[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for spne4:ACF56087.1

[Show Plain Result]


## Summary of Sequence Search
    1::292
    1::292     e-169  99%  292 aa  RSGA_STRR6 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    1::292     e-169  99%  292 aa  RSGA_STRPN RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    1::289     e-131  77%  290 aa  RSGA_STRP3 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    1::289     e-131  77%  290 aa  RSGA_STRP1 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    1::289     e-130  77%  290 aa  RSGA_STRP8 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    1::289     e-130  77%  290 aa  RSGA_STRP6 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    1::289     e-124  74%  290 aa  RSGA_STRA3 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    1::289     e-123  74%  290 aa  RSGA_STRA5 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    1::289     e-121  73%  290 aa  RSGA_STRMU RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    5::305     e-108  68%  307 aa  RSGA_LACLA RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    4::297     1e-85  54%  297 aa  RSGA_ENTFA RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    3::293     4e-82  54%  293 aa  RSGA_GEOKA RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    3::293     2e-81  53%  293 aa  RSGA_BACC1 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    3::293     2e-81  53%  293 aa  RSGA_BACAN RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    3::293     6e-81  54%  293 aa  RSGA_BACCN RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    3::293     8e-81  55%  293 aa  RSGA2_OCEIH RecName: Full=Putative ribosome biogenesis GTPase rsgA
    3::296     1e-80  55%  296 aa  RSGA_BACA2 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    3::293     2e-80  52%  293 aa  RSGA_GEOTN RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    3::293     2e-80  53%  293 aa  RSGA_BACCR RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    3::298     7e-80  53%  298 aa  RSGA_BACSU RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    4::296     1e-79  54%  296 aa  RSGA_LACF3 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    3::293     1e-79  51%  293 aa  RSGA_GEOSW RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    4::296     3e-79  55%  296 aa  RSGA_LACRJ RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    4::296     3e-79  55%  296 aa  RSGA_LACRD RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    4::297     5e-79  53%  299 aa  RSGA_LACSS RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    3::298     6e-77  54%  298 aa  RSGA_BACP2 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    2::291     4e-76  49%  291 aa  RSGA2_LISIN RecName: Full=Putative ribosome biogenesis GTPase rsgA
    2::291     1e-75  50%  291 aa  RSGA2_LISMO RecName: Full=Putative ribosome biogenesis GTPase rsgA
    2::291     5e-75  49%  291 aa  RSGA1_LISMF RecName: Full=Putative ribosome biogenesis GTPase rsgA
    3::293     1e-74  50%  293 aa  RSGA_BACSK RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    3::295     6e-74  51%  301 aa  RSGA_LEUCK RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    4::292     2e-73  51%  295 aa  RSGA_LEUMM RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    4::291     1e-72  49%  291 aa  RSGA_STACT RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    3::291     2e-72  49%  294 aa  RSGA_BACHD RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    4::291     4e-71  46%  291 aa  RSGA_STAS1 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    4::291     6e-71  47%  291 aa  RSGA_STAHJ RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    4::295     7e-70  49%  309 aa  RSGA_PEDPA RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    4::283     1e-69  52%  298 aa  RSGA1_LACPL RecName: Full=Putative ribosome biogenesis GTPase rsgA
    4::291     2e-66  44%  291 aa  RSGA_STAAR RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    4::291     3e-66  45%  291 aa  RSGA_STAES RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    4::291     4e-66  44%  291 aa  RSGA_STAAW RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    4::291     4e-66  44%  291 aa  RSGA_STAAS RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    4::291     4e-66  44%  291 aa  RSGA_STAAN RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    4::291     4e-66  44%  291 aa  RSGA_STAAM RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    4::291     6e-66  45%  291 aa  RSGA_STAEQ RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    4::291     2e-65  44%  291 aa  RSGA_STAAC RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    4::278     2e-63  45%  295 aa  RSGA_THETN RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    3::290     2e-63  43%  292 aa  RSGA_ALKMQ RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    