYS
K6PF_PEDPA      MKRIGIMTSGGDAPGMNLAIRAVARKALSSGLEAYGINYGFAGLVAGDIHEFKAADLDDMVSQGGTMLYS
K6PF_LACDE      MKRIGILTSGGDAPGMNXXXXXXXXXXXXNGLEVFGIRYGFAGLVAGDIFPLESEDVAHLINVSGTFLYS
K6PF_LACAC      MKRIGILTSGGDAPGMNAAIRAVTKTAIHHGLEVFGIRYGFAGLVAGDFIPLTTENVDHKISEGGTFLYS
K6PF_BACSK      MKRIGVLTSGGDSPGMNAAIRAVVRKAIFHGLEVYGISYGYQGLINGDIKKMELGSVGDIIHRGGTMLYT
K6PF_BACSH      MKKIAVLTSGGDVPGMNAAIRAVVRKAAFHGINVVGIKHGYEGLVKGYLEELDLGSVGGIIQRGGTHLNS
K6PF_LACH4      MKRIGILTSGGDAPGMNAAIRAVTKTAIHHGLEVFGIRYGFAGLVAGDFVPLTTENVDHKISEGGTFLYS
K6PF_SERP5      IKKIGVLTSGGDSPGMNAAIRGVVRAALSEGLEVFGIYDGYLGLYEDRMEKLDRYSVSDMINRGGTFLGS
K6PF_VIBPA      IKKIGVLTSGGDAPGMNAAIRGVVRTALSEGLEVFGVYDGYLGLYEGRIEKLDRSSVSDVINKGGTFLGS
K6PF_VIBCH      IKKIGVLTSGGDAPGMNAAIRGVVRTALGAGLEVFGIYDGYQGLYEDRIKQLDRSSVSDVINRGGTFLGS
K6PF_LACPL      MKRIGILTSGGDAPGMNXXXXXXXXXXXXEGLEAYGINYGFAGLVAGDIHKIEAADLDGVIQRGGTLLYS
K6PF_PECCP      IRRIGVLTSGGDAPGMNAAIRGVVRAALTEGLEVYGIYDGYQGLYEDRMEQLDRYSVSDVINRGGTFLGS
K6PF_ERWCT      IRRIGVLTSGGDAPGMNAAIRGVVRAALSEGLEIYGIYDGYQGLYEDRMEQLDRYSVSDVINRGGTFLGS
K6PF_EDWI9      IKKIGVLTSGGDAPGMNAAIRGVVRAALSKGLDVYGIHDGYLGLYEGRIEQLDRHSVSDVINRGGTFLGS
K6PF_VIBVY      IKKIGVLTSGGDAPGMNAAIRGVVRTALGAGLEVYGIYDGYLGLYEGRIKQLDRSSVSDVINRGGTFLGS
K6PF_VIBVU      IKKIGVLTSGGDAPGMNAAIRGVVRTALGAGLEVYGIYDGYLGLYEGRIKQLDRSSVSDVINRGGTFLGS
K6PF_STAES      MKKIAVLTSGGDSPGMNAAVRAVTRTAIYNNIEVYGVYQGYQGLLDDDIHKLELGSVGDTIQRGGTFLFS
K6PF_STAEQ      MKKIAVLTSGGDSPGMNAAVRAVTRTAIYNNIEVYGVYQGYQGLLDDDIHKLELGSVGDTIQRGGTFLFS
K6PF_PHOPR      IKKIGVLTSGGDAPGMNAAVRGVVRAALSDGLEVYGIYDGYQGLHQNRIEKLSRTSVSDVINRGGTFLGS
K6PF_STACT      MKKIAVLTSGGDAPGMNAAIRAVVRTAIYNGIEVYGVYQGYLGLINDDLKKLELGSVGDTIQRGGTFLYS
K6PF_MACCJ      MKKIAVLTSGGDAPGMNAAVRAVVRKAMYYDIEVYGVYQGYQGLINNNIKKMERGTVGDKIQRGGTFLQS
K6PF_STAAW      MKKIAVLTSGGDSPGMNAAVRAVVRTAIYNEIEVYGVYHGYQGLLNDDIHKLELGSVGDTIQRGGTFLYS
K6PF_STAAT      MKKIAVLTSGGDSPGMNAAVRAVVRTAIYNEIEVYGVYHGYQGLLNDDIHKLELGSVGDTIQRGGTFLYS
K6PF_STAAS      MKKIAVLTSGGDSPGMNAAVRAVVRTAIYNEIEVYGVYHGYQGLLNDDIHKLELGSVGDTIQRGGTFLYS
K6PF_STAAR      MKKIAVLTSGGDSPGMNAAVRAVVRTAIYNEIEVYGVYHGYQGLLNDDIHKLELGSVGDTIQRGGTFLYS
K6PF_STAAN      MKKIAVLTSGGDSPGMNAAVRAVVRTAIYNEIEVYGVYHGYQGLLNDDIHKLELGSVGDTIQRGGTFLYS
K6PF_STAAM      MKKIAVLTSGGDSPGMNAAVRAVVRTAIYNEIEVYGVYHGYQGLLNDDIHKLELGSVGDTIQRGGTFLYS
K6PF_STAAE      MKKIAVLTSGGDSPGMNAAVRAVVRTAIYNEIEVYGVYHGYQGLLNDDIHKLELGSVGDTIQRGGTFLYS
K6PF_STAAC      MKKIAVLTSGGDSPGMNAAVRAVVRTAIYNEIEVYGVYHGYQGLLNDDIHKLELGSVGDTIQRGGTFLYS
K6PF_STAAB      MKKIAVLTSGGDSPGMNAAVRAVVRTAIYNEIEVYGVYHGYQGLLNDDIHKLELGSVGDTIQRGGTFLYS
K6PF_STAA9      MKKIAVLTSGGDSPGMNAAVRAVVRTAIYNEIEVYGVYHGYQGLLNDDIHKLELGSVGDTIQRGGTFLYS
K6PF_STAA2      MKKIAVLTSGGDSPGMNAAVRAVVRTAIYNEIEVYGVYHGYQGLLNDDIHKLELGSVGDTIQRGGTFLYS
K6PF_OCEIH      MKRIGVLTSGGDSPGMNAAIRAVVRKAIYHDLEVYGIKNGYQGLMDGNIEKMTLGSVGDIIHRGGTILFS
K6PF_NATTJ      MKKIGVLTSGGDSPGMNATIRAVVRRGIYMGLDIYGIYYGFSGLINGNIEKLEIGSVGDIIHRGGTILHT
K6PF_HAEI8      IKKIAVLTSGGDAPGMNAAIRGVVRSALAEGLEVFGIYDGYQGLYNNKIKQLNRYSVSDVINRGGTFLGS
K6PF_HAEIN      IKKIAVLTSGGDAPGMNAAIRGVVRSALAEGLEVFGIYDGYQGLYNNKIKQLNRYSVSDVINRGGTFLGS
K6PF_HAEIE      IKKIAVLTSGGDAPGMNAAIRGVVRSALAEGLEVFGIYDGYQGLYNNKIKQLNRYSVSDVINRGGTFLGS
K6PF_BUCAT      IKKIGVLTSGGDAPGMNAAIRGVVRTALSERLEVFGIYDGYLGLYENRMVQLDRYSVSDMINRGGTFLGS
K6PF_BUCAI      IKKIGVLTSGGDAPGMNAAIRGVVRTALSERLEVFGIYDGYLGLYENRMVQLDRYSVSDMINRGGTFLGS
K6PF_BUCA5      IKKIGVLTSGGDAPGMNAAIRGVVRTALSERLEVFGIYDGYLGLYENRMVQLDRYSVSDMINRGGTFLGS
K6PF_HAEPS      VKKIAVLTSGGDAPGMNAAIRGVVRAGLSEGLEVYGIQDGYYGLYHDRVIKLERRSVSEVINRGGTFLGS
K6PF_ACTSZ      IKKIAVLTSGGDAPGMNAAIRAVVRAGLSEGLEVYGVFDGYQGLFENRIQKLSRYSVSDVINRGGTFLGS
K6PF_TOLAT      IKKIGVLTSGGDAPGMNAAIRSVIRAALAKGIEVYGIHDGYLGLHRDRIEKLERRSVSDIINRGGTMLGS
K6PF_HAEDU      IKKIAVLTSGGDAPGMNAAIRGVVRAALNEGLEIFGVQDGYYGLYHDKVIPLDRRSVSEIINRGGTFLGS
K6PF_BUCAP      IKKIGVLTSGGDAPGMNAAIRGVVRTALSEKLEVFGIYDGYLGLYENRMTLLDRYSVSDMINRGGTFLGS
K6PF_KLEP7      IKKIGVLTSGGDAPGMNAAIRGVVRAALTEGLEVFGIYDGYLGLYEDRMVQLDRYSVSDMINRGGTFLGS
K6PF_KLEP3      IKKIGVLTSGGDAPGMNAAIRGVVRAALTEGLEVFGIYDGYLGLYEDRMVQLDRYSVSDMINRGGTFLGS
K6PF_ENTS8      IKKIGVLTSGGDAPGMNAAIRGVVRAALTEGLEVFGVYDGYLGLYEDRMIQLDRYSVSDMINRGGTFLGS
K6PF_TERTT      VKNIGVLTSGGDAPGMNAAVRAVVRTALHYDVGVYGIYNGYLGLYRNEIQPMTRRSVADTINRGGTFLGS
K6PF_ENTCL      IKKIGVLTSGGDAPGMNAAIRGVVRAALTEGLEVFGVYDGYLGLYEDRMVQLDRYSVSDMINRGGTFLGS
K6PF_MANSM      IKKIAVLTSGGDAPGMNAAIRGVVRSALFEGLEVFGVYDGYYGLYHNKIKQLNRYSVSDVITRGGTFLGS
K6PF_ESCF3      IKKIGVLTSGGDAPGMNAAIRGVVRAALSEGLEVMGIYDGYLGLYEDRMVQLDRYSVSDMINRGGTFLGS
K6PF_ACTPJ      IKKIAVLTSGGDAPGMNAAIRGVVRAALNEGLEVYGVQDGYYGLYTDRVIPLDRRSVSETINRGGTFLGS
K6PF_ACTP7      IKKIAVLTSGGDAPGMNAAIRGVVRAALNEGLEVYGVQDGYYGLYTDRVIPLDRRSVSETINRGGTFLGS
K6PF_ACTP2      IKKIAVLTSGGDAPGMNAAIRGVVRAALNEGLEVYGVQDGYYGLYTDRVIPLDRRSVSETINRGGTFLGS
K6PF_PASMU      IKKIAVLTSGGDAPGMNAAIRGVVRSALAAGLEVYGIYEGYYGLYHNKVKQMTRYSVSDIINRGGTFLGS
K6PF_ECO27      IKKIGVLTSGGDAPGMNAAIRGVVRSALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSDMINRGGTFLGS
K6PF1_ECOL6     IKKIGVLTSGGDAPGMNAAIRGVVRSALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSDMINRGGTFLGS
K6PF_SHISS      IKKIGVLTSGGDAPGMNAAIRGVVRSALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSDMINRGGTFLGS
K6PF_SHIDS      IKKIGVLTSGGDAPGMNAAIRGVVRSALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSDMINRGGTFLGS
K6PF_SHIBS      IKKIGVLTSGGDAPGMNAAIRGVVRSALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSDMINRGGTFLGS
K6PF_SHIB3      IKKIGVLTSGGDAPGMNAAIRGVVRSALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSDMINRGGTFLGS
K6PF_HAES2      IKKIAVLTSGGDAPGMNAAIRGVVRSALSEGLEVYGIYEGYYGLYHNKIQQLTRYSVSDIINRGGTFLGS
K6PF_HAES1      IKKIAVLTSGGDAPGMNAAIRGVVRSALSEGLEVYGIYEGYYGLYHNKIQQLTRYSVSDIINRGGTFLGS
K6PF_ECOSM      IKKIGVLTSGGDAPGMNAAIRGVVRSALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSDMINRGGTFLGS
K6PF_ECOSE      IKKIGVLTSGGDAPGMNAAIRGVVRSALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSDMINRGGTFLGS
K6PF_ECOLU      IKKIGVLTSGGDAPGMNAAIRGVVRSALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSDMINRGGTFLGS
K6PF_ECOLC      IKKIGVLTSGGDAPGMNAAIRGVVRSALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSDMINRGGTFLGS
K6PF_ECOL5      IKKIGVLTSGGDAPGMNAAIRGVVRSALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSDMINRGGTFLGS
K6PF_ECOHS      IKKIGVLTSGGDAPGMNAAIRGVVRSALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSDMINRGGTFLGS
K6PF_ECODH      IKKIGVLTSGGDAPGMNAAIRGVVRSALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSDMINRGGTFLGS
K6PF_ECOBW      IKKIGVLTSGGDAPGMNAAIRGVVRSALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSDMINRGGTFLGS
K6PF_ECO8A      IKKIGVLTSGGDAPGMNAAIRGVVRSALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSDMINRGGTFLGS
K6PF_ECO81      IKKIGVLTSGGDAPGMNAAIRGVVRSALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSDMINRGGTFLGS
K6PF_ECO7I      IKKIGVLTSGGDAPGMNAAIRGVVRSALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSDMINRGGTFLGS
K6PF_ECO5E      IKKIGVLTSGGDAPGMNAAIRGVVRSALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSDMINRGGTFLGS
K6PF_ECO55      IKKIGVLTSGGDAPGMNAAIRGVVRSALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSDMINRGGTFLGS
K6PF_ECO45      IKKIGVLTSGGDAPGMNAAIRGVVRSALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSDMINRGGTFLGS
K6PF_ECO24      IKKIGVLTSGGDAPGMNAAIRGVVRSALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSDMINRGGTFLGS
K6PF1_SHIFL     IKKIGVLTSGGDAPGMNAAIRGVVRSALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSDMINRGGTFLGS
K6PF1_ECOLI     IKKIGVLTSGGDAPGMNAAIRGVVRSALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSDMINRGGTFLGS
K6PF1_ECO57     IKKIGVLTSGGDAPGMNAAIRGVVRSALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSDMINRGGTFLGS
K6PF_VIBFM      VKKIGVLTSGGDAPGMNAAVRGVVRTALTEGLEVFGIHDGYLGLVEDRIEKLERHSVSDMINRGGTFLGS
K6PF_VIBF1      VKKIGVLTSGGDAPGMNAAVRGVVRTALTEGLEVFGIHDGYLGLVEDRIEKLERHSVSDMINRGGTFLGS
K6PF_SALTY      IKKIGVLTSGGDAPGMNAAIRGVVRAALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSDMINRGGTFLGS
K6PF_SALTI      IKKIGVLTSGGDAPGMNAAIRGVVRAALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSDMINRGGTFLGS
K6PF_SALSV      IKKIGVLTSGGDAPGMNAAIRGVVRAALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSDMINRGGTFLGS
K6PF_SALPK      IKKIGVLTSGGDAPGMNAAIRGVVRAALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSDMINRGGTFLGS
K6PF_SALPC      IKKIGVLTSGGDAPGMNAAIRGVVRAALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSDMINRGGTFLGS
K6PF_SALPB      IKKIGVLTSGGDAPGMNAAIRGVVRAALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSDMINRGGTFLGS
K6PF_SALPA      IKKIGVLTSGGDAPGMNAAIRGVVRAALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSDMINRGGTFLGS
K6PF_SALNS      IKKIGVLTSGGDAPGMNAAIRGVVRAALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSDMINRGGTFLGS
K6PF_SALHS      IKKIGVLTSGGDAPGMNAAIRGVVRAALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSDMINRGGTFLGS
K6PF_SALEP      IKKIGVLTSGGDAPGMNAAIRGVVRAALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSDMINRGGTFLGS
K6PF_SALDC      IKKIGVLTSGGDAPGMNAAIRGVVRAALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSDMINRGGTFLGS
K6PF_SALCH      IKKIGVLTSGGDAPGMNAAIRGVVRAALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSDMINRGGTFLGS
K6PF_SALAR      IKKIGVLTSGGDAPGMNAAIRGVVRAALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSDMINRGGTFLGS
K6PF_SALA4      IKKIGVLTSGGDAPGMNAAIRGVVRAALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSDMINRGGTFLGS
K6PF_ENT38      IKKIGVLTSGGDAPGMNAAIRGVVRAALTEGLEIFGVYDGYLGLYEDRMVQLDRYSVSDMINRGGTFLGS
K6PF_CITK8      IKKIGVLTSGGDAPGMNAAIRGVVRAALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSDMINRGGTFLGS
K6PF_SALG2      IKKIGVLTSGGDAPGMNAAIRGVVRAALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSDMINRGGTFLGS
K6PF_BACMC      IKKIAVLTSGGDSQGMNAAVRAVVRSGLFYGLEVYGIQRGYQGLLNDDIFSMDLRSVGDIIQRGGTVLQS
K6PF_THETN      MKTIGILTSGGDAPGMNAAIRAVVRTGIYYGLKVKGIMRGFAGLVEDEVIDLGLSSVGDIIQKGGTILRT
K6PF_CLONN      MKTIAVLTSGGDAPGMNAAIRAVVRTGLDKGLKVMGIQRGYSGLINGEIFEMHRYSVADIIHRGGTILRT
K6PF_ALISL      VKKIGVLTSGGDAPGMNAAVRGVVRTALTQGLEVFGIHDGYLGLVEDRIEKLERHSVSDMINRGGTFLGS
K6PF_SODGM      IKKIGVLTSGGDSPGMNAAIRGVVRAGLSEGLEVYGIYDGYLGLFQDRIAKLDRYSVSDMINRGGTFLGS
K6PF_CLOBL      MRTIAVLTSGGDAPGMNAAIRAVVRTGLEKGLKVMGIQRGYNGLINGEIFEMDTHSVSDIIQRGGTILRT
K6PF_CLOBK      MRTIAVLTSGGDAPGMNAAIRAVVRTGLEKGLKVMGIQRGYNGLINGEIFEMDTHSVSDIIQRGGTILRT
K6PF_CLOBJ      MRTIAVLTSGGDAPGMNAAIRAVVRTGLEKGLKVMGIQRGYNGLINGEIFEMDTHSVSDIIQRGGTILRT
K6PF_CLOBH      MRTIAVLTSGGDAPGMNAAIRAVVRTGLEKGLKVMGIQRGYNGLINGEIFEMDTHSVSDIIQRGGTILRT
K6PF_CLOB1      MRTIAVLTSGGDAPGMNAAIRAVVRTGLEKGLKVMGIQRGYNGLINGEIFEMDTHSVSDIIQRGGTILRT
K6PF_BAUCH      INKIGVLTSGGDSPGMNAAIRSVVRAGLSEGLEIYGISDGYQGLYQDRMRKLDRYSVSDIINRGGTFLGS
K6PF_ERWT9      IKKIGVLTSGGDAPGMNAAIRGVVRAALSEGLEVCGIYDGYLGLYEDRMINLDRYSVSDMINRGGTFLGS
K6PF_CLOBM      MRTIAVLTSGGDAPGMNAAIRAVVRTGLEKGLKVMGIQRGYNGLINGEIFEMDTHSVSDIIQRGGTILRT
K6PF_CLOB6      MRTIAVLTSGGDAPGMNAAIRAVVRTGLEKGLKVMGIQRGYNGLINGEIFEMDTHSVSDIIQRGGTILRT
K6PF_HALOH      MKKIGVLTSGGDAPGMNAAIRSVVRTGIYHGLDVVGIRRGYAGLIEGDFYLMDRGSVADIIQRGGTILLS
K6PF_CLOBB      MKKIAILTSGGDAPGMNAAIRAVVRTAIDKGLEVMGVQRGYSGLLNGELFAMNRTSVSDIIQRGGTILRT
K6PF_CLOD6      MKTIGLLTSGGDAPGMNAAIRAVVRSAIYYGCKVYGINRGYKGLLEEDLTEMNLSSVGDIIHRGGTILKS
K6PF_ALKOO      MKKIAVLTSGGDAPGMNAAVRAVVRSGIYNEMKVMGVKQGYNGLINAQIEEMNLSSVADIIHRGGTILRT
K6PF_VIBHB      IKKIGVLTSGGDAPGMNAAVRGVVRTALSXXXXXXXXXXXXXXXXXXRIEKLDRSSVSDVINKGGTFLGS
K6PF_CLOTE      MRKIAVLTSGGDAPGMNAAIRAVVRTGLDKGITVLGIERGFDGLLNGEIFEMTRRSVADIIQRGGTILRT
K6PF_BLOFL      IKKIGVLTSGGDSPGMNAAIRGVVRAGLSEGIEVYGIYDGYLGLFQNRMMLLSYCSVSDIINKGGTVLGS
K6PF_BREBN      MRKLAVLTSGGDSPGMNXXXXXXXXXXHFHEVQMFGVYHGYEGLMRGDIKEMSLGSVGDIIQRGGTILYS
K6PF_CLOBA      MKKIAILTSGGDAPGMNAAIRAVVRTAIDKGLEVMGVQRGYSGLLNGELFAMNRTSVSDIIQRGGTILRT
K6PF_ALKMQ      MKTIGVLTSGGDSPGMNAAIRAVVRSGIYNGCKIMGIKQGYSGLINAKIEEMNLSSVADIIHRGGTILRT
K6PF1_CLOPE     MKKIAVLTSGGDAPGMNAALRAVTRMALHHGLEVMGVQRGYAGLINGELFKMDRKSVSEIINRGGTILRT
K6PF_THEPX      MKTIGILTSGGDAPGMNAAIRAVVRTGIYYGLKVKGIMRGYAGLVEDEVIDLNLSSVGDILQKGGTILRT
K6PF_THEP3      MKTIGILTSGGDAPGMNAAIRAVVRTGIYYGLKVKGIMRGYAGLVEDEVIDLNLSSVGDILQKGGTILRT
K6PF_BUCBP      IKRIGVLTSGGDAPGMNAAIRGVVRTALSRNLEVFGIYDGYLGLYENRMILLDRYSVSDIINKGGTFLGS
K6PF_FINM2      MKTIAILTSGGDAPGMNACIRSIARTCIYNGIRVMGIRSGYDGLMNGNIYEMNVSSVADIIHRGGTILGS
K6PF_FUSNN      -KKLAILTSGGDAPGMNAAIRATAKIAEYYGFEVYGIRRGYLGMLNDEIFPMTGRFVSGIIDKGGTVLLT
K6PF_YERE8      VKKIGVLTSGGDAPGMNAAIRGVVRAALSEGLEVYGIEDGYLGLYHNRMKQLDRYSVSDMINRGGTFLGS
K6PF_CLOAB      MKTIAVLTSGGDAPGMNAAIRAVVRTAIEKGINVKGIQRGYSGLINGEIFDMNRHSVSDIIQRGGTILRT
K6PF_DEIRA      IKRVAVLTSGGDAPGMNAAIRAVVRTGAQQGIEVVGVRRGFSGLHRGEVQLLGPRDVANTIQRGGTILLT
K6PF_YERPP      VKKIGVLTSGGDAPGMNAAIRGVVRAALSAGLDVFGIEDGYLGLYENRMKKLDRYSVSDMINRGGTFLGS
K6PF_YERPN      VKKIGVLTSGGDAPGMNAAIRGVVRAALSAGLDVFGIEDGYLGLYENRMKKLDRYSVSDMINRGGTFLGS
K6PF_YERPG      VKKIGVLTSGGDAPGMNAAIRGVVRAALSAGLDVFGIEDGYLGLYENRMKKLDRYSVSDMINRGGTFLGS
K6PF_YERPE      VKKIGVLTSGGDAPGMNAAIRGVVRAALSAGLDVFGIEDGYLGLYENRMKKLDRYSVSDMINRGGTFLGS
K6PF_YERPA      VKKIGVLTSGGDAPGMNAAIRGVVRAALSAGLDVFGIEDGYLGLYENRMKKLDRYSVSDMINRGGTFLGS
K6PF_YERP3      VKKIGVLTSGGDAPGMNAAIRGVVRAALSAGLDVFGIEDGYLGLYENRMKKLDRYSVSDMINRGGTFLGS
K6PF_YERPY      VKKIGVLTSGGDAPGMNAAIRGVVRAALSAGLDVFGIEDGYLGLYENRMKKLDRYSVSDMINRGGTFLGS
K6PF_YERPS      VKKIGVLTSGGDAPGMNAAIRGVVRAALSAGLDVFGIEDGYLGLYENRMKKLDRYSVSDMINRGGTFLGS
K6PF_YERPB      VKKIGVLTSGGDAPGMNAAIRGVVRAALSAGLDVFGIEDGYLGLYENRMKKLDRYSVSDMINRGGTFLGS
K6PF_HAMD5      VKRIGVLTSGGDAPGMNAAIRGVVRSTLFKNKEVFGIYDGYQGLYDNQIQQLNRYSVSDIINRGGTILGS
K6PF_CYTH3      MKKIAVYTSGGDAPGMNACIRAAVRAGHYHNLEVYGIVRGYDGMINGNFIELDNRAVSNIIQKGGTILKS
K6PF_MYCCT      IKKIGILTSGGDAPGMNNAIAGVVKTASSKGIEVYGINDGYKGLVNGWFEKLNVEKTLDILSRGGTYLGS
K6PF_PERMH      MKKIAVLTSGGDAPGLNACIRAVVRAGHYYNCEVIGVRRGFKGLIEKQFISLTPRDVGGIIDKGGTFLLS
K6PF_THENN      MKKIAVLTSGGDAPGMNAAVRAVVRYGIKNGLEVIGVRRGYSGLIDGDFVKLEYKDVAGITEKGGTILRT
K6PF_THET2      MKRIGVFTSGGDAPGMNAAIRAVVRQAHALGVEVIGIRRGYAGMIQGEMVPLGVRDVANIIQRGGTILLT
K6PF1_THET8     MKRIGVFTSGGDAPGMNAAIRAVVRQAHALGVEVIGIRRGYAGMIQGEMVPLGVRDVANIIQRGGTILLT
K6PF2_BACTN     VKCIGILTSGGDAPGMNAAIRAVTRAAIYNGLQVKGIYRGYKGLVTGEIKEFKSQNVSNIIQLGGTILKT
K6PF_SULSY      MKKIGLLTSGGDCPGLNACIRAVVRTANYYNIEVVAFKRGFKGLIENDFTTLDYKSVAGILQKGGTILLT
K6PF_COXBU      IKKLIVLTSGGDAPGMNAAIRAVVRTALHYQFEVYGATAGFAGLVNGQVVPLNSRAVANCIQRGGTILKT
K6PF_AQUAE      --RIGILTAGGDAPGMNAVIRAVVRSAEREGHEVIGIKRGYKGLIEGDFIKLTSRDVGGILDRGGTILLS
K6PF_BUCCC      IKKIGILTSGGDSPGMNAIIRSVVCTALNHNIEVKGIYNGFLGLYNNDMKLLKYSHVANLLNQGGTILGS
K6PF_MYCPU      IKKIAILTSGGDSPGMNNAIRAIIKTARLYDIETYLVYEGFLGLYNGWIKPSEGIDEDSYINKGGTFIFS
K6PF_THESQ      MKKIAVLTSGGDAPGMNXXXXXXXXXXXXQGLEVIGVRRGYSGLIDGDFVKLEYKDVAGITEKGGTILRT
K6PF_THEP1      MKKIAVLTSGGDAPGMNXXXXXXXXXXXXHGLEVIGVRRGYSGLIDGDFVKLEYKDVAGITEKGGTILRT
K6PF1_BACTN     -KYIGILTSGGDASGMNAAIRAVTRAAIFNGFKVKGIYRGYEGLIAGEVKELTTEDVSSIIQRGGTILKT
K6PF_THEMA      MKKIAVLTSGGDAPGMNXXXXXXXXXXXXQGLEVIGVRRGYSGLIDGDFVKLEYKDVAGITEKGGTILRT
K6PF_MYCMO      -KKIAILTSGGDSPGMNNAIRTIVKTSKIHGIEVFLVYNGYKGLVEKTIKNANEINVDQYIGSGGTFIGS
K6PF_MYCH7      -KKIGILTSGGDAPGMNSAISFLTKSALSLGFEPYLIFDGYSGIIARKILPAKNFPYNGISSFGGTAIGS
K6PF_MYCH2      -KKIGILTSGGDAPGMNSAISFLAKSALSLGFEPYLIFDGYSGIIARKILPAKNFPYNGISSFGGTAIGS
K6PF_MYCHJ      -KKIGILTSGGDAPGMNSAISFLAKSALSLGFEPYLIFDGYSGIIARKILPAKNFPYNGISSFGGTAIGS
K6PF_SPICI      LKKIGILTSGGDSQGMNAAIAGVIKTAHAKGLETYIIRDGYLGLINNWIEVVDNNFADSIMLLGGTVIGS
K6PF3_STRCO     --RIGVLTSGGDCPGLNAVIRSVVHRAVVDGDEVIGFRDGWKGLLECDYLKLDLDAVGGILARGGTILGS
K6PF_CHLSY      -QRIGVLTSGGDAPGLNAVIRAVVKSASGLGWEVIGIHDGFEGLLGTKSYRLTNADVQGLLPRGGTILRT
K6PF_CHLAD      -QRIGVLTSGGDAPGLNAVIRAVVKSASSLGWEVIGIHDGFEGLLGTKSYRLTNADVQGLLPRGGTILRT
K6PF_CHLAA      -QRIGVLTSGGDAPGLNAVIRAVVKSASGLGWEVIGIHDGFEGLLGTKSYRLTNADVQGLLPRGGTILRT
K6PF2_STRCO     --RIGVLTAGGDCPGLNAVIRSVVHRAVDNGDEVIGFEDGYAGLLDGRYRALDLNAVSGILARGGTILGS
K6PF1_STRCO     --KVGVLTGGGDCPGLNAVIRAVVRKGVQEGYDFTGFRDGWRGPLEGDTVPLDIPAVRGILPRGGTVLGS
PFP_AMYME       --RVGVLTGGGDCPGLNAVIRAVVRKGIAHGWEIVGFRSGWRGPLTGDSRPLGLDDVEEILIRGGTILGS
PFP_AMYMD       --RVGVLTGGGDCPGLNAVIRAVVRKGIEHGWDFVGFRNGWNGPLTGDSRPLGLNDVEDILTRGGTILRS
K6PF2_ASPOR     -RRIGILTSGGDAPGMNGAIRAVVRTAIQNGCEAWAIHEGYEGLIQGGMHPLYWEDVRGFLSRGGTLIGS
K6PF3_BACTN     --RIGILTSGGDCPGINATIRGVCKTAINHGMEVIGIHSGFQGLLTKDIESFTDKSLSGLLNQGGTMLGT
K6PF2_CLOPE     IKKIAILTGGGDCPGLNAVIRAVTRTAILKGYEVIGYKFGYRGLYNNDFVKLDLDSVSGILHRGGTILHS
K6PF_DROME      -KGLAVFTSGGDSQGMNAAVRACVRMAIYLGCKVYFIREGYQGMVDGGIQEANWASVSSIIHRGGTIIGS
PFP_DICTH       --RIGVLTGGGDCPGLNPAIRGIVMRALDYGDEVIGLKYGWAGLLKADTMPLSLEMVEDILEIGGTILGS
K6PF_COREF      --RIATLTSGGDCPGLNAVIRGIVRTASNEGSTVVGYQDGWEGLLADDDEDIDXXXXXXXXXXXXXXXHP
K6PP_HUMAN      -KAIGVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFIYEGYQGMVDGNIAEADWESVSSILQVGGTIIGS
K6PF_MYCTU      --RIGVLTGGGDCPGLNAVIRAVVRTCHARGSSVVGFQNGFRGLLENRRVQLHNDDRNDLLAKGGTMLGT
K6PF_MYCBO      --RIGVLTGGGDCPGLNAVIRAVVRTCHARGSSVVGFQNGFRGLLENRRVQLHNDDRNDLLAKGGTMLGT
K6PP_RABIT      -KAIGVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFIYEGYQGMVDGGSNIVEAESVSSILQVGGTIIGS
K6PP_PONAB      -KAIGVLTSGGDAQGMNAAVRAVVRMGIYVGAKVCFIYEGYQGMVDGNIAEADWESVSSILQVGGTIIGS
K6PF_SCHMA      ---IAVLTSGGDAQGMNAAVRAVVRMGIYCGCRVFFIREGYQGLVDGNIQEASWADVSGILQLGGTKIGS
K6PF_HUMAN      -KAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVDGGDHIKEATSVSMMLQLGGTVIGS
K6PF_CANFA      -KAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVDGGDHIREATSVSMMLQLGGTVIGS
K6PF_MOUSE      -KAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVDGGEHIREATSVSMMLQLGGTVIGS
K6PF_RABIT      -KAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVDGGDHIREATSVSMMLQLGGTVIGS
K6PF_BOVIN      -KAIAVLTSGGDAQGMNAAVRAVVRVGIYTGARVFFVHEGYQGLVDGGDNIREATSVSMMLQLGGTVIGS
K6PP_MOUSE      -KAIGVLTSGGDAQGMNAAVRAVVRMGIYTGAKVYFIYEGYQGLVDGGSNIVEAKCVSSILQVGGTIIGS
K6PF_PIG        -KAIAVLTSGGDAQGMNAAVRAVVRVGIYTGARVFFVHEGYQGLVDGGDNIREATSVSMMLQLGGTVIGS
K6PF_MYCLE      --RIGILTGGGDCPGLNAVIRAIVRTCDARGSSVVGFQDGWRGLLENRRMQLCNDDRNDLLAKGGTMLGT
K6PF_RAT        -KAIAVLTSGGDAQGMNATVRAVVRVGIFTGLRVFFVHEGYQGLVDGGEHIREATSVSMMLQLGGTVIGS
K6PF_PONAB      -KAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVDGGDHIKEATSVSMMLQLGGTVIGS
K6PF_MACFA      -KAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVDGGDNIKEATSVSMMLQLGGTVIGS
K6PF_HORSE      -KAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVDGGDHIREATSVSMMLQLGGTVIGS
K6PP_RAT        -KAIGVLTSGGDAQGMNAAVRAVVRMGIYTGAKVYFIYEGYQGMVDGGSNIVEAECVSSILQVGGTIIGS
