[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for spne4:ACF56071.1

[Show Plain Result]


## Summary of Sequence Search
    1::66
    1::66      1e-33 100%   66 aa  ATPL_STRZT RecName: Full=ATP synthase subunit c;AltName: Full=ATP
    1::66      1e-33 100%   66 aa  ATPL_STRZP RecName: Full=ATP synthase subunit c;AltName: Full=ATP
    1::66      1e-33 100%   66 aa  ATPL_STRZJ RecName: Full=ATP synthase subunit c;AltName: Full=ATP
    1::66      1e-33 100%   66 aa  ATPL_STRR6 RecName: Full=ATP synthase subunit c;AltName: Full=ATP
    1::66      1e-33 100%   66 aa  ATPL_STRPS RecName: Full=ATP synthase subunit c;AltName: Full=ATP
    1::66      1e-33 100%   66 aa  ATPL_STRPN RecName: Full=ATP synthase subunit c;AltName: Full=ATP
    1::66      1e-33 100%   66 aa  ATPL_STRPJ RecName: Full=ATP synthase subunit c;AltName: Full=ATP
    1::66      1e-33 100%   66 aa  ATPL_STRPI RecName: Full=ATP synthase subunit c;AltName: Full=ATP
    1::66      1e-33 100%   66 aa  ATPL_STRP7 RecName: Full=ATP synthase subunit c;AltName: Full=ATP
    1::66      1e-33 100%   66 aa  ATPL_STRP4 RecName: Full=ATP synthase subunit c;AltName: Full=ATP
    1::66      1e-33 100%   66 aa  ATPL_STRP2 RecName: Full=ATP synthase subunit c;AltName: Full=ATP
    1::66      5e-27  76%   66 aa  ATPL_STROR RecName: Full=ATP synthase subunit c;AltName: Full=ATP
    2::66      5e-16  54%   67 aa  ATPL_STRMU RecName: Full=ATP synthase subunit c;AltName: Full=ATP
    8::67      4e-09  33%   70 aa  ATPL_OENOB RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   18::67      2e-07  40%   70 aa  ATPL_LACSS RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   13::72      1e-06  32%   91 aa  ATPL1_PELPD RecName: Full=ATP synthase subunit c 1;AltName:
   23::78      1e-05  39%   89 aa  ATPL_FUSNN RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   14::72      1e-05  31%   88 aa  ATPL2_PELCD RecName: Full=ATP synthase subunit c 2;AltName:
   18::67      1e-05  34%   70 aa  ATPL_LACJO RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   14::72      1e-05  29%   88 aa  ATPL1_PELCD RecName: Full=ATP synthase subunit c 1;AltName:
   23::78      2e-05  39%   89 aa  ATPL_ILYTA RecName: Full=ATP synthase subunit c, sodium ion
   22::90      2e-05  34%   90 aa  ATPL_MYCA5 RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   27::74      4e-05  33%   77 aa  ATPL_LACH4 RecName: Full=ATP synthase subunit c;AltName: Full=ATP
    7::70      4e-05  34%   74 aa  ATP9_SCHPO RecName: Full=ATP synthase subunit 9,
   22::67      5e-05  33%   70 aa  ATPL_LACCB RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   22::67      5e-05  33%   70 aa  ATPL_LACC3 RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   30::66      5e-05  41%   70 aa  ATPL_BACLD RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   41::96      6e-05  32%  102 aa  ATPL_MYCGE RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   30::66      6e-05  38%   70 aa  ATPL_BACSU RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   30::66      6e-05  41%   70 aa  ATPL_BACP2 RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   30::66      6e-05  38%   70 aa  ATPL_BACA2 RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   32::67      8e-05  42%   70 aa  ATPL_LACF3 RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   22::74      1e-04  28%   82 aa  ATPL_SYNSC RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   