1::282     5e-60  44%  290 aa  RSGA_CLOBB RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    1::282     8e-60  44%  290 aa  RSGA_CLONN RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    5::296     1e-58  42%  297 aa  RSGA_LACGA RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   18::289     2e-58  44%  292 aa  RSGA_CLOB6 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    1::285     2e-58  44%  288 aa  RSGA_CLOAB RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   18::289     3e-58  44%  292 aa  RSGA_CLOBM RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   18::289     3e-58  44%  292 aa  RSGA_CLOBJ RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    1::281     6e-58  42%  290 aa  RSGA_CLOTE RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   18::289     1e-57  43%  292 aa  RSGA_CLOBH RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   18::289     1e-57  43%  292 aa  RSGA_CLOB1 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   12::285     2e-57  43%  287 aa  RSGA_CLOP1 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   18::289     3e-57  43%  292 aa  RSGA_CLOBL RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   18::289     3e-57  43%  292 aa  RSGA_CLOBK RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    5::296     6e-57  42%  297 aa  RSGA_LACJO RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   12::285     6e-57  43%  287 aa  RSGA_CLOPE RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   12::285     8e-57  43%  287 aa  RSGA_CLOPS RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    5::296     1e-56  40%  296 aa  RSGA_LACAC RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    5::296     7e-56  42%  296 aa  RSGA_LACH4 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    1::282     4e-55  41%  290 aa  RSGA_CLOBA RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    1::301     6e-55  42%  302 aa  RSGA_EUBR3 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    1::283     6e-53  42%  290 aa  RSGA_CARHZ RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    1::281     1e-52  40%  281 aa  RSGA_MYCAP RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    1::272     6e-52  40%  272 aa  RSGA_MYCPU RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   17::282     3e-50  42%  290 aa  RSGA_CLOB8 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    1::283     6e-50  41%  285 aa  RSGA_MYCHJ RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    1::289     6e-50  39%  290 aa  RSGA_MOOTA RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    1::283     8e-50  41%  285 aa  RSGA_MYCH2 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    1::286     6e-49  39%  287 aa  RSGA_CLOK5 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    1::286     6e-49  39%  287 aa  RSGA_CLOK1 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    4::289     1e-48  38%  305 aa  RSGA_CLOCE RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    1::286     2e-48  41%  287 aa  RSGA_MYCPE RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    1::283     5e-48  40%  285 aa  RSGA_MYCH7 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   22::294     9e-48  38%  295 aa  RSGA_THEP1 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   22::294     9e-48  38%  295 aa  RSGA_THEMA RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   22::292     2e-45  37%  295 aa  RSGA_THENN RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    1::288     6e-45  39%  303 aa  RSGA_UREP2 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    1::310     1e-44  38%  325 aa  RSGA_FLAJ1 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    1::302     8e-44  38%  310 aa  RSGA2_BACTN RecName: Full=Putative ribosome biogenesis GTPase rsgA
    1::287     2e-43  39%  302 aa  RSGA_UREPA RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    1::309     2e-43  39%  326 aa  RSGA_FLAPJ RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   60::341     5e-43  39%  346 aa  RSGA_HAEIN RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   60::341     5e-43  39%  346 aa  RSGA_HAEIE RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   60::341     2e-42  39%  346 aa  RSGA_HAEI8 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   60::341     3e-42  39%  346 aa  RSGA_HAEIG RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    1::283     3e-42  40%  285 aa  RSGA_FUSNN RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    1::302     8e-42  38%  310 aa  RSGA_BACFR RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    1::302     8e-42  38%  310 aa  RSGA_BACFN RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    1::288     1e-41  36%  301 aa  RSGA_UREU1 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    1::302     1e-41  37%  310 aa  RSGA_BACV8 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    1::300     