K6PF_DICDI      VKRMAVLTSGGDSSGMNPAIRAFARQVMLKGAKVFAVREGYNGLVNDSIVPLNWGSVXXXXXXXXXXXXX
K6PF_SULDN      MKNIAILSSGGDVSGMNPAIKHFVEYALHNGLTPYFVYNGFEGLIDNKITKASHSDVAGIINRGGTILGS
K6PF_ASPNG      -RRIGVLTSGGDAPGMNGVVRAVVRMAIHSDCEAFAVYEGYEGLVNGMIRQLHWEDVRGWLSRGGTLIGS
K6PF_SULNB      MKNIAILCSGGDVSGMNAALKRFVEYAFDQGLTPFFVENGYEGLIDNKISKADYSDVAGIISIGGTKIRT
K6PF1_YEAST     -KKIAVMTSGGDSPGMNAAVRAVVRTGIHFGCDVFAVYEGYEGLLRGGKYLKKMADVRGWLSEGGTLIGT
K6PF1_ASPOR     -RRIGVLTSGGDAPGMNGAVRAVVRMAIYSGCEAYAVYEGYEGLVHGGIRQVHWEDVRGWLSRGGTLIGS
K6PF_ASPFU      -RRIGVLTSGGDAPGMNGAVRAVVRMAIYSDCEAYAVFEGYEGLVHGGIRQLHWEDVRGWLSKGGTLIGS
K6PF1_CANAL     -KKIGVMTSGGDAPGMNPAVRAVVRAGIYYGCDVYAVYEGYEGLVKGGLKKMEWSDVRSYMSLGGTSIGT
K6PF_THEEB      -KRLGVFTSGGDCPGLNTAIRAIVAHALSYGWEVLGILHATQGLIERKAIPLNAEGLGGLLNMGGTILGA
K6PL_PONAB      -KAIGVLTSGGDAQGMNAAVRAVTRMGIYVGAKVFLIHEGYEGLVEGNIKQANWLSVSNIIQLGGTVIGS
K6PF_MYCPE      MKKIAILTSGGDASTMNKCLSTFITYASKYNCEVVFVKNGYKGIYDNEFVKPDYTETKSWWSLPGTKIYS
K6PF2_CANAL     -RNIAVMTSGGDSQGMNAAVRAVVRATIFHGSKAFAVQEGYAGLVKGGIKEMKWQDVRGFLSEGGTNIGT
K6PL_RAT        -KAIGVLTSGGDAQGMNAAVRAVTRMGIYVGAKVFLIXXXXXXXXXXNIKPANWLSVSNIIQLGGTIIGS
K6PL_MOUSE      -KAIGVLTSGGDAQGMNAAVRAVTRMGIYVGAKVFLIXXXXXXXXXXNIKPANWLSVSNIIQLGGTIIGS
K6PF_CORGL      --RIATLTSGGDCPGLNAVIRGIVRTASNEGSTVVGYQDGWEGLLGDDDEDIDXXXXXXXXXXXXXXXHP
K6PF1_PICPA     -KKIAIITSGGDAPGMNAAVRAVTRAGIFYGCKVYACYEGYTGLVKGGLKELQWQDVRGLLSXXXXXXXX
K6PF_MYCPN      -KKIAILTSGGDAPGMNATLVYLTRYATSSEIEVFFVKNGYYGLYHDELVPAHQLDLSNSLFSAGTVIGS
K6PF1_KLULA     -KKIAVMTSGGDSQGMNAAVRAVVRSSIYYGCDVYAVYEGYEGLVKGGLRKMEWKDVRGWLSEGGTLIGT
K6PF2_KLULA     -KSIAVMTSGGDAPGMNANVRAIVRTAIFKGCNAFVVMEGYEGLVKGYIKQVYWETVRNWSCEGGTNIGT
K6PF_HAECO      ---VAVFTSGGDSQGMNGAVHSVVRMGIYLGCKVCFINEGYQGMVDGGDNIVEASSGSDIIQKGGTIIGS
K6PF_WOLSU      --RIGLVCSGGDCAGMNPATKKFVEYSLELGYEPYFIRXXXXXXXXXXXXPATLKEVSGILHKGGTILQS
K6PF2_YEAST     -KAIAVMTSGGDAPGMNSNVRAIVRSAIFKGCRAFVVMEGYEGLVRGGPEYIKEFHWEDVSAEGGTNIGT
K6PL_HUMAN      -KAIGVLTSGGDAQGMNAAVRAVTRMGIYVGAKVFLIXXXXXXXXXXNIKQANWLSVSNIIQLGGTIIGS
K6PL_BOVIN      -KAIGVLTSGGDAQGMNAAVRAVTRMGIYVGAKVFLIXXXXXXXXXXNIKQANWLSVSNIIQLGGTVIGS
K6PF_CAEEL      ---VGVLTSGGDSQGMNAAVRSVVRETIRQGHRCYLIREGYNGLINGNIELAKWAHVANVTHLGGSMIGT
K6PF1_YARLI     -KRIGVMTSGGDAPGMCXXXXXXXXXXXXXXCEVYAVREGYEGLVKGGIEPLSWEDVRGWLSLGGTLIGT
K6PF_SCHPO      -KKIAVMTSGGDSPGMNXXXXXXXXXXXHRGCDAFAIYEGYEGLVQGGIKQLQWGDVRGWLAEGGTLIGT
K6PF_MYCGE      MDKIAILTSGGDASGMNATIAYLTKYAIAKQLEVFYVKNGYYGLYHNHFITSKELDLTDFFFMGGTVIGS
K6PF_ANAVT      -KKIGILTSGGDCPGLNCVIRAVVSHALTYDWEVFGIPYATQGLIALNMHGWDLRGIDPLLNMGGTILGT
K6PF1_SYNY3     IKRIGILTSGGDCAGLNAVIRSVVHHAITYGWEVIGIQEATQGLMPSKAIALHRDNIDHLLMMGGTFLGT
K6PF2_ANASP     -KRIGILTSGGDCPGLNCVIRAVVSHALTYDWEVLGIPYATQGLIALNMHGWDLRGIDPLLNMGGTILGT
K6PF1_ANASP     -RRIGILTSGGDCSGLNAVIRAVVHCASGKGWEVFGIRQATLGLMAREIDQVDPXXXXXXXNKGDPFAFP
K6PF2_SYNY3     -KRIGILTSGGDCPGLNAVIRAVVKASALKGWEVYGIPYGTDGFVEGMLKGLDVLQFXXXXXXXXXXXXH
K6PF_CALFI      ----------------------------------------------------------------------
K6PF3_ARATH     -----IVTCGGLCPGLNTVIREIVSSSYMYGVKILGIDGGYRGFYAKNTVSLDSKVVNDIHKRGGTILGT
K6PF6_ARATH     --RACIVTCGGLCPGLNTVIREIVLHFMYGVTEVIGVDCGFRGFYSKNTVALTPKTVSDIHKRGGTILGT
K6PF5_ARATH     --KAAIITCGGLCPGLNDVIRHIVITLEIYGVKIVGIPFGYRGFSDKDLTPLSRKVVQNIXXXXXXXXXX
K6PF_UREPA      -KNILIITSGGDAPGMNASLISLIHRLMNNNFNVFIGIEGLLGLYNNLIEPIKDKRVFDVFNEQGTVIKT
K6PF4_ARATH     --KACIVTCGGLCPGINTVIREIVLNNMYGVNNILGIQGGYRGFYSKNTMNLTPKVVNDIHKRGGTFLQT
K6PF2_ARATH     --KAAIVTCGGLCPGMNTVIRELVLWELYGVREIYGIPAGYRGFYSMKAVKLDPKAVHDWHKKGGTVLAT
K6PF1_ARATH     -----IVTCGGLCPGLNTVIREIVGLSYMYGVKILGIDGGYRGFYARNTIHLDLKTVNDIHRSGGTILGT
K6PF7_ARATH     -----IVTCGGLCPGLNTVIREVVSSSYMYGVKILGIDGGYRGFYAKNTIPLNSKVVNDIHKXXXXXXXX
PFP_PROFR       VKKVALLTAGGFAPCLSSAIAELIKREVSPETTLIGYRYGYEGLLKGEFSPAVRAHYDRLFSFGGSPIGN
PFPB_SOLTU      --KIGVVLSGGQAPGGHNVISGIYLQTHCKGSTMYGFRGGPAGVMKGKYVVLTPEFIYPYRNQGGFDMIC
K6PF2_THET8     MKRIGVLTSGGDSPGMNAAIRAVVR---------------------------------------------
PFPA_SOLTU      ----------------------------------------------------------------------
PFPA_RICCO      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ARYPEFAQLEGQLKGIEQLKKHXXXXXXXXXXXXSYHGAMRLTEHGFPAIGLPGTIDNDIVGTDFTIGFD
K6PF_STRPI      ARYPEFAQLEGQLKGIEQLKKHXXXXXXXXXXXXSYHGAMRLTEHGFPAIGLPGTIDNDIVGTDFTIGFD
K6PF_STRP7      ARYPEFAQLEGQLKGIEQLKKHXXXXXXXXXXXXSYHGAMRLTEHGFPAIGLPGTIDNDIVGTDFTIGFD
K6PF_STRP4      ARYPEFAQLEGQLKGIEQLKKHXXXXXXXXXXXXSYHGAMRLTEHGFPAIGLPGTIDNDIVGTDFTIGFD
K6PF_STRZT      ARYPEFAQLEGQLKGIEQLKKHXXXXXXXXXXXXSYHGAMRLTEHGFPAIGLPGTIDNDIVGTDFTIGFD
K6PF_STRZP      ARYPEFAQLEGQLKGIEQLKKHXXXXXXXXXXXXSYHGAMRLTEHGFPAIGLPGTIDNDIVGTDFTIGFD
K6PF_STRZJ      ARYPEFAQLEGQLKGIEQLKKHXXXXXXXXXXXXSYHGAMRLTEHGFPAIGLPGTIDNDIVGTDFTIGFD
K6PF_STRPN      ARYPEFAQLEGQLKGIEQLKKHXXXXXXXXXXXXSYHGAMRLTEHGFPAIGLPGTIDNDIVGTDFTIGFD
K6PF_STRPJ      ARYPEFAQLEGQLKGIEQLKKHXXXXXXXXXXXXSYHGAMRLTEHGFPAIGLPGTIDNDIVGTDFTIGFD
K6PF_STRPS      ARYPEFAQLEGQLKGIEQLKKHXXXXXXXXXXXXSYHGAMRLTEHGFPAIGLPGTIDNDIVGTDFTIGFD
K6PF_STRR6      ARYPEFAQLEGQLKGIEQLKKHXXXXXXXXXXXXSYHGAMRLTEHGFPAIGLPGTIDNDIVGTDFTIGFD
K6PF_STRP2      ARYPEFAQLEGQLKGIEQLKKHXXXXXXXXXXXXSYHGAMRLTEHGFPAIGLPGTIDNDIVGTDFTIGFD
K6PF_STRGC      ARYPEFAQKEGQLKGIEQLKKHXXXXXXXXXXXXSYHGAMRLTEHGFPAVGVPGTIDNDIVGTDFTIGFD
K6PF_STRSV      ARYPEFAQVEGQLKGIEQLKKHXXXXXXXXXXXXSYHGAMRLTEHGFPAVGVPGTIDNDIVGTDFTIGFD
K6PF_STRSY      ARYPEFAKLEGQLKGIEQLKKHXXXXXXXXXXXXSYHGAMRLTEHGFPAIGVPGTIDNDIVGTDFTIGFD
K6PF_STRPZ      ARYPEFAQLEGQLAGIEQLKKHXXXXXXXXXXXXSYHGAMRLTEHGFPAVGIPGTIDNDIAGTDYTIGFD
K6PF_STRPM      ARYPEFAQLEGQLAGIEQLKKHXXXXXXXXXXXXSYHGAMRLTEHGFPAVGIPGTIDNDIAGTDYTIGFD
K6PF_STRPG      ARYPEFAQLEGQLAGIEQLKKHXXXXXXXXXXXXSYHGAMRLTEHGFPAVGIPGTIDNDIAGTDYTIGFD
K6PF_STRPD      ARYPEFAQLEGQLAGIEQLKKHXXXXXXXXXXXXSYHGAMRLTEHGFPAVGIPGTIDNDIAGTDYTIGFD
K6PF_STRPC      ARYPEFAQLEGQLAGIEQLKKHXXXXXXXXXXXXSYHGAMRLTEHGFPAVGIPGTIDNDIAGTDYTIGFD
K6PF_STRPB      ARYPEFAQLEGQLAGIEQLKKHXXXXXXXXXXXXSYHGAMRLTEHGFPAVGIPGTIDNDIAGTDYTIGFD
K6PF_STRP8      ARYPEFAQLEGQLAGIEQLKKHXXXXXXXXXXXXSYHGAMRLTEHGFPAVGIPGTIDNDIAGTDYTIGFD
K6PF_STRP6      ARYPEFAQLEGQLAGIEQLKKHXXXXXXXXXXXXSYHGAMRLTEHGFPAVGIPGTIDNDIAGTDYTIGFD
K6PF_STRP1      ARYPEFAQLEGQLAGIEQLKKHXXXXXXXXXXXXSYHGAMRLTEHGFPAVGIPGTIDNDIAGTDYTIGFD
K6PF_STRP3      ARYPEFAQLEGQLAGIEQLKKHXXXXXXXXXXXXSYHGAMRLTEHGFPAVGIPGTIDNDIAGTDYTIGFD
K6PF_STRTR      ARYPEFAQLEGQLKGIEQLKKYXXXXXXXXXXXXSYHGAMRLTEHGFPAVGLPGTIDNDIVGTDYTIGFD
K6PF_STRTD      ARYPEFAQLEGQLKGIEQLKKYXXXXXXXXXXXXSYHGAMRLTEHGFPAVGLPGTIDNDIVGTDYTIGFD
K6PF_STRS7      ARYPEFAQLEGQLAGIEQLKKHXXXXXXXXXXXXSYHGAMRLTEHGFPAVGIPGTIDNDIAGTDYTIGFD
K6PF_STRPF      ARYPEFAQLEGQLAGIEQLKKHXXXXXXXXXXXXSYHGAMRLTEHGFPAVGIPGTIDNDIAGTDYTIGFD
K6PF_STREM      ARYPEFAQLEGQLAGIEQLKKHXXXXXXXXXXXXSYHGAMRLTEHGFPAVGIPGTIDNDIAGTDYTIGFD
K6PF_STRE4      ARYPEFAQLEGQLAGIEQLKKHXXXXXXXXXXXXSYHGAMRLTEHGFPAVGIPGTIDNDIAGTDYTIGFD
K6PF_STRA5      ARYPEFAELEGQLKGIEQLKKHXXXXXXXXXXXXSYHGAMRLTEHGFPAVGLPGTIDNDIVGTDYTIGFD
K6PF_STRA3      ARYPEFAELEGQLKGIEQLKKHXXXXXXXXXXXXSYHGAMRLTEHGFPAVGLPGTIDNDIVGTDYTIGFD
K6PF_STRA1      ARYPEFAELEGQLKGIEQLKKHXXXXXXXXXXXXSYHGAMRLTEHGFPAVGLPGTIDNDIVGTDYTIGFD
K6PF_STRMU      ARYPEFAKLEGQLKGIEQLKKHXXXXXXXXXXXXSYHGAMRLTEHGFPAVGLPGTIDNDIVGTDYTIGFD
K6PF_STRU0      ARYPEFANLEGQLAGIEQLKKHXXXXXXXXXXXXSYHGAMRLTEHGFPAVGIPGTIDNDIAGTDYTIGFD
K6PF_LACLS      ARYPEFAQVEGQLAGIEQLKKFXXXXXXXXXXXXSYHGAMRLTEHGFPAVGLPGTIDNDIVGTDFTIGFD
K6PF_LACLM      ARYPEFAQVEGQLAGIEQLKKFXXXXXXXXXXXXSYHGAMRLTEHGFPAVGLPGTIDNDIVGTDFTIGFD
K6PF_LACLA      ARYPEFAQVEGQLAGIEQLKKFXXXXXXXXXXXXSYHGAMRLTEHGFPAVGLPGTIDNDIVGTDFTIGFD
K6PF_ENTFA      ARYPEFATEEGQLKGIEQLKKFGIEGLVVIGGDGSYHGAMALTKRGFPAVGIPGTIDNDIPGTDFTIGFD
K6PF_ANOFW      ARCPEFKTLEGQLKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEHGYPCVGVPGTIDNDIPGTDFTIGFD
K6PF_LISW6      ARYPEFATEEGQLKGIEQLKKHQIDGLVVIGGDGSYHGAEALTKRGFPTIGIPGTIDNDISGTDFTIGFD
K6PF_LISMO      ARYPEFATEEGQLKGIEQLKKHQIDGLVVIGGDGSYHGAEALTKRGFPTIGIPGTIDNDISGTDFTIGFD
K6PF_LISMF      ARYPEFATEEGQLKGIEQLKKHQIDGLVVIGGDGSYHGAEALTKRGFPTIGIPGTIDNDISGTDFTIGFD
K6PF_LISMC      ARYPEFATEEGQLKGIEQLKKHQIDGLVVIGGDGSYHGAEALTKRGFPTIGIPGTIDNDISGTDFTIGFD
K6PF_LISIN      ARYPEFATEEGQLKGIEQLKKHQIDGLVVIGGDGSYHGAEALTKRGFPTIGIPGTIDNDISGTDFTIGFD
K6PF_LISMH      ARYPEFATEEGQLKGIEQLKKHQIDGLVVIGGDGSYHGAEALTKRGFPTIGIPGTIDNDISGTDFTIGFD
K6PF_GEOKA      ARCPEFKTEEGQKKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEHGFPCVGVPGTIDNDIPGTDFTIGFD
K6PF_BACST      ARCPEFKTEEGQKKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEHGFPCVGVPGTIDNDIPGTDFTIGFD
K6PF_BACCN      ARCPEFKDPAVREKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEQGFPCVGVPGTIDNDIPGTDFTIGFD
K6PF_BACSU      ARCPEFKTVEGREKGIANLKKLGIEGLVVIGGDGSYMGAKKLTEHGFPCVGVPGTIDNDIPGTDFTIGFD
K6PF_BACLD      ARCPEFKTVEGREKGIANLKKYGIEGLVVIGGDGSYMGAKKLTEHGFPCVGVPGTIDNDIPGTDLTIGFD
K6PF_BACWK      ARCPEFKDPEVRLKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEQGFPCVGVPGTIDNDIPGTDFTIGFD
K6PF_BACHK      ARCPEFKDPEVRLKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEQGFPCVGVPGTIDNDIPGTDFTIGFD
K6PF_BACCZ      ARCPEFKDPEVRLKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEQGFPCVGVPGTIDNDIPGTDFTIGFD
K6PF_BACCQ      ARCPEFKDPEVRLKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEQGFPCVGVPGTIDNDIPGTDFTIGFD