22::74      1e-04  28%   81 aa  ATPL_SYNS9 RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   22::74      1e-04  28%   82 aa  ATPL_SYNR3 RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   22::74      1e-04  28%   82 aa  ATPL_SYNPX RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   30::67      1e-04  39%   70 aa  ATPL_STACT RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   32::68      1e-04  41%   72 aa  ATPL_GEOKA RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   30::67      1e-04  39%   71 aa  ATPL_ENTHR RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   32::69      1e-04  37%   72 aa  ATPL_BACWK RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   32::68      1e-04  41%   72 aa  ATPL_BACST RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   32::68      1e-04  41%   72 aa  ATPL_BACP3 RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   32::69      1e-04  37%   72 aa  ATPL_BACHK RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   32::69      1e-04  37%   72 aa  ATPL_BACCZ RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   32::69      1e-04  37%   72 aa  ATPL_BACCR RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   32::69      1e-04  37%   72 aa  ATPL_BACCQ RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   32::69      1e-04  37%   72 aa  ATPL_BACCN RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   32::69      1e-04  37%   72 aa  ATPL_BACC7 RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   32::69      1e-04  37%   72 aa  ATPL_BACC4 RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   32::69      1e-04  37%   72 aa  ATPL_BACC3 RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   32::69      1e-04  37%   72 aa  ATPL_BACC2 RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   32::69      1e-04  37%   72 aa  ATPL_BACC1 RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   32::69      1e-04  37%   72 aa  ATPL_BACC0 RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   32::69      1e-04  37%   72 aa  ATPL_BACAN RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   32::69      1e-04  37%   72 aa  ATPL_BACAH RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   32::69      1e-04  37%   72 aa  ATPL_BACAC RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   32::69      1e-04  37%   72 aa  ATPL_BACAA RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   22::74      1e-04  28%   81 aa  ATPL_SYNS3 RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   33::88      1e-04  27%   92 aa  ATPL_MYCPU RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   38::74      1e-04  43%   77 aa  ATPL_CLAMS RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   38::74      1e-04  43%   77 aa  ATPL_CLAM3 RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   38::74      1e-04  43%   75 aa  ATPL_BIFAA RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   63::102     2e-04  38%  115 aa  ATPL_HYDS0 RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   38::76      2e-04  41%   76 aa  ATPL_BIFA0 RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   15::74      2e-04  28%   81 aa  ATPH_WELMI RecName: Full=ATP synthase subunit c,
   15::74      2e-04  28%   81 aa  ATPH_GNEPA RecName: Full=ATP synthase subunit c,
   30::68      3e-04  36%   72 aa  ATPL_SYNWW RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   15::74      3e-04  27%   81 aa  ATPH_CHAGL RecName: Full=ATP synthase subunit c,