6e-41  37%  310 aa  RSGA_PARD8 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   48::298     8e-41  39%  304 aa  RSGA_PHYMT RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   59::340     1e-40  38%  350 aa  RSGA_YERPY RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   59::340     1e-40  38%  350 aa  RSGA_YERPS RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   59::340     1e-40  38%  350 aa  RSGA_YERPP RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   59::340     1e-40  38%  350 aa  RSGA_YERPN RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   59::340     1e-40  38%  350 aa  RSGA_YERPG RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   59::340     1e-40  38%  350 aa  RSGA_YERPE RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   59::340     1e-40  38%  350 aa  RSGA_YERPB RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   59::340     1e-40  38%  350 aa  RSGA_YERPA RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   59::340     1e-40  38%  350 aa  RSGA_YERP3 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    6::303     2e-40  38%  306 aa  RSGA_AYWBP RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    6::303     2e-40  37%  306 aa  RSGA_ONYPE RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    1::303     3e-40  36%  311 aa  RSGA_AZOPC RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   39::334     5e-40  38%  344 aa  RSGA_ACTPJ RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   39::334     5e-40  38%  344 aa  RSGA_ACTP7 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   39::334     5e-40  38%  344 aa  RSGA_ACTP2 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   93::340     7e-40  39%  350 aa  RSGA_YERE8 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   41::343     7e-40  40%  350 aa  RSGA_SHIFL RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   63::338     7e-40  39%  351 aa  RSGA_PHOLL RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    1::315     9e-40  36%  315 aa  RSGA_GRAFK RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   41::343     9e-40  41%  350 aa  RSGA_ECOLI RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   41::343     9e-40  41%  350 aa  RSGA_ECOLC RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   41::343     9e-40  41%  350 aa  RSGA_ECODH RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   41::343     9e-40  41%  350 aa  RSGA_ECOBW RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   41::343     1e-39  40%  350 aa  RSGA_SHIB3 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   41::343     1e-39  40%  350 aa  RSGA_ECOSM RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   41::343     1e-39  40%  350 aa  RSGA_ECOSE RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   41::343     1e-39  40%  350 aa  RSGA_ECOLU RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   41::343     1e-39  40%  350 aa  RSGA_ECOL6 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   41::343     1e-39  40%  350 aa  RSGA_ECOHS RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   41::343     1e-39  40%  350 aa  RSGA_ECO81 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   41::343     1e-39  40%  350 aa  RSGA_ECO7I RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   41::343     1e-39  40%  350 aa  RSGA_ECO5E RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   41::343     1e-39  40%  350 aa  RSGA_ECO57 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   41::343     1e-39  40%  350 aa  RSGA_ECO55 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   41::343     1e-39  40%  350 aa  RSGA_ECO45 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   41::343     1e-39  40%  350 aa  RSGA_ECO27 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   41::343     1e-39  40%  350 aa  RSGA_ECO24 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   41::338     2e-39  40%  353 aa  RSGA_KLEP3 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   41::343     2e-39  40%  350 aa  RSGA_ECO8A RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   22::288     2e-39  36%  302 aa  RSGA_AQUAE RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   61::335     2e-39  38%  348 aa  RSGA_ACTSZ RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   41::343     2e-39  40%  350 aa  RSGA_SALEP RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   41::343     2e-39  40%  350 aa  RSGA_SALDC RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   41::343     2e-39  41%  350 aa  RSGA_ESCF3 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   89::343     3e-39  39%  354 aa  RSGA_SHEON RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   61::334     3e-39  38%  342 aa  RSGA_HAEDU RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   11::322     5e-39  39%  370 aa  RSGA_ANAVT RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   41::343     6e-39  40%  350 aa  RSGA_SALTY RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   41::343     6e-39  40%  350 aa  RSGA_SALTI RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   41::343     6e-39  40%  350 aa  RSGA_SALPB RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   41::343     6e-39  40%  350 aa  RSGA_SALNS RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   41::343     6e-39  40%  350 aa  RSGA_SALHS RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   41::343     6e-39  40%  350 aa  RSGA_SALA4 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   67::344     6e-39  38%  350 aa  RSGA_HAES2 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   67::341     8e-39  35%  350 aa  RSGA_PASMU RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   52::344     8e-39  36%  350 aa  RSGA_HAES1 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   11::322     1e-38  38%  370 aa  RSGA1_ANASP RecName: Full=Putative ribosome biogenesis GTPase rsgA
   41::343     2e-38  39%  350 aa  RSGA_SALSV RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   61::341     2e-38  36%  352 aa  RSGA_MANSM RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    1::307     7e-38  34%  307 aa  RSGA_CYTH3 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   65::338     9e-38  34%  343 aa  RSGA_PSEE4 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   41::337     1e-37  39%  353 aa  RSGA_KLEP7 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
  116::351     1e-37  39%  354 aa  RSGA1_VIBPA RecName: Full=Putative ribosome biogenesis GTPase rsgA
   19::310     1e-37  37%  316 aa  RSGA_BURXL RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   94::350     2e-37  39%  387 aa  RSGA_VIBCH RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   59::346     2e-37  37%  352 aa  RSGA_PROMH RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   68::341     2e-37  34%  348 aa  RSGA_HAHCH RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   64::338     3e-37  36%  343 aa  RSGA_SACD2 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   63::338     3e-37  34%  343 aa  RSGA_AZOVD RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   65::338     3e-37  34%  343 aa  RSGA_PSEPK RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   65::338     3e-37  34%  343 aa  RSGA_PSEP1 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   51::306     3e-37  38%  309 aa  RSGA_PROMA RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    9::290     3e-37  36%  358 aa  RSGA_MICAN RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   21::308     3e-37  39%  314 aa  RSGA_BURPS RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   21::308     4e-37  39%  314 aa  RSGA_BURP6 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   21::308     4e-37  39%  314 aa  RSGA_BURP1 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   21::308     4e-37  39%  314 aa  RSGA_BURP0 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   65::338     6e-37  34%  343 aa  RSGA_PSEPW RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   65::338     6e-37  36%  343 aa  RSGA_PSEF5 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   65::338     1e-36  34%  343 aa  RSGA_PSEPG RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   60::335     2e-36  37%  349 aa  RSGA_SERP5 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    7::293     2e-36  37%  300 aa  RSGA_BORPE RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    7::293     2e-36  37%  300 aa  RSGA_BORPA RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    7::293     2e-36  37%  300 aa  RSGA_BORBR RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    6::309     2e-36  37%  310 aa  RSGA_PHYAS RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   22::311     2e-36  36%  317 aa  RSGA_BURP8 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   21::308     2e-36  38%  314 aa  RSGA_BURMS RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   21::308     2e-36  38%  314 aa  RSGA_BURMA RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   21::308     2e-36  38%  314 aa  RSGA_BURM9 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   21::308     2e-36  38%  314 aa  RSGA_BURM7 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   19::313     5e-36  39%  315 aa  RSGA_RALPJ RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    1::305     6e-36  37%  315 aa  RSGA_PORGI RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    1::305     8e-36  37%  315 aa  RSGA_PORG3 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   96::309     1e-35  41%  311 aa  RSGA_CHLTE RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   65::338     2e-35  34%  343 aa  RSGA_PSEPF RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   57::329     2e-35  38%  345 aa  RSGA_SODGM RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   57::342     3e-35  37%  349 aa  RSGA_PECCP RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   19::310     4e-35  36%  316 aa  RSGA_BURPP RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   63::338     2e-34  31%  343 aa  RSGA_PSEFS RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   63::342     3e-34  36%  349 aa  RSGA_ERWCT RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   59::344     4e-34  34%  351 aa  RSGA_MARAV RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   17::260     8e-34  38%  267 aa  RSGA_DICD3 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