K6PF_BACCE      ARCPEFKDPEVRLKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEQGFPCVGVPGTIDNDIPGTDFTIGFD
K6PF_BACC7      ARCPEFKDPEVRLKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEQGFPCVGVPGTIDNDIPGTDFTIGFD
K6PF_BACC3      ARCPEFKDPEVRLKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEQGFPCVGVPGTIDNDIPGTDFTIGFD
K6PF_BACC1      ARCPEFKDPEVRLKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEQGFPCVGVPGTIDNDIPGTDFTIGFD
K6PF_BACC0      ARCPEFKDPEVRLKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEQGFPCVGVPGTIDNDIPGTDFTIGFD
K6PF_BACAN      ARCPEFKDPEVRLKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEQGFPCVGVPGTIDNDIPGTDFTIGFD
K6PF_BACAH      ARCPEFKDPEVRLKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEQGFPCVGVPGTIDNDIPGTDFTIGFD
K6PF_BACAC      ARCPEFKDPEVRLKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEQGFPCVGVPGTIDNDIPGTDFTIGFD
K6PF_BACAA      ARCPEFKDPEVRLKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEQGFPCVGVPGTIDNDIPGTDFTIGFD
K6PF_BACA2      ARCPEFKTVEGREKGIENLKKLGIEGLVVIGGDGSYMGAKKLTEHGFPCVGVPGTIDNDIPGTDFTIGFD
K6PF_BACHD      ARCEEFKTLEGQKKGIEQLKKFGIEGLVVIGGDGSFAGAQKLTEHGFPTVGVPGTIDNDIPGTDFTIGFD
K6PF_BACC4      ARCPEFKDPEVRLKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEQGFPCVGVPGTIDNDIPGTDFTIGFD
K6PF_BACC2      ARCPEFKDPEVRLKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEQGFPCVGVPGTIDNDIPGTDFTIGFD
K6PF_BACCR      ARCLEFKDPEVRLKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEQGFPCVGVPGTIDNDIPGTDFTIGFD
K6PF_GEOSW      ARCPEFKTEEGQLKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEHGFPCVGVPGTIDNDIPGTDFTIGFD
K6PF_BACP2      ARCPEFKTVEGREKGIENLKKFGIEGLVVIGGDGSFMGAKKLTELGFPCVGVPGTIDNDIPGTDFTIGFD
K6PF_LACGA      ARFPEFKEEEVQLKGIEQLKKHGIDALVVIGGDGSYHGALKLTRHGYNAVGLPGSIDNDIPYTDFTIGFD
K6PF_LACJO      ARFPEFKEEEVQLKGIEQLKKHGIDALVVIGGDGSYHGALKLTRHGYNAIGLPGSIDNDIPYTDYTIGFD
K6PF_LACCB      ARYPQFAQEEGQLRGVEQLNKFGIEALVVIGGDGSYHGALALTRHGFNTIGLPGTIDNDIPYTDFTIGFD
K6PF_LACC3      ARYPQFAQEEGQLRGVEQLNKFGIEALVVIGGDGSYHGALALTRHGFNTIGLPGTIDNDIPYTDFTIGFD
K6PF_LACS1      ARFPEFAETETQLKGIEQLKKFGIEALVVIGGDGSYHGAEKLTMHGYNSIGVPGTIDNDIPGTDFTIGFD
K6PF_PEDPA      ARYPEFAQEESQLKGIEQLKKFGIDALVVIGGDGSYHGALRLTEHGYNTIGLPGTIDNDIPFTDFTIGFD
K6PF_LACDE      ARYPEFAEEEGQLAGIEQLKKHXXXXXXXXXXXXSYHGALQLTRHGFNSIGLPGTIDNDIPYTDATIGYD
K6PF_LACAC      ARFPEFAQEEVQQKGVEQLKKHXXXXXXXXXXXXSYHGALALTRHGVNSVGLPGTIDNDIPYTDYTIGFD
K6PF_BACSK      ARCEEFKTLEGQQKGIEQLKKFGIEGLVVIGGDGSYRGAQQLTKHGFPTIGVPGTIDNDIPGTDFTIGFD
K6PF_BACSH      ARCPEFKEDAVQQQGIENLRAAGIEGLVVIGGDGSYRGAMDLVKKGFPAVGVPGTIDNDVPGTEYTIGFD
K6PF_LACH4      ARFPEFAQEEVQQKGVEQLKKHXXXXXXXXXXXXSYHGALALTRHGVNSVGLPGTIDNDIPYTDYTIGFD
K6PF_SERP5      ARFPEFRDDSVRAKAIENLQNRGIDALVVIGGDGSYMGAKRLTEEGFPCIGLPGTIDNDVAGTDYTIGFF
K6PF_VIBPA      ARFPEFKQVEVREKAIENLKKHGIDALVVIGGDGSYMGAKKLTEMGYPCIGLPGTIDNDIAGTDYTVGYL
K6PF_VIBCH      ARFPQFREVEVREKAIENLKKHGIEALVVIGGDGSYMGAKKLTEMGFPCIGLPGTIDNDIAGTDYTIGYL
K6PF_LACPL      ARYPEFAHEEGQLKGIEQLKRFGIDALVVIGGDGSYHGALRLTEHGYNTIGLPGTIDNDIPYTDFTIGFD
K6PF_PECCP      ARFPQFRDEAVRQVCVENMKRRGLDALVVIGGDGSYMGAKRLTEMGFPCIGLPGTIDNDVAGTDYTIGYF
K6PF_ERWCT      ARFPQFRDEAVRQVCVENMQRRGLDALVVIGGDGSYMGAKRLTEMGFPCIGLPGTIDNDVAGTDYTIGYF
K6PF_EDWI9      ARFPEFRDEKVREKAVENMREFGLDALVVIGGDGSYLGAKRLTEMGFPCIGLPGTIDNDVAGTDYTIGYF
K6PF_VIBVY      ARFPEFKEVAVREKAIENLKAHGIDALVVIGGDGSYMGAKKLTEMGYPCIGLPGTIDNDIAGTDYTIGYL
K6PF_VIBVU      ARFPEFKEVAVREKAIENLKAHGIDALVVIGGDGSYMGAKKLTEMGYPCIGLPGTIDNDIAGTDYTIGYL
K6PF_STAES      ARCPQFKEEDVRKKAIENLRKRGIEGLVVIGGDGSYRGAQRISEEEIQTIGIPGTIDNDINGTDFTIGFD
K6PF_STAEQ      ARCPQFKEEDVRKKAIENLRKRGIEGLVVIGGDGSYRGAQRISEEEIQTIGIPGTIDNDINGTDFTIGFD
K6PF_PHOPR      ARFPEFKDEKVRAQAIQNLKMHGIEALVVIGGDGSYMGAKKLTEMGFPCIGIPGTIDNDVAGTDYTIGYF
K6PF_STACT      ARCPEFKDKEVRAKAIENLRSRXXXXXXXXXXXXSYRGAQRISEEEIQTIGIPGTIDNDIPGTDYTIGFD
K6PF_MACCJ      ARCPEFKDPEVRKQAIANLNNLGIEGLVVIGGDGSYRGAQRLNEEGIKTIGIPGTIDNDINGTDFTIGFD
K6PF_STAAW      ARCPEFKEQEVRKVAIENLRKRGIEGLVVIGGDGSYRGAQRISEEEIQTIGIPGTIDNDINGTDFTIGFD
K6PF_STAAT      ARCPEFKEQEVRKVAIENLRKRGIEGLVVIGGDGSYRGAQRISEEEIQTIGIPGTIDNDINGTDFTIGFD
K6PF_STAAS      ARCPEFKEQEVRKVAIENLRKRGIEGLVVIGGDGSYRGAQRISEEEIQTIGIPGTIDNDINGTDFTIGFD
K6PF_STAAR      ARCPEFKEQEVRKVAIENLRKRGIEGLVVIGGDGSYRGAQRISEEEIQTIGIPGTIDNDINGTDFTIGFD
K6PF_STAAN      ARCPEFKEQEVRKVAIENLRKRGIEGLVVIGGDGSYRGAQRISEEEIQTIGIPGTIDNDINGTDFTIGFD
K6PF_STAAM      ARCPEFKEQEVRKVAIENLRKRGIEGLVVIGGDGSYRGAQRISEEEIQTIGIPGTIDNDINGTDFTIGFD
K6PF_STAAE      ARCPEFKEQEVRKVAIENLRKRGIEGLVVIGGDGSYRGAQRISEEEIQTIGIPGTIDNDINGTDFTIGFD
K6PF_STAAC      ARCPEFKEQEVRKVAIENLRKRGIEGLVVIGGDGSYRGAQRISEEEIQTIGIPGTIDNDINGTDFTIGFD
K6PF_STAAB      ARCPEFKEQEVRKVAIENLRKRGIEGLVVIGGDGSYRGAQRISEEEIQTIGIPGTIDNDINGTDFTIGFD
K6PF_STAA9      ARCPEFKEQEVRKVAIENLRKRGIEGLVVIGGDGSYRGAQRISEEEIQTIGIPGTIDNDINGTDFTIGFD
K6PF_STAA2      ARCPEFKEQEVRKVAIENLRKRGIEGLVVIGGDGSYRGAQRISEEEIQTIGIPGTIDNDINGTDFTIGFD
K6PF_OCEIH      ARSEEFKTDEGQFRAIEQLNKHNIDGLVVIGGDGSFQGAKKLTEKGFPCIGVPGTIDNDIAGTDYTIGFD
K6PF_NATTJ      SRSEEFKTEMGQQKGFDNXXXXXXXXXXXXXXXXSFKGAEKLSQMGLPVIGVPGTIDNDIPETEMSIGFD
K6PF_HAEI8      ARFPEFKDPNVRAKCAEILRSHGIDALVVIGGDGSYMGAKLLTEHGFPCVGLPGTIDNDVAGTDYTIGYQ
K6PF_HAEIN      ARFPEFKDPNIRAKCAEILRSHGIDALVVIGGDGSYMGAKLLTEHSFPCVGLPGTIDNDVAGTDYTIGYQ
K6PF_HAEIE      ARFPEFKDPNIRAKCAEILRSHGIDALVVIGGDGSYMGAKLLTEHSFPCVGLPGTIDNDVAGTDYTIGYQ
K6PF_BUCAT      ARFASFYQDKIRSIAVQNIKKRKIDALVVIGGDGSYIGAQKLTEMGIPCISIPGTIDNDVSGTDYTIGYF
K6PF_BUCAI      ARFASFYQDKIRSIAVQNIKKRKIDALVVIGGDGSYIGAQKLTEMGIPCISIPGTIDNDVSGTDYTIGYF
K6PF_BUCA5      ARFASFYQDKIRSIAVQNIKKRKIDALVVIGGDGSYIGAQKLTEMGIPCISIPGTIDNDVSGTDYTIGYF
K6PF_HAEPS      ARFPEFKNPEVRAKCVETLKKYEIDALVVIGGDGSYMGAKLLTEHGIACIGLPGTIDNDVAGTDYTIGFQ
K6PF_ACTSZ      ARFPEFKQPEVRSKCAEILHSHGIDALVVIGGDGSYTGAKLLTEHGFPCIGLPGTIDNDIPGTDYTIGYQ
K6PF_TOLAT      ARFPAFKEESVRREAIANLNKHGIEALVVIGGDGSYMGAKKLTEMGYPCIGLPGTIDNDIAGTDFTIGFD
K6PF_HAEDU      ARFPQFKDIEVRKQAVKILAKYEIDALVVIGGDGSYMGAKLLTEEGYPCIGLPGTIDNDIVGTDYTIGYQ
K6PF_BUCAP      ARFPGFYKNEIRTIAVNNLNKRNIDALVVIGGDGSYIGAQKLTKMGIPCISIPGTIDNDVAGTDYTIGYF
K6PF_KLEP7      ARFPEFREEHIRAVAIENMKKRGLDALVVIGGDGSYMGAMRLTEMGFPCIGLPGTIDNDIKGTDYTIGFF
K6PF_KLEP3      ARFPEFREEHIRAVAIENMKKRGLDALVVIGGDGSYMGAMRLTEMGFPCIGLPGTIDNDIKGTDYTIGFF
K6PF_ENTS8      ARFPEFREEHIRAVAIENMKKRGIDALVVIGGDGSYMGAKRLTEMGFPCIGLPGTIDNDVAGTDYTIGYF
K6PF_TERTT      ARFPEFKEEAVREEAIKNLRKHEIDALVVVGGDGSYMGAKKLTEMGFPCIGLPGTIDNDVAGTDYTIGYF
K6PF_ENTCL      ARFPEFRDEHVREVAIENMKKRGLDALVVIGGDGSYMGAKRLTEMGFPCIGLPGTIDNDIKGTDYTIGFF
K6PF_MANSM      ARFPEFKNPEVRAKCAEILRSHGIDALVVIGGDGSYTGAKLLTEHGIQCIGLPGTIDNDAPGTDYTIGYQ
K6PF_ESCF3      ARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAMRLTEMGFPCIGLPGTIDNDIKGTDYTIGFF
K6PF_ACTPJ      ARFPQFKDPDVRKKSVETLKKYDIDALVVIGGDGSYMGAKLITEEGYPCIGIPGTIDNDIVGTDYTIGYQ
K6PF_ACTP7      ARFPQFKDPDVRKKSVETLKKYDIDALVVIGGDGSYMGAKLITEEGYPCIGIPGTIDNDIVGTDYTIGYQ
K6PF_ACTP2      ARFPQFKDPDVRKKSVETLKKYDIDALVVIGGDGSYMGAKLITEEGYPCIGIPGTIDNDIVGTDYTIGYQ
K6PF_PASMU      ARFPEFKDPAVRAKCAEILRSHGIDALVVIGGDGSYMGAKLLTEHGFPCVGIPGTIDNDVAGTDYTIGYQ
K6PF_ECO27      ARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAMRLTEMGFPCIGLPGTIDNDIKGTDYTIGFF
K6PF1_ECOL6     ARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAMRLTEMGFPCIGLPGTIDNDIKGTDYTIGFF
K6PF_SHISS      ARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAMRLTEMGFPCIGLPGTIDNDIKGTDYTIGFF
K6PF_SHIDS      ARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAMRLTEMGFPCIGLPGTIDNDIKGTDYTIGFF
K6PF_SHIBS      ARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAMRLTEMGFPCIGLPGTIDNDIKGTDYTIGFF
K6PF_SHIB3      ARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAMRLTEMGFPCIGLPGTIDNDIKGTDYTIGFF
K6PF_HAES2      ARFPEFKDPAVREKCVEILRSHGIDALVVIGGDGSYMGAKLLTEHDFPCVGIPGTIDNDVAGTDYTIGYQ
K6PF_HAES1      ARFPEFKDPAVREKCVEILRSHGIDALVVIGGDGSYMGAKLLTEHDFPCVGIPGTIDNDVAGTDYTIGYQ
K6PF_ECOSM      ARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAMRLTEMGFPCIGLPGTIDNDIKGTDYTIGFF
K6PF_ECOSE      ARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAMRLTEMGFPCIGLPGTIDNDIKGTDYTIGFF
K6PF_ECOLU      ARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAMRLTEMGFPCIGLPGTIDNDIKGTDYTIGFF
K6PF_ECOLC      ARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAMRLTEMGFPCIGLPGTIDNDIKGTDYTIGFF
K6PF_ECOL5      ARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAMRLTEMGFPCIGLPGTIDNDIKGTDYTIGFF
K6PF_ECOHS      ARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAMRLTEMGFPCIGLPGTIDNDIKGTDYTIGFF
K6PF_ECODH      ARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAMRLTEMGFPCIGLPGTIDNDIKGTDYTIGFF
K6PF_ECOBW      ARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAMRLTEMGFPCIGLPGTIDNDIKGTDYTIGFF
K6PF_ECO8A      ARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAMRLTEMGFPCIGLPGTIDNDIKGTDYTIGFF
K6PF_ECO81      ARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAMRLTEMGFPCIGLPGTIDNDIKGTDYTIGFF
K6PF_ECO7I      ARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAMRLTEMGFPCIGLPGTIDNDIKGTDYTIGFF
K6PF_ECO5E      ARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAMRLTEMGFPCIGLPGTIDNDIKGTDYTIGFF
K6PF_ECO55      ARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAMRLTEMGFPCIGLPGTIDNDIKGTDYTIGFF