   25::67      4e-04  30%   70 aa  ATPL_EXIS2 RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   14::74      4e-04  31%   85 aa  ATPL_DICTD RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   38::76      4e-04  36%   76 aa  ATPL_BIFLI RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   30::67      4e-04  37%   70 aa  ATPL_BACHD RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   15::74      4e-04  27%   81 aa  ATPH_TRACE RecName: Full=ATP synthase subunit c,
   15::74      4e-04  27%   81 aa  ATPH_STAPU RecName: Full=ATP synthase subunit c,
   15::74      4e-04  27%   81 aa  ATPH_SOLTU RecName: Full=ATP synthase subunit c,
   15::74      4e-04  27%   81 aa  ATPH_PIPCE RecName: Full=ATP synthase subunit c,
   15::74      4e-04  27%   81 aa  ATPH_PHYPA RecName: Full=ATP synthase subunit c,
   15::74      4e-04  27%   81 aa  ATPH_PELHO RecName: Full=ATP synthase subunit c,
   15::69      4e-04  29%   83 aa  ATPH_PAVLU RecName: Full=ATP synthase subunit c,
   15::74      4e-04  27%   81 aa  ATPH_OENPA RecName: Full=ATP synthase subunit c,
   15::74      4e-04  27%   81 aa  ATPH_OENGL RecName: Full=ATP synthase subunit c,
   15::74      4e-04  27%   81 aa  ATPH_OENEH RecName: Full=ATP synthase subunit c,
   15::74      4e-04  27%   81 aa  ATPH_OENBI RecName: Full=ATP synthase subunit c,
   15::74      4e-04  27%   81 aa  ATPH_OENAR RecName: Full=ATP synthase subunit c,
   15::74      4e-04  27%   81 aa  ATPH_MARPO RecName: Full=ATP synthase subunit c,
   15::74      4e-04  27%   81 aa  ATPH_CUCSA RecName: Full=ATP synthase subunit c,
   15::74      4e-04  27%   81 aa  ATPH_CRYJA RecName: Full=ATP synthase subunit c,
   15::74      4e-04  27%   81 aa  ATPH_CICAR RecName: Full=ATP synthase subunit c,
   32::68      5e-04  38%   72 aa  ATPL_BACCA RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   54::96      5e-04  37%  100 aa  ATPL_AQUAE RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   22::74      5e-04  26%   82 aa  ATPH_PAUCH RecName: Full=ATP synthase subunit C, organellar
   15::69      5e-04  29%   82 aa  ATPH_HETA4 RecName: Full=ATP synthase subunit c,
   15::69      5e-04  29%   82 aa  ATPH_HETA2 RecName: Full=ATP synthase subunit c,
   28::67      7e-04  30%   70 aa  ATPL_PEDPA RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   18::78      7e-04  32%   78 aa  ATPL_MYCPE RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   14::74      7e-04  31%   84 aa  ATPL_DICT6 RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   38::75      7e-04  37%   75 aa  ATPL_BIFLO RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   38::75      7e-04  37%   75 aa  ATPL_BIFLD RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   30::68      7e-04  33%   70 aa  ATPL_BACME RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   19::74      7e-04  27%   81 aa  ATPH_CUSOB RecName: Full=ATP synthase subunit C, plastid;AltName:
   19::74      7e-04  27%   81 aa  ATPH_CUSGR RecName: Full=ATP synthase subunit C, plastid;AltName:
   22::74      0.001  26%   82 aa  ATPL_SYNPW RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   16::72      0.001  25%   84 aa  ATPL_HAEPS RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   16::72      0.001  25%   84 aa  ATPL_HAEIN RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   16::72      0.001  25%   84 aa  ATPL_HAEIG RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   16::72      0.001  25%   84 aa  ATPL_HAEIE RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   16::72      0.001  25%   84 aa  ATPL_HAEI8 RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   16::72      0.001  25%   84 aa  ATPL_ACTSZ RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   16::72      0.001  25%   84 aa  ATPL_ACTPJ RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   16::72      0.001  25%   84 aa  ATPL_ACTP7 RecName: Full=ATP synthase subunit c;AltName: Full=ATP
   16::72      0.001  25%   84 aa  ATPL_ACTP2 RecName: Full=ATP synthase subunit c;AltName: Full=ATP
    1::66

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MNLTFLGLCIACMGVSVGEGLLMNGLFKSVARQPDMLSEFRSLMFLGVAFIEGTFFVTLVFSFIIK
ATPL_STRZT      MNLTFLGLCIACMGVSVGEGLLMNGLFKSVARQPDMLSEFRSLMFLGVAFIEGTFFVTLVFSFIIK
ATPL_STRZP      MNLTFLGLCIACMGVSVGEGLLMNGLFKSVARQPDMLSEFRSLMFLGVAFIEGTFFVTLVFSFIIK
ATPL_STRZJ      MNLTFLGLCIACMGVSVGEGLLMNGLFKSVARQPDMLSEFRSLMFLGVAFIEGTFFVTLVFSFIIK
ATPL_STRR6      MNLTFLGLCIACMGVSVGEGLLMNGLFKSVARQPDMLSEFRSLMFLGVAFIEGTFFVTLVFSFIIK
ATPL_STRPS      MNLTFLGLCIACMGVSVGEGLLMNGLFKSVARQPDMLSEFRSLMFLGVAFIEGTFFVTLVFSFIIK
ATPL_STRPN      MNLTFLGLCIACMGVSVGEGLLMNGLFKSVARQPDMLSEFRSLMFLGVAFIEGTFFVTLVFSFIIK
ATPL_STRPJ      MNLTFLGLCIACMGVSVGEGLLMNGLFKSVARQPDMLSEFRSLMFLGVAFIEGTFFVTLVFSFIIK
ATPL_STRPI      MNLTFLGLCIACMGVSVGEGLLMNGLFKSVARQPDMLSEFRSLMFLGVAFIEGTFFVTLVFSFIIK
ATPL_STRP7      MNLTFLGLCIACMGVSVGEGLLMNGLFKSVARQPDMLSEFRSLMFLGVAFIEGTFFVTLVFSFIIK
ATPL_STRP4      MNLTFLGLCIACMGVSVGEGLLMNGLFKSVARQPDMLSEFRSLMFLGVAFIEGTFFVTLVFSFIIK
ATPL_STRP2      MNLTFLGLCIACMGVSVGEGLLMNGLFKSVARQPDMLSEFRSLMFLGVAFIEGTFFVTLVFSFIIK
ATPL_STROR      MNLTFFGLCLACMGVSLAEGMLMNGLFKSAARQPDIIPQLRSLMIMGIAFIEGTFLVTLVFSFVIK
ATPL_STRMU      LNLKILALGIAVLGVSLGEGILVANIAKSAARQPEMYGKLQTLMIMGVAFIEGTFFVLLASTFFV-
ATPL_OENOB      -----IALCGSAIGAGIGNGMLMAKLIESIARQPELEGNLRTNMFISMALVEAMPIIVIAMSFVL-
ATPL_LACSS      ---------------SYGNGKVISKTIESMARQPELSAQLRSTMFIGVGLIEAVPILSIVVSFLI-
ATPL1_PELPD     -----IGMAIGTLGTAIGQGMAVKSAVEGVARNPGAASKIMTTMMIGLAMIESLAIYALVVCLII-
ATPL_FUSNN      ---------IAGLGPGIGEGYAAGKAVESVARQPEARGSIISTMILGQAVAESTGIYSLVIALIL-
ATPL2_PELCD     ------GMAIGSLGTGIGQGLAVKSALEGVARNPGASGKILTTMMIGLAMIESLAIYVFVVAMII-
ATPL_LACJO      ---------------SYGNGKVISKTIEGMARQPESANNLRATMFIGVGLIEAVPILAIVIGFLI-
ATPL1_PELCD     ------GMAFGSLGTAIGQGLAVKSALEGVARNPGASGKILTTMMIGLAMVESLAIYVFVVSMII-
ATPL_ILYTA      ---------IAGIGPGVGQGYAAGKAVESVARQPEAKGDIISTMVLGQAVAESTGIYSLVIALIL-
ATPL_MYCA5      --LTMVAAGLAIMGVSVGQGMAVAKAVEAIGRNPEATSKIRSTLIMGLAIVETAFIIALLIIFV--
ATPL_LACH4      -----------------GNGKVISKTLEGMARQPESADNLRATMFIGVGLIEAVPILAIVVAFLI-
ATP9_SCHPO      ----YIGAGLATIGVSVGIGLIFSNLISGTSRNPSVRPHLFSMAILGFALTEATGLFCLMLAFLI-
ATPL_LACCB      -------------------GMVISKTLEGMARQPEMAGTLRGTMFIGVGLIEAVPILSVVVAFML-
ATPL_LACC3      -------------------GMVISKTLEGMARQPEMAGTLRGTMFIGVGLIEAVPILSVVVAFML-
ATPL_BACLD      ---------------------------EGIARQPEAGKELRTLMFIGVALVEALPIIAVVIAFL--
ATPL_MYCGE      ---------IAGSTVGIGQGYIFGKAVEAIARNPEVEKQVFKLIFIGSAVSESTAIYGLLISFIL-
ATPL_BACSU      ---------------------------EGIARQPEAGKELRTLMFMGIALVEALPIIAVVIAFL--
ATPL_BACP2      ---------------------------EGIARQPEAGRELRTLMFIGVALVEALPIIAVVIAFL--
ATPL_BACA2      ---------------------------EGIARQPEAGKELRTLMFMGIALVEALPIIAVVIAFL--
ATPL_LACF3      -----------------------------MARQPEMSGQLRGTMFLGVGLIEALPILSIVIAFLV-