  116::349     8e-34  36%  352 aa  RSGA1_VIBVY RecName: Full=Putative ribosome biogenesis GTPase rsgA
  116::349     8e-34  36%  352 aa  RSGA1_VIBVU RecName: Full=Putative ribosome biogenesis GTPase rsgA
   85::338     1e-33  35%  343 aa  RSGA_PSESM RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   62::348     1e-33  35%  352 aa  RSGA_ALCBS RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    7::315     2e-33  36%  369 aa  RSGA_SYNY3 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   24::306     2e-33  33%  307 aa  RSGA_GEMAT RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   44::258     3e-33  38%  274 aa  RSGA_MYCGA RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   85::340     5e-33  36%  340 aa  RSGA_CHRSD RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   56::341     6e-33  37%  353 aa  RSGA_ERWT9 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   51::315     6e-33  35%  316 aa  RSGA_DICNV RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   85::338     8e-33  34%  343 aa  RSGA_PSEU2 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   47::334     8e-33  32%  339 aa  RSGA_PSEAE RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   47::334     8e-33  32%  339 aa  RSGA_PSEAB RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   47::334     8e-33  32%  339 aa  RSGA_PSEA8 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   85::338     1e-32  34%  343 aa  RSGA_PSE14 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   65::338     4e-32  32%  343 aa  RSGA_PSEMY RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   89::314     5e-32  38%  314 aa  RSGA_NITEU RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   73::301     9e-32  35%  307 aa  RSGA_BORAP RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   67::317     9e-32  38%  352 aa  RSGA2_LACPL RecName: Full=Putative ribosome biogenesis GTPase rsgA
   24::310     2e-31  33%  346 aa  RSGA1_LISMO RecName: Full=Putative ribosome biogenesis GTPase rsgA
   73::301     4e-31  32%  307 aa  RSGA_BORBZ RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   73::301     4e-31  32%  307 aa  RSGA_BORBU RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   59::349     8e-31  33%  369 aa  RSGA_METAC RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   74::322     1e-30  34%  358 aa  RSGA2_VIBPA RecName: Full=Putative ribosome biogenesis GTPase rsgA
   14::302     1e-30  30%  313 aa  RSGA_NITMU RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   22::316     2e-30  35%  318 aa  RSGA_RALSO RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   96::341     2e-30  37%  352 aa  RSGA_HAMD5 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   73::307     4e-30  33%  307 aa  RSGA_BORGA RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   98::310     5e-30  36%  311 aa  RSGA_CHLP8 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   28::327     7e-30  34%  364 aa  RSGA_PELCD RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   64::321     9e-30  35%  351 aa  RSGA1_OCEIH RecName: Full=Putative ribosome biogenesis GTPase rsgA
   11::277     3e-29  36%  304 aa  RSGA_SYNSC RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   48::277     3e-29  36%  304 aa  RSGA_SYNS3 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   65::328     4e-29  31%  349 aa  RSGA2_VIBVU RecName: Full=Putative ribosome biogenesis GTPase rsgA
   26::309     7e-29  32%  313 aa  RSGA_BORRA RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   26::309     7e-29  32%  313 aa  RSGA_BORDL RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   47::317     4e-28  34%  318 aa  RSGA_VARPS RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   57::329     6e-28  34%  365 aa  RSGA_METMA RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   69::325     6e-28  32%  353 aa  RSGA2_VIBVY RecName: Full=Putative ribosome biogenesis GTPase rsgA
   39::320     8e-28  30%  332 aa  RSGA_XYLFM RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   56::323     3e-27  33%  359 aa  RSGA_LEPIC RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   35::288     4e-27  36%  348 aa  RSGA_THEEB RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   56::323     4e-27  33%  359 aa  RSGA_LEPIN RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   79::331     7e-27  33%  370 aa  RSGA_STRAW RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    9::310     7e-27  32%  312 aa  RSGA_PROMT RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   75::327     1e-26  32%  366 aa  RSGA_STRCO RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    9::310     2e-26  32%  312 aa  RSGA_PROM1 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