K6PF_ECO45      ARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAMRLTEMGFPCIGLPGTIDNDIKGTDYTIGFF
K6PF_ECO24      ARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAMRLTEMGFPCIGLPGTIDNDIKGTDYTIGFF
K6PF1_SHIFL     ARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAMRLTEMGFPCIGLPGTIDNDIKGTDYTIGFF
K6PF1_ECOLI     ARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAMRLTEMGFPCIGLPGTIDNDIKGTDYTIGFF
K6PF1_ECO57     ARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAMRLTEMGFPCIGLPGTIDNDIKGTDYTIGFF
K6PF_VIBFM      ARFPEFKEVAVREKAIENLKKHDIDALIVIGGDGSYMGAKKLTEMGYPCIGLPGTIDNDIAGTDYTIGYL
K6PF_VIBF1      ARFPEFKEVAVREKAIENLKKHDIDALIVIGGDGSYMGAKKLTEMGYPCIGLPGTIDNDIAGTDYTIGYL
K6PF_SALTY      ARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAKRLTEMGFPCIGLPGTIDNDIKGTDYTIGYF
K6PF_SALTI      ARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAKRLTEMGFPCIGLPGTIDNDIKGTDYTIGYF
K6PF_SALSV      ARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAKRLTEMGFPCIGLPGTIDNDIKGTDYTIGYF
K6PF_SALPK      ARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAKRLTEMGFPCIGLPGTIDNDIKGTDYTIGYF
K6PF_SALPC      ARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAKRLTEMGFPCIGLPGTIDNDIKGTDYTIGYF
K6PF_SALPB      ARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAKRLTEMGFPCIGLPGTIDNDIKGTDYTIGYF
K6PF_SALPA      ARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAKRLTEMGFPCIGLPGTIDNDIKGTDYTIGYF
K6PF_SALNS      ARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAKRLTEMGFPCIGLPGTIDNDIKGTDYTIGYF
K6PF_SALHS      ARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAKRLTEMGFPCIGLPGTIDNDIKGTDYTIGYF
K6PF_SALEP      ARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAKRLTEMGFPCIGLPGTIDNDIKGTDYTIGYF
K6PF_SALDC      ARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAKRLTEMGFPCIGLPGTIDNDIKGTDYTIGYF
K6PF_SALCH      ARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAKRLTEMGFPCIGLPGTIDNDIKGTDYTIGYF
K6PF_SALAR      ARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAKRLTEMGFPCIGLPGTIDNDIKGTDYTIGYF
K6PF_SALA4      ARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAKRLTEMGFPCIGLPGTIDNDIKGTDYTIGYF
K6PF_ENT38      ARFPEFREEHIRQVAIENMKKRGLDALVVIGGDGSYMGAKRLTEMGFPCIGLPGTIDNDIKGTDYTIGFF
K6PF_CITK8      ARFPEFRDENVRAVAIENLKKRGIDALVVIGGDGSYMGAKRLTEMGFPCIGLPGTIDNDIKGTDYTIGYF
K6PF_SALG2      ARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAKRLTEIGFPCIGLPGTIDNDIKGTDYTIGYF
K6PF_BACMC      ARCKEFMTPEGQQKGADILRKRXXXXXXXXXXXXSYHGANKLSKLGINTMALPGTIDNDISYTDFTIGFD
K6PF_THETN      ARCEEFKQKEVRKKAYETLQKHGIEGLVVIGGDGSFRGAQLLSEENVNTICIPGTIDNDIPCTDYTIGFD
K6PF_CLONN      ARCEEFKTEAGRKKGVNILKAFXXXXXXXXXXXXSFQGAQLLSKLGVKTIGIPGTIDNDLAYTDYTIGFD
K6PF_ALISL      ARFPEFKEVAVREKAIANLKKHDIDALIVIGGDGSYMGAKKLTEMGYPCIGLPGTIDNDIAGTDYTIGYL
K6PF_SODGM      ARFPEFREEGTRAIAIENMTKRGLDALVVIGGDGSYMGAKRLTEMGFPCIGLPGTIDNDVAGTDYTIGYF
K6PF_CLOBL      ARCEEFRTEQGREKAAKILKAFXXXXXXXXXXXXSFHGAQLLSKLGINTVGLPGTIDNDLAYTDYTIGFD
K6PF_CLOBK      ARCEEFRTEQGREKAAKILKAFXXXXXXXXXXXXSFHGAQLLSKLGINTVGLPGTIDNDLAYTDYTIGFD
K6PF_CLOBJ      ARCEEFRTEQGREKAAKILKAFXXXXXXXXXXXXSFHGAQLLSKLGINTVGLPGTIDNDLAYTDYTIGFD
K6PF_CLOBH      ARCEEFRTEQGREKAAKILKAFXXXXXXXXXXXXSFHGAQLLSKLGINTVGLPGTIDNDLAYTDYTIGFD
K6PF_CLOB1      ARCEEFRTEQGREKAAKILKAFXXXXXXXXXXXXSFHGAQLLSKLGINTVGLPGTIDNDLAYTDYTIGFD
K6PF_BAUCH      ARFQEFREEAIRAIALNNMSKYGLGALVVIGGDGSYMGAKLLTEMGLPCIGLPGTIDNDVAGTDYTIGYF
K6PF_ERWT9      ARFPEFRNEDVRSVAIENMKKRGIDALVVIGGDGSYMGAKRLTEMGFPCIGLPGTIDNDVAGTDYTIGYF
K6PF_CLOBM      ARCEEFRTEQGREKAAKILKAFXXXXXXXXXXXXSFHGAQLLSKLGINTVGLPGTIDNDLAYTDYTIGFD
K6PF_CLOB6      ARCEEFRTEQGREKAAKILKAFXXXXXXXXXXXXSFHGAQLLSKLGINTVGLPGTIDNDLAYTDYTIGFD
K6PF_HALOH      ARCEEFKTEEGRQKALKKMKXXXXXXXXXXXXXXSFRGAEKVSELGIPAIGIPGTIDNDLACTDFTIGFD
K6PF_CLOBB      ARCPEFKDEEVRKRAVKILNAYGVDALVVIGGDGSFMGAKLLSKLGIKTIGLPGTIDNDLAYTDFTIGFD
K6PF_CLOD6      SRCEEFKTEEGRLKAVKILKKYKIDCLVVIGGDGSFAGAQKLSDLGFPAIGIPGTIDNDLAYTDYTIGFD
K6PF_ALKOO      ARSEEFMTEEGQRKALNVIKVLGIEGIVAIGGDGSIRGAKTLNELGIPTIGVPGTIDNDLAYTDYTIGFD
K6PF_VIBHB      ARFPEFKEVEVREQAIENLKKHGIDALVVIGGDGSYMGAKKLTEMGYPCIGLPGTIDNDIAGTDYTIGYL
K6PF_CLOTE      ARSEEFKTEEGQKKATDILRVFGVEGLVVIGGDGSFQGAKSLSELGVKTIGIPGTIDNDLAYTDYTIGFD
K6PF_BLOFL      SRFPELKKDMIRSVVMNNISKSHLDALVIIGGDGSYIGARRLSDLGCPCIGIPGTIDNDVAGTDYTIGYF
K6PF_BREBN      ARSEAFKTEAGQQRAVEQLRAHEIEGLIVIGGDGSFRGAQKLTEKGFPTIGVPGTIDNDIPCTDFTIGFD
K6PF_CLOBA      ARCPEFKDEEVRKRAVKILNAYGVDALVVIGGDGSFMGAKLLSKLGIKTIGLPGTIDNDLAYTDFTIGFD
K6PF_ALKMQ      ARCEEFRTEEGRKKALNXXXXXXXXXXXXXXXXXSFQGAKKLSELGIPTVAVPGTIDNDLGYSDYTIGFD
K6PF1_CLOPE     ARCLEFKQEEVREKAAQILKAYGVEALVVIGGDGSFMGAKLLSKLGVKTVGLPGTIDNDLSYTDYTIGFD
K6PF_THEPX      ARCEEFKKKEVRKKAYETLQKHGIEGLVVIGGDGSFRGAQLLSEENVNTIGIPGTIDNDIPCTDYTIGFD
K6PF_THEP3      ARCEEFKKKEVRKKAYETLQKHGIEGLVVIGGDGSFRGAQLLSEENVNTIGIPGTIDNDIPCTDYTIGFD
K6PF_BUCBP      ARFSNFFKKDIRSIAIKNMQQRNIDFLVVIGGDGSYVGAQKLTEMGFPCISIPGTIDNDVAGTDYTIGYF
K6PF_FINM2      ARCPEFKTEEGQKKGAQILKDFGIXXXXXXXXXXSFKGASALSKIGISTIGIPCTIDNDMGYTDYTIGFF
K6PF_FUSNN      ARSEEFKEARFREIAANNLKKKGINYLVVIGGDGSYRGANLLKEHGIKVVGIPGTIDNDICGTDFTLGFD
K6PF_YERE8      ARFPEFRDPEIRKIALQNMKERXXXXXXXXXXXXSYAGADLLTEGGIHCVGLPGTIDNDVAGTDYTIGFF
K6PF_CLOAB      ARCPEFLKEEVRQKAANVLRVFGIDGLVVIGGNGSFMGAQKLSKLGVKTVGLPGTIDNDLPYTDYTIGFD
K6PF_DEIRA      ARSHTWRSPEGRAKGAAVLREWXXXXXXXXXXXXSFHGGYFLQEHGIPVIGVPGTIDNDLYGTDHTIGYF
K6PF_YERPP      ARFPEFRDPEVRKVALKNMHERXXXXXXXXXXXXSYAGADLLTEGGIHCVGLPGTIDNDVAGTDYTIGFF
K6PF_YERPN      ARFPEFRDPEVRKVALKNMHERXXXXXXXXXXXXSYAGADLLTEGGIHCVGLPGTIDNDVAGTDYTIGFF
K6PF_YERPG      ARFPEFRDPEVRKVALKNMHERXXXXXXXXXXXXSYAGADLLTEGGIHCVGLPGTIDNDVAGTDYTIGFF
K6PF_YERPE      ARFPEFRDPEVRKVALKNMHERXXXXXXXXXXXXSYAGADLLTEGGIHCVGLPGTIDNDVAGTDYTIGFF
K6PF_YERPA      ARFPEFRDPEVRKVALKNMHERXXXXXXXXXXXXSYAGADLLTEGGIHCVGLPGTIDNDVAGTDYTIGFF
K6PF_YERP3      ARFPEFRDPEVRKVALKNMHERXXXXXXXXXXXXSYAGADLLTEGGIHCVGLPGTIDNDVAGTDYTIGFF
K6PF_YERPY      ARFPEFRDPEVRKVALKNMHERXXXXXXXXXXXXSYAGADLLTEGGIHCVGLPGTIDNDVAGTDYTIGFF
K6PF_YERPS      ARFPEFRDPEVRKVALKNMHERXXXXXXXXXXXXSYAGADLLTEGGIHCVGLPGTIDNDVAGTDYTIGFF
K6PF_YERPB      ARFPEFRDPEVRKVALKNMHERXXXXXXXXXXXXSYAGADLLTEGGIHCVGLPGTIDNDVAGTDYTIGFF
K6PF_HAMD5      ARFPEFTQKENRARAIKNLNSHGIDALVVIGGDGSYAGAELLAEGGIHCVGLPGTIDNDVAGTDYSIGFF
K6PF_CYTH3      ARSEEFRSPEGRRKAFDQIQKFGIDGLVAIGGNGTFTGALFYNEYQIPCVGAPGTIDNDLYGSDFTIGYD
K6PF_MYCCT      ARLPEFKELEVRQKAVANLKKAGIEALVVIGGDGSYMGAQRLTEMGINCIGLPGTIDNDIASTDYTIGFH
K6PF_PERMH      AREDRFLEYKYRKIAANNIREEKIDGLFVIGGNGSFQGAYLLSEFGIPIIGIPKTIDNDTYGTEYTIGFD
K6PF_THENN      SRCEEFKTEEGREAAAKQLKKHXXXXXXXXXXXXXXTGAHLLEEHNIPVVGIPATIDNDIGLTDMCIGVD
K6PF_THET2      ARSQEFLTEEGRAKAYAKLQAAGIEGLVAIGGDGTFRGALCLVEHGMPVVGVPGTIDNDLYGTDYTIGFD
K6PF1_THET8     ARSQEFLTEEGRAKAYAKLQAAGIEGLVAIGGDGTFRGALCLVEHGMPVVGVPGTIDNDLYGTDYTIGFD
K6PF2_BACTN     ARCKEFTTPEGRQLAYDNMKREGIDALVIIGGDGSLTGAIFAQEFDVPCIGLPGTIDNDLYGTDTTIGYD
K6PF_SULSY      AREPRFKDYNFRKIAYENIQKHNIEALFVIGGNGSFQGAYLLQDFGLNIIGIPKTIDNDIYGTDYAIGFD
K6PF_COXBU      GRFENFRFKAVRDKAREFLKKLQIDAMIVLGGNGSFAGASKLYQEGGPQIGIPCTIDNDIQGTDYCIGFD
K6PF_AQUAE      SRDPRYKKLEYREKAYKNLNXXXXXXXXXXXXXXXXXXXLTAEETGIPVIGVPCTIDNDVGGTEYCIGYD
K6PF_BUCCC      SRFLEFKLEKTRKIAIKNIYKRKIDCLIIIGGDGSYKAANFLTNMGVPCIGIPGTIDNDVSGTDYTVGYF
K6PF_MYCPU      ARFVEFAQEKYRQVAKENLLKLGIEALVVIGGDGSYKGAQKLHEMGIKTIALPGTIDNDITSSDFTIGYD
K6PF_THESQ      SRCEEFKTEEGRELAAKQIKKHXXXXXXXXXXXXXXTGAHLLEEHKIPVVGIPATIDNDIGLTDMCIGVD
K6PF_THEP1      SRCEEFKTEEGRELAAKQIKKHXXXXXXXXXXXXXXTGAHLLEEHKIPVVGIPATIDNDIGLTDMCIGVD
K6PF1_BACTN     ARSETFTTPEGRKKAYKVIQKENINALIIIGGDGSLTGAIFAEEYDVTCIGLPGTIDNDLYGTDFTIGYD
K6PF_THEMA      SRCEEFKTEEGRELAAKQIKKHXXXXXXXXXXXXXXTGAHLLEEHKIPVVGIPATIDNDIGLTDMCIGVD
K6PF_MYCMO      ARYLEFKKLEVRQKAVQNLKEMGIDSLVVIGGDGSYAGAQLLHELGVKTIGLPGTIDNDIASTEYTIGLD
K6PF_MYCH7      SRFPEFKKEEVQNKAVEILSEIGISSLVVVGGDGTYNGGYKLHLKGIKVIALPGTIDNDIQFTDYTIGFD
K6PF_MYCH2      SRFPEFKKEEVQNKAVEILSEIGISSLVVVGGDGTYNGGYKLHLKGIKVIALPGTIDNDIQFTDYTIGFD
K6PF_MYCHJ      SRFPEFKKEEVQNKAVEILSEIGISSLVVVGGDGTYNGGYKLHLKGIKVIALPGTIDNDIQFTDYTIGFD
K6PF_SPICI      ARLPEFKDPEVQKKAVDILKKQEIAALVVIGGDGSYQGAQRLTELGINCIALPGTIDNDITSSDYTIGFD
K6PF3_STRCO     SRVPEHLR-----DGVERARGHVEELGLDAIIPIGGEGTLKLSDNGLPIVGVPKTIDNDIAVTDVTFGFD
K6PF_CHLSY      TRSDELSEADPYVRAVKAIEEMGLRALITIGGEGTQRIALELHKLGAPVIGVPKTIDNDLAGTDRTFGFD
K6PF_CHLAD      TRSDELSEADPYVRAVKAIEEMGLRALITIGGEGTQRIALELHKLGAPVIGVPKTIDNDLAGTDRTFGFD
K6PF_CHLAA      TRSDELSEADPYVRAVKAIEEMGLRALITIGGEGTQRIALELHKLGAPVIGVPKTIDNDLAGTDRTFGFD
K6PF2_STRCO     SRLERDRLREACENAGDMIQNFGIDALIPIGGEGTLTAARMLSDAGLPVVGVPKTIDNDISSTDRTFGFD
K6PF1_STRCO     SRTNPLKQRDGIRRIKDNLAALGVEALITIGGEDTLGVATRLAEYGVPCVGVPKTIDNDLSATDYTFGFD
PFP_AMYME       SRTNPYKEEGGVEKIRAVLADQGVDALIAIGGEDTLGVAKKLTDDGIGVVGVPKTIDNDLAATDYTFGFD
PFP_AMYMD       SRTNPY-KVEGGVDKIKQVLADQGVDALIAIGGEDTLGAKRLTDDGIGVVGVPKTIDNDLGATDYTFGFD
K6PF2_ASPOR     VRCDRFREREGRLQAARNMVLFGIDALVVCGGDGSLTGAAQVAPHNLNIVGLLGSIDNDFSGTDATIGCY
K6PF3_BACTN     SREKPFSDVDKPALILQNIQEMGLDCVVCIGGNGTQKTAAKFAAMGVNIVSVPKTIDNDIWGTDISFGFD
K6PF2_CLOPE     SNKDNLFDYQVEDEGVENLKKEGVDALVVIGGDGTLTSARDFSRKGVNVIGVPKTIDNDLLATDVTFGFN
K6PF_DROME      ARCQDFRERQGRLKAANNLIQRGITNLVVIGGDGSLTGANLFRQEWLHIVGLVGSIDNDFCGTDMTIGTD
PFP_DICTH       SRTNPFKKEEDVQKCVENFKKLNLDALIAIGGEDTLGVASKFSKLGLPMIGVPKTIDKDLEETDYTLGFD