ATPL_SYNSC      ------------IGPGIGQGTASGGAVEGIARQPEAEGKIRGTLLLSLAFMESLTIYGLVVALVL-
ATPL_SYNS9      ------------IGPGIGQGTASGGAVEGIARQPEAEGKIRGTLLLSLAFMESLTIYGLVVALVL-
ATPL_SYNR3      ------------IGPGIGQGTASGGAVEGIARQPEAEGKIRGTLLLSLAFMESLTIYGLVVALVL-
ATPL_SYNPX      ------------IGPGIGQGTASGGAVEGIARQPEAEGKIRGTLLLSLAFMESLTIYGLVVALVL-
ATPL_STACT      ---------------------------EGVARQPEARGQLMSIMFIGIGLVEALPILGLVISFIV-
ATPL_GEOKA      ---------------------------EGIARQPELRPVLQTTMFIGVALVEALPIIGVVFSFI--
ATPL_ENTHR      ---------------------------ESMARQPEMSGQLRTTMFIGVALVEAVPILGVVIALIL-
ATPL_BACWK      ---------------------------EGVARQPELKGALQTIMFIGVALVEALPIIGVVIAFIV-
ATPL_BACST      ---------------------------EGIARQPELRPVLQTTMFIGVALVEALPIIGVVFSFI--
ATPL_BACP3      ---------------------------EGIARQPELRPVLQTTMFIGVALVEALPIIGVVFSFI--
ATPL_BACHK      ---------------------------EGVARQPELKGALQTIMFIGVALVEALPIIGVVIAFIV-
ATPL_BACCZ      ---------------------------EGVARQPELKGALQTIMFIGVALVEALPIIGVVIAFIV-
ATPL_BACCR      ---------------------------EGVARQPELKGALQTIMFIGVALVEALPIIGVVIAFIV-
ATPL_BACCQ      ---------------------------EGVARQPELKGALQTIMFIGVALVEALPIIGVVIAFIV-
ATPL_BACCN      ---------------------------EGVARQPELKGALQTIMFIGVALVEALPIIGVVIAFIV-
ATPL_BACC7      ---------------------------EGVARQPELKGALQTIMFIGVALVEALPIIGVVIAFIV-
ATPL_BACC4      ---------------------------EGVARQPELKGALQTIMFIGVALVEALPIIGVVIAFIV-
ATPL_BACC3      ---------------------------EGVARQPELKGALQTIMFIGVALVEALPIIGVVIAFIV-
ATPL_BACC2      ---------------------------EGVARQPELKGALQTIMFIGVALVEALPIIGVVIAFIV-
ATPL_BACC1      ---------------------------EGVARQPELKGALQTIMFIGVALVEALPIIGVVIAFIV-
ATPL_BACC0      ---------------------------EGVARQPELKGALQTIMFIGVALVEALPIIGVVIAFIV-
ATPL_BACAN      ---------------------------EGVARQPELKGALQTIMFIGVALVEALPIIGVVIAFIV-
ATPL_BACAH      ---------------------------EGVARQPELKGALQTIMFIGVALVEALPIIGVVIAFIV-
ATPL_BACAC      ---------------------------EGVARQPELKGALQTIMFIGVALVEALPIIGVVIAFIV-
ATPL_BACAA      ---------------------------EGVARQPELKGALQTIMFIGVALVEALPIIGVVIAFIV-
ATPL_SYNS3      ------------IGPGIGQGSASQGAVEGIARQPEAEGKIRGTLLLSLAFMESLTIYGLVVALVL-
ATPL_MYCPU      ---------IGNFGTGLGQGLSAGRAAEAVGRNPEAIKKIRSLMIIGMAISESASLYSFIIAILL-
ATPL_CLAMS      ---------------------------EAMARQPEMAGSLRTTMFLGIAFSEALALIGLATYFI--
ATPL_CLAM3      ---------------------------EAMARQPEMAGSLRTTMFLGIAFSEALALIGLATYFI--
ATPL_BIFAA      ---------------------------EGTARQPELGSRLQTLMFLGLAFVEVLALLGFVLAFI--
ATPL_HYDS0      ------------------------GAEEGMARNPNMAGKLQTIMFIGLAFIETFALYAMLFSII--
ATPL_BIFA0      ---------------------------ESTARQPELGGRLQTLMFLGLAFVEVLALLGFVAAFIFQ
ATPH_WELMI      -----LAVGLASIGPGVGQGTAAGQALEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALAL-
ATPH_GNEPA      -----LAVGLASIGPGVGQGTAAGQALEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALAL-
ATPL_SYNWW      --------------------------FEAIARQPEVGGDVRTLLFITLAFIETLTIYGLLIAFML-
ATPH_CHAGL      -----LAVGLASIGPGIGQGTAAGQAVEGIARQPEVDGKIRGTLLLSLAFMEALTIYGLVVALAL-
ATPL_EXIS2      ----------------------VNGTVLGQARQPELKNELRQTMFIGIGLVEALPIIGVAVGFLL-
ATPL_DICTD      ------GFSVALVGMNAAQGNAAASAFESVARQPEAGDQINRMLLFALAFIETIMIFTLTVALIL-
ATPL_BIFLI      ---------------------------ESTARQPEMSGKIQTIMFIGLALVEVLALIGFVAALIIR
ATPL_BACHD      ---------------------------EGVTRQPELRGSLQTLMFIGVPLAEAVPIIAIVVSFIL-
ATPH_TRACE      -----LAVGLASIGPGIGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALAL-