K6PF_COREF      DKFRA---------GIDQVKANLADAGIDALIPIGGEGTLKLADNGIPVVGVPKTIDNDVNGTDFTFGFD
K6PP_HUMAN      ARCQAFRTREGRLKAACNLLQRGITNLCVIGGDGSLTGAEELARNGLNVVGMVGSIDNDFCGTDMTIGTD
K6PF_MYCTU      ARVHPDKLRAGLPQIMQTLDDNGIDVLIPIGGEGTLTAASWLSEENVPVVGVPKTIDNDIDCTDVTFGHD
K6PF_MYCBO      ARVHPDKLRAGLPQIMQTLDDNGIDVLIPIGGEGTLTAASWLSEENVPVVGVPKTIDNDIDCTDVTFGHD
K6PP_RABIT      ARSKAFRTREGRLKAACNLIHRGITNLCVIGGSGSLTGAEELAQDGLNVVGMVGSIDNDFCGTDMTIGTD
K6PP_PONAB      ARCQAFRTREGRLKAACNLLQRGITNLCVIGGDGSLTGAEELARNGLNVVGMVGSIDNDFCGTDMTIGTD
K6PF_SCHMA      ARCMDFRERYGRLKAAENLVKNQITNLVVIGGDGSLTGASSLLEHRLNIVGLVGSIDNDFCGTDMTIGAD
K6PF_HUMAN      ARCKDFREREGRLRAAYNLVKRGITNLCVIGGDGSLTGADKITDEELNIVGLVGSIDNDFCGTDMTIGTD
K6PF_CANFA      ARCKDFREREGRLRAAHNLVKRGITNLCVIGGDGSLTGAEEATKSSYNIVGLVGSIDNDFCGTDMTIGTD
K6PF_MOUSE      ARCKDFREREGRLRAAHNLVKRGITNLCVIGGDGSLTGADTLQKDGLNIVGLVGSIDNDFCGTDMTIGTD
K6PF_RABIT      ARCKDFREREGRLRAAHNLVKRGITNLCVIGGDGSLTGASDLQKAGLNIVGLVGSIDNDFCGTDMTIGTD
K6PF_BOVIN      ARCKDFREREGRLRAAHNLVKRGITNLCVIGGDGSLTGASDLQKSGLNIVGLVGSIDNDFCGTDMTIGTD
K6PP_MOUSE      ARCKAFRSREGRLKAACNLARLGITNLCVIGGDGSLTGAEELARNGLNVVGMVGSIDNDFCGTDMTIGTD
K6PF_PIG        ARCKDFREREGRLRAAHNLVKRGITNLCVIGGDGSLTGADTFSEWGLNIVGLVGSIDNDFCGTDMTIGTD
K6PF_MYCLE      AHHPD--KLRAGLHQIKQLDDNGIDVLIPIGGEGTLTAAHWLSQEDVPVVGVPKTIDNDIDCTDVTFGHD
K6PF_RAT        ARCKDFREREGRLRAAHNLVKRGITNLCVIGGDGSLTGAERTKSSYLNIVFLVGSIDNDFCGTDMTIGTD
K6PF_PONAB      ARCKDFREREGRLRAAYNLVKRGITNLCVIGGDGSLTGADKITDEELNIVGLVGSIDNDFCGTDMTIGTD
K6PF_MACFA      ARCKDFREREGRLRAAYNLVKRGITNLCVIGGDGSLTGAGKITDEELNIVGLVGSIDNDFCGTDMTIGTD
K6PF_HORSE      ARCKDFREREGRLRAAHNLVKLGITNLCVIGGDGSLTGAEEATKSNYNIVGLVGSIDNDFCGTDMTIGTD
K6PP_RAT        ARCQAFRSREGRLKAACNLVRLGITNLCVIGGDGSLTGAEELAKNGLNVVGMVGSIDNDFCGTDMTIGTD
K6PF_DICDI      XXSAEFRTREGRKRAVFNLVKNRIDNLLVIGGDGSLTGALDVMEH-FPILGIVGSIDNDMCGTDLTVGAD
K6PF_SULDN      SRSKRF-----MLKNYREVKKNLDALDIDMLIVLGGDGSFRYKEHGVKFCGIPSTIDNDINGTIYCLGVD
K6PF_ASPNG      ARCMTFRERPGRLRAAKNMVLRGIDALVVCGGDGSLTGAKELVETGLNIVGLVGSIDNDMSGTDATIGCY
K6PF_SULNB      SRSERFKEISYRQIALENLRXXXXXXXXXXXXXXSFKGMQKLSDEGF--IGIPSTIDNDIAGTQYCLGVD
K6PF1_YEAST     ARSMEFRKREGRRQAAGNLISQGIDALVVCGGDGSLTGA-DLFRHEWPSVGLVGSIDNDMSGTDSTIGAY
K6PF1_ASPOR     ARSMAFRERAGRLKAAKNMIVRGIDALVVCGGDGSLTGADELTEEQIVPVGLVGSIDNDMSGTDATIGCY
K6PF_ASPFU      ARSMAFRERAGRLKAAKNMVLRGIDALVVCGGDGSLTGADELTEEQIEPVGLVGSIDNDMSGTDATIGCY
K6PF1_CANAL     ARCKEFRERAGRLQGAYNMIKNGIDALVVCGGDGSLTGAKELVDTGLTIVGLVGSIDNDMSGTDVTIGAF
K6PF_THEEB      INKGDLGHADEVIAGYYELGLDALIAICGDGSLRILHQLAQKGNWNFLAI--PKTIDNDVALTDRAIGFD
K6PL_PONAB      ARCKAFTTREGRRAAAYNLVQHGITNLCVIGGDGSLTGAMARTYSHLNIAGLVGSIDNDFCGTDMTIGTD
K6PF_MYCPE      SRFPEILDEQVRKQMVDNLHKNSIDTLVVIGGDGSYKGARLLSKSGIKVIGLPGTIDNDIASTSYSIGFD
K6PF2_CANAL     ARCMEFKERWGRLKGCKNLIDAGIDGLIVCGGDGSLTGA-DLFRHEWPSLGMVGSIDNDMAMTDATIGGY
K6PL_RAT        ARCKAFTTREGRLAAAYNLLQHGITNLCVIGGDGSLTGAEELVKEGLSIAGLVGSIDNDFCGTDMTIGTD
K6PL_MOUSE      ARCKAFTTREGRLAAAYNLLQHGITNLCVIGGDGSLTGAEELVKEGLTIAGLVGSIDNDFCGTDMTIGTD
K6PF_CORGL      DKFKA---------GIDQIKANLEDAGIDALIPIGGEGTLKLSDNGIPVVGVPKTIDNDVNGTDFTFGFX
K6PF1_PICPA     ARSKEFRERWGRLQACYNMVSNGIDALVVCGGDGSLTGADLFTHRNLTIVGLVGSIDNDMCGTDSTIGAY
K6PF_MYCPN      KRFVEFKELKVREQAAQNLKKRQIDYLVVIGGDGSYMGAKLLSELGVNCYCLPGTIDNDINSSEFTIGFL
K6PF1_KLULA     ARSKEFRERWGRKQACSNLIDQGIDALVVIGGDGSLTGADKFTEQNLTIVGMVGSIDNDMSGTDSTIGAY
K6PF2_KLULA     ARCKEFREREGRLLGALHLIEAGVDALIVCGGDGSLTGARELLDQGLNICGTVGSIDNDMSTTDATIGAY
K6PF_HAECO      ARCTDLRQREGRMKAAYNLIEKGITNLVVIGGDGSLIGANQFRKDNIQIVGLVGSIDNDFCGTDMTIGTD
K6PF_WOLSU      SRSKRFFDPAFRLQAYQNLQRHSIEALVTLGGDGSFRAMEVLAEHSLLYAGIPATIDNDIRASDYALGVD
K6PF2_YEAST     ARCMEFKKREGRLLGAQHLIEAGVDALIVCGGDGSLTGA-DLFRSEWPSLGTVGSIDNDMSTTDATIGAY
K6PL_HUMAN      ARCKAFTTREGRRAAAYNLVQHGITNLCVIGGDGSLTGATARTYSHLNIAGLVGSIDNDFCGTDMTIGTD
K6PL_BOVIN      ARCKAFTTREGRRAAAYNLVQRGITNLCVIGGDGSLTGAEELVSEGLNIAGLVGSIDNDFCGTDMTIGTD
K6PF_CAEEL      SRCDEFRTTDGRKKAAAIMFDKRIFHLIVIGGDGSLMGAQKLKEEWLHLAGIVGSIDNDCIESDKSIGSD
K6PF1_YARLI     ARCKEFREREGRLAGALNMVKNGIDALIVIGGDGSLTGADLFREE-WPSLGMVGSIDNDMATTDVTIGAY
K6PF_SCHPO      ARCMAFRERPGRLRAAKNLISAGIDSIIVCGGDGSLTGAAKLYRH-LTIVGLVGSIDNDMSSTDVTIGAF
K6PF_MYCGE      SRFKQFQDPSLRKQAVLNLKKRGINNLVVIGGDGSYMGAKALSELGLNCFCLPGTIDNDVNSSEFTIGFW
K6PF_ANAVT      INKGDLAHVDEMLASYEALALDALIVIGGDGSLGILH---ELASRGWNLVAIPKTIDSDVALTERAVGFD
K6PF1_SYNY3     TNKGNFPMADGTVRDIAGYRQXXXXXXXXXXXXXXXXXXRRIAQQGINLVGIPKTIDNDVGATEISIGFD
K6PF2_ANASP     INKGDLAHVDEMLASYQALALDALIVIGGDGSLGILH---ELASRGWNLVAIPKTIDNDVALTERAVGFD
K6PF1_ANASP     MPDGSFCDRSSEI--IAGYHQXXXXXXXXXXXXXXXXXXRRLAQQGINLVGIPKTIDNDIGITEHAIGFD
K6PF2_SYNY3     PEQPAIA--EAILKGYAILDLEALIVIGGDGSLDIIYDLAQ--KGNWHIIAIPKTIDNDVPFTDLAVGFS
K6PF_CALFI      -------------------------------------------------VGMVGSIDNDFCGTDMTIGTD
K6PF3_ARATH     SRGGH-----DTTKIVDSIQDRGINQVYIIGGDGTQRGASVIFEEKVAVIGIPKTIDNDIPVIDKSFGFD
K6PF6_ARATH     SRGGDTSKIVDNIQDREINQVYIIGGDGTQKGANAIYKEIRRRGLKVAVAGIPKTIDNDIPVIDKSFGFD
K6PF5_ARATH     XXXXXXXEIVDSMRGINML--FVLGGNGTHAGANAIHNECRKRKIKVAVVGVPKTIDNDILHMDKTFGFD
K6PF_UREPA      SRFIKLDINDKKTQIIDNLLSHNIQKIIILGGQGSMQAGLVLTKMGFEVFGILHTIDNDFSETQMCIGAL
K6PF4_ARATH     SRGGH-----DTAKIVDNIQDRGINQVYIIGGGGTQKGAEKIYEEQVAVSGIPKTIDNDIAVIDKSFGFD
K6PF2_ARATH     SRGGFHLQ-----KIVDAIHLNGYNQVYIIGGDGTMRGALRKLEVGITVI--PKTVDNDVGIIDRSFGFQ
K6PF1_ARATH     SRGGH-----NTTKIVDSIQDRGINQVYIIGGDGSQKGAAAIFEEKVAVAGIPKTIDNDIPIIDRSFGFD
K6PF7_ARATH     XXXXHDTN-----KIVDSIQDRGINQVYIIGGDGTQRGASVIFEEKVAVVGIPKTIDNDIPVIDKSFGFD
PFP_PROFR       SRVKLTNVKDLVARGLDPLKVAADQLIADGVDVLHTIGGXXXXQHDYPVVGLPKTIDNDIVPIRQSLGAW
PFPB_SOLTU      SGRDKIETPEQFKQAEETAKKXXXXXXXXXXXXXSNTNACLLAENKTRVIGCPKTIDGDLKSKEVSFGFD
K6PF2_THET8     ----------------------------------------------------------------------
PFPA_SOLTU      -------------------------------------------------VGVPVTLNGDLKNVEANVGFD
PFPA_RICCO      -------------------------------------------------VGVPVTLNGDLKNVETNVGFD


                         +         .         .         .         .         *         .:210
query           TAVTTAMDAIDKIRDTSSSHRRTFVIEVMGRNAGDIALWAGIATGADEIIIPEADFKMEDIVASIKAGYE
K6PF_STRPI      TAVTTAMDAIDKIRDTSSSHRRTFVIEVMGRNAGDIALWAGIATGADEIIIPEADFKMEDIVASIKAGYE
K6PF_STRP7      TAVTTAMDAIDKIRDTSSSHRRTFVIEVMGRNAGDIALWAGIATGADEIIIPEADFKMEDIVASIKAGYE
K6PF_STRP4      TAVTTAMDAIDKIRDTSSSHRRTFVIEVMGRNAGDIALWAGIATGADEIIIPEADFKMEDIVASIKAGYE
K6PF_STRZT      TAVTTAMDAIDKIRDTSSSHRRTFVIEVMGRNAGDIALWAGIATGADEIIIPEAGFKMEDIVASIKAGYE
K6PF_STRZP      TAVTTAMDAIDKIRDTSSSHRRTFVIEVMGRNAGDIALWAGIATGADEIIIPEAGFKMEDIVASIKAGYE
K6PF_STRZJ      TAVTTAMDAIDKIRDTSSSHRRTFVIEVMGRNAGDIALWAGIATGADEIIIPEAGFKMEDIVASIKAGYE
K6PF_STRPN      TAVTTAMDAIDKIRDTSSSHRRTFVIEVMGRNAGDIALWAGIATGADEIIIPEAGFKMEDIVASIKAGYE
K6PF_STRPJ      TAVTTAMDAIDKIRDTSSSHRRTFVIEVMGRNAGDIALWAGIATGADEIIIPEAGFKMEDIVASIKAGYE
K6PF_STRPS      TAVTTAMDAIDKIRDTSSSHRRTFVIEVMGRNAGDIALWAGIATGADEIIIPEAGFKMEDIVASIKAGYE
K6PF_STRR6      TAVTTAMDAIDKIRDTSSSHRRTFVIEVMGRNAGDIALWAGIATGADEIIIPEAGFKMEDIVASIKAGYE
K6PF_STRP2      TAVTTAMDAIDKIRDTSSSHRRTFVIEVMGRNAGDIALWAGIATGADEIIIPEAGFKMEDIVASIKAGYE
K6PF_STRGC      TAVTTAMDAIDKIRDTSSSHRRTFVVEVMGRNAGDIALWAGIATGADEIIVPEEGFKFEEIVASIKHGYE
K6PF_STRSV      TAVTTAMDAIDKIRDTSSSHRRTFVIEVMGRNAGDIALWAGIASGADEIIVPEEGFKIEEVVESIKNGYA
K6PF_STRSY      TAVTTAMDAIDKIRDTSSSHRRTFVVEVMGRHAGDIALWAGIASGADVIVVPEEDFNINDVVDRIKAGYD
K6PF_STRPZ      TAVNTAVEAIDKLRDTSSSHGRTFVVEVMGRNAGDIALWAGIASGADQIIVPEEEFDIEKVASTIQYDFE
K6PF_STRPM      TAVNTAVEAIDKLRDTSSSHGRTFVVEVMGRNAGDIALWAGIASGADQIIVPEEEFDIEKVASTIQYDFE
K6PF_STRPG      TAVNTAVEAIDKLRDTSSSHGRTFVVEVMGRNAGDIALWAGIASGADQIIVPEEEFDIEKVASTIQYDFE
K6PF_STRPD      TAVNTAVEAIDKLRDTSSSHGRTFVVEVMGRNAGDIALWAGIASGADQIIVPEEEFDIEKVASTIQYDFE
K6PF_STRPC      TAVNTAVEAIDKLRDTSSSHGRTFVVEVMGRNAGDIALWAGIASGADQIIVPEEEFDIEKVASTIQYDFE
K6PF_STRPB      TAVNTAVEAIDKLRDTSSSHGRTFVVEVMGRNAGDIALWAGIASGADQIIVPEEEFDIEKVASTIQYDFE
K6PF_STRP8      TAVNTAVEAIDKLRDTSSSHGRTFVVEVMGRNAGDIALWAGIASGADQIIVPEEEFDIEKVASTIQYDFE
K6PF_STRP6      TAVNTAVEAIDKLRDTSSSHGRTFVVEVMGRNAGDIALWAGIASGADQIIVPEEEFDIEKVASTIQYDFE
K6PF_STRP1      TAVNTAVEAIDKLRDTSSSHGRTFVVEVMGRNAGDIALWAGIASGADQIIVPEEEFDIEKVASTIQYDFE
K6PF_STRP3      TAVNTAVEAIDKLRDTSSSHGRTFVVEVMGRNAGDIALWAGIASGADQIIVPEEEFDIEKVASTIQYDFE
K6PF_STRTR      TAVATATEALDKIQDTAFSHGRTFVVEVMGRNAGDIALWAGIASGADQIIVPEEEYDINEVVRKVKEGYE
K6PF_STRTD      TAVATATEALDKIQDTAFSHGRTFVVEVMGRNAGDIALWAGIASGADQIIVPEEEYDINEVVRKVKEGYE
K6PF_STRS7      TAVNTAVEAIDKLRDTSSSHGRTFVVEVMGRNAGDIALWAGIASGADQIIVPEEEFDIHKVVSTIKDDFE
K6PF_STRPF      TAVNTAVEAIDKLRDTSSSHGRTFVVEVMGRNAGDIALWAGIASGADQIIVPEEEFDIEKVASTIQYDFE
K6PF_STREM      TAVNTAVEAIDKLRDTSSSHGRTFVVEVMGRNAGDIALWAGIASGADQIIVPEEEFDIHKVVSTIKDDFE
K6PF_STRE4      TAVNTAVEAIDKLRDTSSSHGRTFVVEVMGRNAGDIALWAGIASGADQIIVPEEEFDIHKVVSTIKDDFE
K6PF_STRA5      TAVATAVENLDRLRDTSASHNRTFVVEVMGRNAGDIALWSGIAAGADQIIVPEEEFNIDEVVSNVRAGYA
K6PF_STRA3      TAVATAVENLDRLRDTSASHNRTFVVEVMGRNAGDIALWSGIAAGADQIIVPEEEFNIDEVVSNVRAGYA
K6PF_STRA1      TAVATAVENLDRLRDTSASHNRTFVVEVMGRNAGDIALWSGIAAGADQIIVPEEEFNIDEVVSNVRAGYA
K6PF_STRMU      TAVNTATDALDKIRDTSFSHGRTFVVEVMGRNAGDIALWSGIAAGADQIIIPEEPYDIKEVVANVKNGYS
K6PF_STRU0      TAVNTAVEAIDKLRDTSSSHGRTFVVEVMGRNAGDIALWAGIASGADQIIVPEEEFNIQQVVKTIDDDFK
K6PF_LACLS      TAVSTVVDALDKIRDTSSSHNRTFVVEVMGRXXXXXXXXXXXXXXXXXXCIPEKEFKFENVVNNINKGYE
K6PF_LACLM      TAVSTVVDALDKIRDTSSSHNRTFVVEVMGRXXXXXXXXXXXXXXXXXXCIPEKEFKFENVVNNINKGYE
K6PF_LACLA      TAVSTVVDALDKIRDTSSSHNRTFVVEVMGRXXXXXXXXXXXXXXXXXXCIPEKEFKFENVVNNINKGYE
K6PF_ENTFA      TAINTVLESIDRIRDTATSHVRTFVIEVMGRNAGDIALWSGVAGGADEIIIPEHDFDMKNVAKRIQEGRD
K6PF_ANOFW      TALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWAGLAGGAESILIPEADYDMDEIVSRLKRGHE
K6PF_LISW6      TALNTVLDALDKIRDTATSHERTFIIEVMGRDAGDIALWSGLAGGAEAIIVPEESFNMDDVVDRLNKGRE
K6PF_LISMO      TALNTVLDALDKIRDTATSHERTFIIEVMGRDAGDIALWSGLAGGAEAIIVPEESFNMDDVVDRLNKGRE
K6PF_LISMF      TALNTVLDALDKIRDTATSHERTFIIEVMGRDAGDIALWSGLAGGAEAIIVPEESFNMDDVVDRLNKGRE
K6PF_LISMC      TALNTVLDALDKIRDTATSHERTFIIEVMGRDAGDIALWSGLAGGAEAIIVPEESFNMDDVVDRLNKGRE
K6PF_LISIN      TALNTVLDALDKIRDTATSHERTFIIEVMGRDAGDIALWSGLAGGAEAIIVPEESFNMDDVVDRLNKGRE
K6PF_LISMH      TALNTVLDALDKIRDTATSHERTFIIEVMGRDAGDIALWSGLAGGAEAIIVPEESFNMDDVVDRLNKGRE
K6PF_GEOKA      TALNTVIDAIDKIRDTATSHERTYVVEVMGRHAGDIALWSGLAGGAETILIPEADYDMDDIIARLKRGHE
K6PF_BACST      TALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWSGLAGGAETILIPEADYDMNDVIARLKRGHE
K6PF_BACCN      TALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWAGLADGAETILIPEAEYDMDDVIARLKRGSE
K6PF_BACSU      TALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWAGLAGGAESILIPEADYDMHEIIARLKRGHE
K6PF_BACLD      TALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWSGLAGGAESILIPEADYDMEEIIARLKRGHE
K6PF_BACWK      TALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWAGLADGAETILIPEEKYDMEDVIARLKRGSE
K6PF_BACHK      TALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWAGLADGAETILIPEEEYDMEDVIARLKRGSE
K6PF_BACCZ      TALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWAGLADGAETILIPEEEYDMEDVIARLKRGSE
K6PF_BACCQ      TALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWAGLADGAETILIPEEEYDMEDVIARLKRGSE
K6PF_BACCE      TALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWAGLADGAETILIPEEEYDMEDVIARLKRGSE
K6PF_BACC7      TALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWAGLADGAETILIPEEEYDMEDVIARLKRGSE
K6PF_BACC3      TALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWAGLADGAETILIPEEEYDMEDVIARLKRGSE
K6PF_BACC1      TALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWAGLADGAETILIPEEEYDMEDVIARLKRGSE
K6PF_BACC0      TALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWAGLADGAETILIPEEEYDMEDVIARLKRGSE
K6PF_BACAN      TALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWAGLADGAETILIPEEEYDMEDVIARLKRGSE
K6PF_BACAH      TALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWAGLADGAETILIPEEEYDMEDVIARLKRGSE
K6PF_BACAC      TALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWAGLADGAETILIPEEEYDMEDVIARLKRGSE
K6PF_BACAA      TALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWAGLADGAETILIPEEEYDMEDVIARLKRGSE
K6PF_BACA2      TALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWAGLAGGAESILIPEADYDMQEIIGRLKRGHD
K6PF_BACHD      TALNTVIDAIDKIRDTATSHDRTYVIEVMGRNAGDLALWSGLADGAETIVIPEADHDIDQIISRLQRGQE
K6PF_BACC4      TALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWAGLADGAETILIPEEEYDMDDVIARLKRGSE
K6PF_BACC2      TALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWAGLADGAETILIPEEEYDMDDVIARLKRGSE
K6PF_BACCR      TALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWAGLADGAETILIPEEEYDMDDVIARLKRGSE
K6PF_GEOSW      TALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWSGLAGGAETILIPEADYDMNDVIARLKRGHE
K6PF_BACP2      TALNTVIDAIDKIRDTATSHERTYVVEVMGRHAGDIALWSGLAGGAESILIPEADYDMDEIIARLRRGHE
K6PF_LACGA      TACNTAMEAIDKIRDTATSHQRVFVVNVMGRDCGDIAMHVGVATGADAIVIPEEPYDIKEIAENLKQGFA
K6PF_LACJO      TACNTAMEAIDKIRDTATSHQRVFVVNVMGRDCGDIAMHVGVATGADAIVIPEEPYDIKEIAENLKQGFA
K6PF_LACCB      TAVNTVVEAVDRLRDTAASHERTFVIEVMGREAGDIALWSGVAGGAEDVIIPEHDFDVKKIASKLQSSRE
K6PF_LACC3      TAVNTVVEAVDRLRDTAASHERTFVIEVMGREAGDIALWSGVAGGAEDVIIPEHDFDVKKIASKLQSSRE
K6PF_LACS1      TAANVAMEALDRINDTATSHQRVFVVEVMGRGAGDIALWSGIATGADAIVIPEREYDIEAIANKISENRK
K6PF_PEDPA      TALNTAVDAIDKIRDTAKSHQRVFAVQVMGRNAADIALWAGVASGADAVIAPGFDYDVEAIANKLKKNRA
K6PF_LACDE      TACMTAMDAIDKIRDTASSHHRVFIVNVMGRNCGDIAMRVGVACGADAIVIPERPYDVEEIANRLKQAQE
K6PF_LACAC      SACRTAMDAIDKIRDTASSHHRVFVVNVMGRECGDIAMRVGVASGADAIVIPERPYDVKEIAETIKRGFA
K6PF_BACSK      TALNTVIDAIDKIRDTATSHDRTYVIEVMGRHXXXXXXXXXXXXXXETIVIPEAEHNMEQILATIKRGQE
K6PF_BACSH      TALNTVVESIDKIRDTATSHENSFIVEVMGRDAGDIALWAGLAAGAETVLIPEEDYDLDDIVARLDRGAA
K6PF_LACH4      SACRTAMDAIDKIRDTASSHHRVFVVNVMGRECGDIAMRVGVASGADAIVIPERPYDVKEIAETITRGFA
K6PF_SERP5      TALETVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLAAAIAGGCEFIVLPEIEFNREDLVCEIKAGID
K6PF_VIBPA      SALNTVIDAIDRLRDTSSSHQRISIVEIMGRHCGDLTLMSAIAGGCEYIITPETGLDKDKLISNIQDGIA
K6PF_VIBCH      TALNTVIEAIDRLRDTSSSHQRISIVEIMGRHCGDLTLTSAIAGGCEYIITPETGLNMEQLISNIKDGIA
K6PF_LACPL      TAVNTNVQALDRIYDTAHSHDRTFVVEVMGRGAGDVALWSGVSIGATAIVVPEVDWDMEEIANKIKHNRA
K6PF_PECCP      TALETVLEAIDRLRDTSSSHQRISIVEVMGRHCGDLTLAAAIAGGCEFIVLPEVPFSPEDLVCEIKAGIE
K6PF_ERWCT      TALETVLEAIDRLRDTSSSHQRISIVEVMGRHCGDLTLAAAIAGGCEFIVLPEVPFSPEDLVSEIKAGIE
K6PF_EDWI9      TALETVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLAAAIAGGCEYIVLPEVEFKREDLVEEIKVGIT
K6PF_VIBVY      TALNTVIESIDRLRDTSSSHQRISIVEIMGRHCGDLTLMSAIAGGCEYIITPETGLDKEKLIGNIQDGIS
K6PF_VIBVU      TALNTVIESIDRLRDTSSSHQRISIVEIMGRHCGDLTLMSAIAGGCEYIITPETGLDKEKLIGNIQDGIS
K6PF_STAES      TALNTIIESVDKIRDTASSHARTFIVEVMGRDCGDLALWAGLSVGAETIVLPEVNTDIKDVAEKIEQGIK
K6PF_STAEQ      TALNTIIESVDKIRDTASSHARTFIVEVMGRDCGDLALWAGLSVGAETIVLPEVNTDIKDVAEKIEQGIK
K6PF_PHOPR      TALNTVIDAIDRLRDTSSSHQRISIVEVMGRHCGDLTLMSAIAGGCEYIITPETGLHKEELIAKIKEGIY
K6PF_STACT      SALNTIIESVDKIRDTASSHARTFIVEVMGRDCGDLALWAGLAVGAETIIVPEEKVDIKDVAEKIESGIK
K6PF_MACCJ      TALNTIVEAIDKIRDTASSHERTFIVEVMGRDAGDLALWSGLAGGAETVLCPEHRKDVKVIADKIQQGIE
K6PF_STAAW      TALNTIIGLVDKIRDTASSHARTFIIEAMGRDCGDLALWAGLSVGAETIVVPEVKTDIKEIADKIEQGIK
K6PF_STAAT      TALNTIIGLVDKIRDTASSHARTFIIEAMGRDCGDLALWAGLSVGAETIVVPEVKTDIKEIADKIEQGIK
K6PF_STAAS      TALNTIIGLVDKIRDTASSHARTFIIEAMGRDCGDLALWAGLSVGAETIVVPEVKTDIKEIADKIEQGIK
K6PF_STAAR      TALNTIIGLVDKIRDTASSHARTFIIEAMGRDCGDLALWAGLSVGAETIVVPEVKTDIKEIADKIEQGIK
K6PF_STAAN      TALNTIIGLVDKIRDTASSHARTFIIEAMGRDCGDLALWAGLSVGAETIVVPEVKTDIKEIADKIEQGIK
K6PF_STAAM      TALNTIIGLVDKIRDTASSHARTFIIEAMGRDCGDLALWAGLSVGAETIVVPEVKTDIKEIADKIEQGIK
K6PF_STAAE      TALNTIIGLVDKIRDTASSHARTFIIEAMGRDCGDLALWAGLSVGAETIVVPEVKTDIKEIADKIEQGIK
K6PF_STAAC      TALNTIIGLVDKIRDTASSHARTFIIEAMGRDCGDLALWAGLSVGAETIVVPEVKTDIKEIADKIEQGIK
K6PF_STAAB      TALNTIIGLVDKIRDTASSHARTFIIEAMGRDCGDLALWAGLSVGAETIVVPEVKTDIKEIADKIEQGIK
K6PF_STAA9      TALNTIIGLVDKIRDTASSHARTFIIEAMGRDCGDLALWAGLSVGAETIVVPEVKTDIKEIADKIEQGIK
K6PF_STAA2      TALNTIIGLVDKIRDTASSHARTFIIEAMGRDCGDLALWAGLSVGAETIVVPEVKTDIKEIADKIEQGIK
K6PF_OCEIH      TSLNTIIDAVDKVRDTATSHERTYIIEVMGRDXXXXXXXXXXXXXXESILIPEEKEDFSSIVQRLKNGHD
K6PF_NATTJ      TALNTVIEAIDRIRDTATSHERIFVIEVMGRDCGNLALWSGLAGGAESVLIPEIDYDMEKVIERLKHGYK
K6PF_HAEI8      TALQTAVDAIDRLRDTSSSHQRISIVEIMGRHCSDLTISAGIAGGCEYIVASEIEFNREELIQQIERSII
K6PF_HAEIN      TALQTAVDAIDRLRDTSSSHQRISIVEIMGRHCSDLTISAGIAGGCEYIVASEIEFNREELIQQIERSII
K6PF_HAEIE      TALQTAVDAIDRLRDTSSSHQRISIVEIMGRHCSDLTISAGIAGGCEYIVASEIEFNREELIQQIERSII
K6PF_BUCAT      TALQTVVEAIDRLRDTSSSHQRISIVEVMGRHCGDLTLAAAIAGGCEFIVLPEIDYKKEDLVIEIQAGIA
K6PF_BUCAI      TALQTVVEAIDRLRDTSSSHQRISIVEVMGRHCGDLTLAAAIAGGCEFIVLPEIDYKKEDLVIEIQAGIA
K6PF_BUCA5      TALQTVVEAIDRLRDTSSSHQRISIVEVMGRHCGDLTLAAAIAGGCEFIVLPEIDYKKEDLVIEIQAGIA
K6PF_HAEPS      TALETALEAIDRLRDTSTSHQRISIVEIMGRHCGDLTLSAALAGGCEYIIIPEKGFDKESLIRNIEDGFN
K6PF_ACTSZ      TALETAVDAIDRLRDTSGSHHRISIVEIMGRHCSDLTICAAIAGGCEYIVAPEVGFNQEELIQQIELSLA
K6PF_TOLAT      TALNVVMEAIDRLRDTSTSHKRISVVEVMGRHCGDLXXXXXXXXXXEFVIVPEKGFKKEDLLANIDEGIA
K6PF_HAEDU      TALQTAVEAIDRLRDTSTSHQRISIVEIMGRHCGDLTISAALAGGCEYIIVPEKGLDKESLIHSIADNFR
K6PF_BUCAP      TALETVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLAAAIAGGCEFIVLPEIHYKKEELVSEIQAGIE
K6PF_KLEP7      TALSTVVEAIDRLRDTSSSHQRISVVEVMGRYCGDLTLAAAIAGGCEFIMVPEVEYTRDDLVAEXXXXXX
K6PF_KLEP3      TALSTVVEAIDRLRDTSSSHQRISVVEVMGRYCGDLTLAAAIAGGCEFIMVPEVEYTRDDLVAEXXXXXX
K6PF_ENTS8      TALHTVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLAAAIAGGCEFIVLPEVEFNREDLVAEXXXXXX
K6PF_TERTT      TALNTVLDALDRLRDTSSSHKRISVVEIMGRHCGDLTVWSAIGSGAEYAIVPEMPFDEDKFLEQLRDQVG
K6PF_ENTCL      TALGTVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLAAAIAGGCEFIVVPEVEFSREDLVAEXXXXXX
K6PF_MANSM      TALETAVDAIDRLRDTSSSHQRISIVEIMGRHCSDLTINAALAGGCEYIVASEVEFDQEELIQQIERSIA
K6PF_ESCF3      TALSTVVEAIDRLRDTSSSHQRISVVEVMGRYCGDLTLAAAIAGGCEFVVVPEVEFSREDLVNEXXXXXX
K6PF_ACTPJ      TALETAVEAIDRLRDTSTSHQRISIVEIMGRHCGDLTISAALASGCEYIIVPEKGLDKESLMRNIEDGFN
K6PF_ACTP7      TALETAVEAIDRLRDTSTSHQRISIVEIMGRHCGDLTISAALASGCEYIIVPEKGLDKESLMRNIEDGFN
K6PF_ACTP2      TALETAVEAIDRLRDTSTSHQRISIVEIMGRHCGDLTISAALASGCEYIIVPEKGLDKESLMRNIEDGFN
K6PF_PASMU      TALQTAVEAIDRLRDTSSSHQRISIVEIMGRHCSDLAISAGIAGGCEYIVASEVEFNREELIQQIERSII
K6PF_ECO27      TALSTVVEAIDRLRDTSSSHQRISVVEVMGRYCGDLTLAAAIAGGCEFVVVPEVEFSREDLVNEXXXXXX
K6PF1_ECOL6     TALSTVVEAIDRLRDTSSSHQRISVVEVMGRYCGDLTLAAAIAGGCEFVVVPEVEFSREDLVNEXXXXXX
K6PF_SHISS      TALSTVVEAIDRLRDTSSSHQRISVVEVMGRYCGDLTLAAAIAGGCEFVVVPEVEFSREDLVNEXXXXXX
K6PF_SHIDS      TALSTVVEAIDRLRDTSSSHQRISVVEVMGRYCGDLTLAAAIAGGCEFVVVPEVEFSREDLVNEXXXXXX