ATPH_STAPU      -----LAVGLASIGPGIGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALAL-
ATPH_SOLTU      -----LAVGLASIGPGIGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALAL-
ATPH_PIPCE      -----LAVGLASIGPGIGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALAL-
ATPH_PHYPA      -----LAVGLASIGPGIGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALAL-
ATPH_PELHO      -----LAVGLASIGPGIGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALAL-
ATPH_PAVLU      -----LSVGLAAIGPGIGQGSAAGQALEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLV------
ATPH_OENPA      -----LAVGLASIGPGIGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALAL-
ATPH_OENGL      -----LAVGLASIGPGIGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALAL-
ATPH_OENEH      -----LAVGLASIGPGIGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALAL-
ATPH_OENBI      -----LAVGLASIGPGIGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALAL-
ATPH_OENAR      -----LAVGLASIGPGIGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALAL-
ATPH_MARPO      -----LAVGLASIGPGIGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALAL-
ATPH_CUCSA      -----LAVGLASIGPGIGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALAL-
ATPH_CRYJA      -----LSVGLASIGPGIGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALAL-
ATPH_CICAR      -----LAVGLASIGPGIGQGTAAGQAVEGIARQPEAEDKIRGTLLLSLAFMEALTIYGLVVALAL-
ATPL_BACCA      ---------------------------EGIAAQPELRPVLQTTMFIGVALVEALPIIGVVFSFI--
ATPL_AQUAE      ----------------------VRGTQEGVARNPNAGGRLQTLMFIGLAFIETIALYGLLIAFIL-
ATPH_PAUCH      ------------IGPGIGQGTAAGSAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALVL-
ATPH_HETA4      -----LSVGLAAIGPGIGQGNAAGQAVEGIARQPEAENKIRGTLLLSLAFMEALTIYGLV------
ATPH_HETA2      -----LSVGLAAIGPGIGQGNAAGQAVEGIARQPEAENKIRGTLLLSLAFMEALTIYGLV------
ATPL_PEDPA      -------------------------MLEGMARQPELSGQLRTTMFIGVGLVEAMPILAFVISLLV-
ATPL_MYCPE      ---------IAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETCFIIAILLVFVAR
ATPL_DICT6      ------GLSVALVGMNAAQGNAAASALESVARQPEAGDQINRMLLFALAFIETIMIFTLTVALIL-
ATPL_BIFLO      ---------------------------ESTARQPEMSGKIQTIMFIGLALVEVLALIGFVAALII-
ATPL_BIFLD      ---------------------------ESTARQPEMSGKIQTIMFIGLALVEVLALIGFVAALII-
ATPL_BACME      ---------------------------EGTARQPEARGTLTSMMFVGVALVEALPIIAVVIAFMVQ
ATPH_CUSOB      ---------LASIGPGIGQGTAAGRAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALAL-
ATPH_CUSGR      ---------LASIGPGIGQGTAAGRAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALAL-
ATPL_SYNPW      ------------IGPGIGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALVL-
ATPL_HAEPS      -------LAFAALGTAIGFAILGGKFLESSARQPELASSLQTKMFIVAGLLDAIAMIAVGISLL--
ATPL_HAEIN      -------LAFAALGTAIGFAILGGKFLESSARQPELASSLQTKMFIVAGLLDAIAMIAVGISLL--
ATPL_HAEIG      -------LAFAALGTAIGFAILGGKFLESSARQPELASSLQTKMFIVAGLLDAIAMIAVGISLL--
ATPL_HAEIE      -------LAFAALGTAIGFAILGGKFLESSARQPELASSLQTKMFIVAGLLDAIAMIAVGISLL--
ATPL_HAEI8      -------LAFAALGTAIGFAILGGKFLESSARQPELASSLQTKMFIVAGLLDAIAMIAVGISLL--
ATPL_ACTSZ      -------LAFAALGTAIGFAILGGKFLESSARQPELASSLQTKMFIVAGLLDAIAMIAVGISLL--
ATPL_ACTPJ      -------LAFAALGTAIGFAILGGKFLESSARQPELASSLQTKMFIVAGLLDAIAMIAVGISLL--
ATPL_ACTP7      -------LAFAALGTAIGFAILGGKFLESSARQPELASSLQTKMFIVAGLLDAIAMIAVGISLL--
ATPL_ACTP2      -------LAFAALGTAIGFAILGGKFLESSARQPELASSLQTKMFIVAGLLDAIAMIAVGISLL--