K6PF_SHIBS      TALSTVVEAIDRLRDTSSSHQRISVVEVMGRYCGDLTLAAAIAGGCEFVVVPEVEFSREDLVNEXXXXXX
K6PF_SHIB3      TALSTVVEAIDRLRDTSSSHQRISVVEVMGRYCGDLTLAAAIAGGCEFVVVPEVEFSREDLVNEXXXXXX
K6PF_HAES2      TALETAVEAIDRLRDTSSSHKRISIVEIMGRHCSDLTISAAIAGGCEYIVASEIEFNREELIKQIERAII
K6PF_HAES1      TALETAVEAIDRLRDTSSSHKRISIVEIMGRHCSDLTISAAIAGGCEYIVASEIEFNREELIKQIERAII
K6PF_ECOSM      TALSTVVEAIDRLRDTSSSHQRISVVEVMGRYCGDLTLAAAIAGGCEFVVVPEVEFSREDLVNEXXXXXX
K6PF_ECOSE      TALSTVVEAIDRLRDTSSSHQRISVVEVMGRYCGDLTLAAAIAGGCEFVVVPEVEFSREDLVNEXXXXXX
K6PF_ECOLU      TALSTVVEAIDRLRDTSSSHQRISVVEVMGRYCGDLTLAAAIAGGCEFVVVPEVEFSREDLVNEXXXXXX
K6PF_ECOLC      TALSTVVEAIDRLRDTSSSHQRISVVEVMGRYCGDLTLAAAIAGGCEFVVVPEVEFSREDLVNEXXXXXX
K6PF_ECOL5      TALSTVVEAIDRLRDTSSSHQRISVVEVMGRYCGDLTLAAAIAGGCEFVVVPEVEFSREDLVNEXXXXXX
K6PF_ECOHS      TALSTVVEAIDRLRDTSSSHQRISVVEVMGRYCGDLTLAAAIAGGCEFVVVPEVEFSREDLVNEXXXXXX
K6PF_ECODH      TALSTVVEAIDRLRDTSSSHQRISVVEVMGRYCGDLTLAAAIAGGCEFVVVPEVEFSREDLVNEXXXXXX
K6PF_ECOBW      TALSTVVEAIDRLRDTSSSHQRISVVEVMGRYCGDLTLAAAIAGGCEFVVVPEVEFSREDLVNEXXXXXX
K6PF_ECO8A      TALSTVVEAIDRLRDTSSSHQRISVVEVMGRYCGDLTLAAAIAGGCEFVVVPEVEFSREDLVNEXXXXXX
K6PF_ECO81      TALSTVVEAIDRLRDTSSSHQRISVVEVMGRYCGDLTLAAAIAGGCEFVVVPEVEFSREDLVNEXXXXXX
K6PF_ECO7I      TALSTVVEAIDRLRDTSSSHQRISVVEVMGRYCGDLTLAAAIAGGCEFVVVPEVEFSREDLVNEXXXXXX
K6PF_ECO5E      TALSTVVEAIDRLRDTSSSHQRISVVEVMGRYCGDLTLAAAIAGGCEFVVVPEVEFSREDLVNEXXXXXX
K6PF_ECO55      TALSTVVEAIDRLRDTSSSHQRISVVEVMGRYCGDLTLAAAIAGGCEFVVVPEVEFSREDLVNEXXXXXX
K6PF_ECO45      TALSTVVEAIDRLRDTSSSHQRISVVEVMGRYCGDLTLAAAIAGGCEFVVVPEVEFSREDLVNEXXXXXX
K6PF_ECO24      TALSTVVEAIDRLRDTSSSHQRISVVEVMGRYCGDLTLAAAIAGGCEFVVVPEVEFSREDLVNEXXXXXX
K6PF1_SHIFL     TALSTVVEAIDRLRDTSSSHQRISVVEVMGRYCGDLTLAAAIAGGCEFVVVPEVEFSREDLVNEXXXXXX
K6PF1_ECOLI     TALSTVVEAIDRLRDTSSSHQRISVVEVMGRYCGDLTLAAAIAGGCEFVVVPEVEFSREDLVNEXXXXXX
K6PF1_ECO57     TALSTVVEAIDRLRDTSSSHQRISVVEVMGRYCGDLTLAAAIAGGCEFVVVPEVEFSREDLVNEXXXXXX
K6PF_VIBFM      TALNTVIDAIDRLRDTSSSHQRISIVEVMGRHCGDLTLMSAIAGGCEYVITPETGLNKEALIQNIQDXXX
K6PF_VIBF1      TALNTVIDAIDRLRDTSSSHQRISIVEVMGRHCGDLTLMSAIAGGCEYVITPETGLNKEALIQNIQDXXX
K6PF_SALTY      TALGTVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLAAAIAGGCEFIVVPEVEFNREDLVAEXXXXXX
K6PF_SALTI      TALGTVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLAAAIAGGCEFIVVPEVEFNREDLVAEXXXXXX
K6PF_SALSV      TALGTVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLAAAIAGGCEFIVVPEVEFNREDLVAEXXXXXX
K6PF_SALPK      TALGTVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLAAAIAGGCEFIVVPEVEFNREDLVAEXXXXXX
K6PF_SALPC      TALGTVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLAAAIAGGCEFIVVPEVEFNREDLVAEXXXXXX
K6PF_SALPB      TALGTVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLAAAIAGGCEFIVVPEVEFNREDLVAEXXXXXX
K6PF_SALPA      TALGTVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLAAAIAGGCEFIVVPEVEFNREDLVAEXXXXXX
K6PF_SALNS      TALGTVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLAAAIAGGCEFIVVPEVEFNREDLVAEXXXXXX
K6PF_SALHS      TALGTVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLAAAIAGGCEFIVVPEVEFNREDLVAEXXXXXX
K6PF_SALEP      TALGTVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLAAAIAGGCEFIVVPEVEFNREDLVAEXXXXXX
K6PF_SALDC      TALGTVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLAAAIAGGCEFIVVPEVEFNREDLVAEXXXXXX
K6PF_SALCH      TALGTVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLAAAIAGGCEFIVVPEVEFNREDLVAEXXXXXX
K6PF_SALAR      TALGTVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLAAAIAGGCEFIVVPEVEFNREDLVAEXXXXXX
K6PF_SALA4      TALGTVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLAAAIAGGCEFIVVPEVEFNREDLVAEXXXXXX
K6PF_ENT38      TALGTVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLAAAIAGGCEFIVVPEVEFSREDLVNEXXXXXX
K6PF_CITK8      TALGTVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLAAAIAGGCEFVVVPEVEFSRDDLVAEXXXXXX
K6PF_SALG2      TALGTVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLAAAIAGGCEFIVVPEVEFNREDLVAEXXXXXX
K6PF_BACMC      TSVSIVVDAINKLRDTMSSHERSSIVEVMGRHCGDIALYAGLASGAETIIVPEVPFDMDEIAERMKQNFA
K6PF_THETN      TACNTVIDAINKIRDTATSHERANIIEVMGRNSGYIALYAGVAGGAEMIILPEVEWSIDELCDKITYGIK
K6PF_CLONN      TATNTVLDAINKLRDTSSSHERVSIVEVMGRGCGDLALFAGIGGGAESVIVPEKEFNEDELCKTILEGKL
K6PF_ALISL      TALNTVIDAIDRLRDTSSSHQRISIVEVMGRHCGDLTLMAAIAGGCEYVITPETGLNKEALIQNIQDXXX
K6PF_SODGM      TALETVVEAIDRLRDTSTSHQRISIVEVMGRYCGDLTMAAAIAGGCEFIVLPEVEFKPEDLVYEXXXXXX
K6PF_CLOBL      TSINTVLDAINKLRDTSTSHERVSVVEVMGRNCGDIALYTGVAGGAESIIIPEKEYNADKLCKQILQGKL
K6PF_CLOBK      TSINTVLDAINKLRDTSTSHERVSVVEVMGRNCGDIALYTGVAGGAESIIIPEKEYNADKLCKQILQGKL
K6PF_CLOBJ      TSINTVLDAINKLRDTSTSHERVSVVEVMGRNCGDIALYTGVAGGAESIIIPEKEYNADKLCKQILQGKL
K6PF_CLOBH      TSINTVLDAINKLRDTSTSHERVSVVEVMGRNCGDIALYTGVAGGAESIIIPEKEYNADKLCKQILQGKL
K6PF_CLOB1      TSINTVLDAINKLRDTSTSHERVSVVEVMGRNCGDIALYTGVAGGAESIIIPEKEYNADKLCKQILQGKL
K6PF_BAUCH      TALETVVEAIDRLRDTSTSHQRISIVEVMGRYCGDLTMAAAIAGGCEFIVLPEVEFQPEDLVYEIKASIA
K6PF_ERWT9      TALETVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLAAAIAGGCEFIVLPEIPYTREELVNEXXXXXX
K6PF_CLOBM      TSINTVLDAINKLRDTSTSHERVSVVEVMGRNCGDIALYTGVAGGAESIIIPEKEYNADKLCKQILQGKL
K6PF_CLOB6      TSINTVLDAINKLRDTSTSHERVSVVEVMGRNCGDIALYTGVAGGAESIIIPEKEYNADKLCKQILQGKL
K6PF_HALOH      TAMNTIIDTINKIRDTATSHERTFVVETMGRRSGFLTLMAGLAGGAESILIPEIDFDLDDVSQKLKKGYE
K6PF_CLOBB      TALNTIVDAINKIRDTSTSHERVSIIEVMGRDCGDLALHAGISSGAEAIIVPEGEFDRDALCRTILDGKN
K6PF_CLOD6      TAMNTIIDAIGKIRDTSSSHERVNIVEVMGRHCXXXXXXXXXXXXXETIIVPEVEITVDEVALRLKTTQK
K6PF_ALKOO      TSVNTVVDAISKIRDTSTSHGRANIIEVMGRHCGDIALMAGLAGGAESIIVPEVGVDVDEVCNKLLKGRY
K6PF_VIBHB      TALNTVIDAIDRLRDTSSSHQRISIVEIMGRHCGDLTLMSAIAGGCEYIITPETGLDKDKLIKNIQDGIA
K6PF_CLOTE      TAVNTVLDAINKLRDTSTSHGRASVVEVMGRNCGDIALYAGLAGGAESIIVPELRFDIDKLCKTILEGKK
K6PF_BLOFL      TALETIIEAIDRLRDTSSSHQRISIVEVMGRYCGDLTISAAIAGGCEFVIIPELKFQMQDLVDKIKLNIS
K6PF_BREBN      TALNTVVEAIDKIRDTATSHERTYIIEVMGRXXXXXXXXXXXXXXXESIMIPEASQDMDDIIERLHAGQR
K6PF_CLOBA      TALNTIVDAINKIRDTSTSHERVSIIEVMGRDCGDLALHAGISSGAEAIIVPEGEFDRDALCRTILEGKN
K6PF_ALKMQ      TAMNTVLDAISKIRDTSTSHGRANIIEVMGRHCGDIALYTGLAGGAESIIIPEVGLDIDEICRKLLQGKN
K6PF1_CLOPE     TALNTVVDAINKLRDTSTSHERVSIVEVMGRNCGDLALYXXXXXXXXXXXVPEMPFDKDELIKTILEGRT
K6PF_THEPX      TACNTVIDAINKIRDTATSHERANIIEVMGRNXXXXXXXXXXXXXXEMIILPEVEWSIDELCDKITYGIK
K6PF_THEP3      TACNTVIDAINKIRDTATSHERANIIEVMGRNXXXXXXXXXXXXXXEMIILPEVEWSIDELCDKITYGIK
K6PF_BUCBP      TALETVVEAIDRLRDTSSSHQRISIVEVMGRNCGDLTLSAAIAGGCEFIVLPEIEFTKEELVXXXXXXXX
K6PF_FINM2      TAVETVSDAISKLRDTSSSHGRANIIEVMGRNCGDIALYSGVASGAESILVPEVELNIDEVTEKIERGRK
K6PF_FUSNN      TCLNTILDAMSKIRDTATSHERTILIQVMGRRAGDLALHACIAGGGDGIMIPEMDNPIEMLALQLKERRK
K6PF_YERE8      TALETVVEAIDRLRDTSSSHQRISIVEVMGRFCGDLTLAAAIAGGCEFIAIPEVEFKREDLVKEXXXXXX
K6PF_CLOAB      TTLNTVLDAINKLRDTSTSHERVSIIEVMGRDCGDIALFSGIAGGAESVIIPEIGYDFNELCKNILEGKL
K6PF_DEIRA      TAVETALEAVDKLRDTGASHERIFVIEVMGRHAGHIALDVAVAGGAEEVFIPEDKKPIGDVVNIVKDSIA
K6PF_YERPP      TALETVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLAAAIAGGCEFIAIPEVEFKRDDLVAEXXXXXX
K6PF_YERPN      TALETVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLAAAIAGGCEFIAIPEVEFKRDDLVAEXXXXXX
K6PF_YERPG      TALETVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLAAAIAGGCEFIAIPEVEFKRDDLVAEXXXXXX
K6PF_YERPE      TALETVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLAAAIAGGCEFIAIPEVEFKRDDLVAEXXXXXX
K6PF_YERPA      TALETVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLAAAIAGGCEFIAIPEVEFKRDDLVAEXXXXXX
K6PF_YERP3      TALETVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLAAAIAGGCEFIAIPEVEFKRDDLVAEXXXXXX
K6PF_YERPY      TALETVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLAAAIAGGCEFIAIPEVEFKRDDLVAEXXXXXX
K6PF_YERPS      TALETVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLAAAIAGGCEFIAIPEVEFKRDDLVAEXXXXXX
K6PF_YERPB      TALETVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLAAAIAGGCEFIAIPEVEFKRDDLVAEXXXXXX
K6PF_HAMD5      TALQTVVEAIDRLRDTSSSHQRISIVEVMGRHCGDLTLAAAIAGGCEFIVIPEVPFDRKELXXXXXXXXX
K6PF_CYTH3      TAVNTCLAAIDKIRDTADAHERVFFIEVMGRDTGYIAVRSAISGGAEMAIIPEFPYDKNVVINRLKHGTS
K6PF_MYCCT      TALNTIVEAVDRIRDTMQSHNRADVVEIMGNGCGDLVTYTAVATGA-EIFSPAEDLTIEQMGQKAKQFRL
K6PF_PERMH      TAVNNAVDAIDKIRDTSESHERVFVIEVMGRKSGFLALAAGISTGADVTLIPEYPFPMHVIVKSIVDALN
K6PF_THENN      TCLNTVMDAIQKLKDTASSHERAFIVEVMGRHSGYIALMAGLVTGAEAIIIPEIPVDYSQLADRILQERR
K6PF_THET2      TAVNTALEAIDRIRDTAASHERVFFIEVMGRHAGFIALDVGLAGGAEVIAVPEEPVDPKAVAEVLEASQR
K6PF1_THET8     TAVNTALEAIDRIRDTAASHERVFFIEVMGRHAGFIALDVGLAGGAEVIAVPEEPVDPKAVAEVLEASQR
K6PF2_BACTN     TALNTILDAVDKIRDTATSHERLFFVEVMGRDAGFLXXXXXXXXXXXXXXXPEFSTEVDQLEEFIKNGFR
K6PF_SULSY      TAVNNAMEAIDKIKDTTMSHERIFIVEVMGRDNGFIALEVGIAVGAELTLIPEYPFPLHVIEETILKAKE
K6PF_COXBU      TACNTALQAIDKIRDTAFSHERNFLIEVMGRSSGFIAVNVGIAGGAEIIALPEFHVDIDTLTQKIKKQH-
K6PF_AQUAE      TALRNAVDAIDKIRDTASSHERIFIVEVMGRNRGFIAVEAGLATGAELILIPEERFPREQIPEEIEKAKK
K6PF_BUCCC      TALETVVDAIDKLRDTSASHHRISIIEIMGRYCGDLTLSAAIAGGCEFIVIPEIIYQKELLLLEIQKSIK
K6PF_MYCPU      TALNTIVEAVDKIRDTASSHKRCIMVEVMGHGASDLALYSGMATGSEIIVSNDYKLSVEEMAKIVKKQFE
K6PF_THESQ      TCLNTVMDAVQKLKDTASSHERAFIVEVMGRHSGYIALMAGLVTGAEAIIVPEIPVDYSQLADRILEERR
K6PF_THEP1      TCLNTVMDAVQKLKDTASSHERAFIVEVMGRHSGYIALMAGLVTG