  119::329     2e-26  34%  341 aa  RSGA_XYLFA RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   65::323     1e-25  32%  367 aa  RSGA_OPITP RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
  119::329     2e-25  32%  341 aa  RSGA_XYLFT RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
  110::320     2e-25  32%  332 aa  RSGA_XYLF2 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   42::288     3e-25  35%  299 aa  RSGA_SYNPX RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   67::288     4e-25  33%  313 aa  RSGA_RHOBA RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   24::310     4e-25  31%  346 aa  RSGA1_LISIN RecName: Full=Putative ribosome biogenesis GTPase rsgA
   24::310     7e-25  31%  346 aa  RSGA2_LISMF RecName: Full=Putative ribosome biogenesis GTPase rsgA
   65::345     6e-24  33%  353 aa  RSGA2_ANASP RecName: Full=Putative ribosome biogenesis GTPase rsgA
   44::278     6e-23  33%  278 aa  RSGA_MYCGE RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   32::323     1e-22  29%  355 aa  RSGA1_BACTN RecName: Full=Putative ribosome biogenesis GTPase rsgA
   81::335     2e-22  31%  363 aa  RSGA_XANCP RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   81::335     2e-22  31%  363 aa  RSGA_XANCB RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   81::335     2e-22  31%  363 aa  RSGA_XANC8 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   81::335     2e-22  31%  363 aa  RSGA_XANAC RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
  131::294     2e-22  35%  307 aa  RSGA_NEIG2 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
  131::294     2e-22  35%  307 aa  RSGA_NEIG1 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   81::335     2e-22  31%  363 aa  RSGA_XANC5 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   71::322     3e-22  33%  346 aa  RSGA_RHILO RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   81::335     4e-22  31%  363 aa  RSGA_XANOR RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   81::335     4e-22  31%  363 aa  RSGA_XANOM RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
  135::294     7e-22  38%  307 aa  RSGA_NEIMF RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   81::335     9e-22  31%  363 aa  RSGA_XANOP RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
  131::286     9e-22  38%  307 aa  RSGA_NEIMA RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
  131::286     9e-22  38%  307 aa  RSGA_NEIM0 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   58::306     3e-21  32%  321 aa  RSGA_PROMM RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
  135::294     3e-21  38%  307 aa  RSGA_NEIMB RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   58::306     4e-21  32%  321 aa  RSGA_PROM3 RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
   53::278     1e-20  30%  278 aa  RSGA_MYCPN RecName: Full=Putative ribosome biogenesis GTPase rsgA; 
    1::55      7e-06  35%   60 aa  YRH1_AZOVI RecName: Full=Uncharacterized protein in rhdA
   26::98      9e-06  38%  504 aa  RBSA_VIBF1 RecName: Full=Ribose import ATP-binding protein rbsA;   
   25::97      3e-05  38%  493 aa  RBSA_HAEIN RecName: Full=Ribose import ATP-binding protein rbsA;   
   25::97      3e-05  38%  493 aa  RBSA_HAEI8 RecName: Full=Ribose import ATP-binding protein rbsA;   
  205::276     4e-05  43%  448 aa  MNME_ACHLI RecName: Full=tRNA modification GTPase mnmE;       
    7::79      4e-05  39%  198 aa  ENGB_PELTS RecName: Full=Probable GTP-binding protein engB;
   26::98      7e-05  36%  504 aa  RBSA_PHOPR RecName: Full=Ribose import ATP-binding protein rbsA;   
  344::405     7e-05  32%  587 aa  MSBA_HAEIN RecName: Full=Lipid A export ATP-binding/permease
  257::397     7e-05  32%  589 aa  MSBA_COXBU RecName: Full=Lipid A export ATP-binding/permease
   44::106     7e-05  39%  212 aa  ENGB_RICRS RecName: Full=Probable GTP-binding protein engB;
   44::106     7e-05  39%  212 aa  ENGB_RICPU RecName: Full=Probable GTP-binding protein engB;
   23::90      7e-05  32%  189 aa  ENGB_MYCGA RecName: Full=Probable GTP-binding protein engB;
   22::59      1e-04  47%  254 aa  HMUV_SHEDO RecName: Full=Hemin import ATP-binding protein hmuV;    
   44::106     1e-04  39%  212 aa  ENGB_RICAE RecName: Full=Probable GTP-binding protein engB;
   44::106     1e-04  39%  212 aa  ENGB_RICFE RecName: Full=Probable GTP-binding protein engB;
   44::106     1e-04  39%  212 aa  ENGB_RICCN RecName: Full=Probable GTP-binding protein engB;
   20::92      1e-04  32%  186 aa  ENGB_MYCPE RecName: Full=Probable GTP-binding protein engB;
  329::398     2e-04  29%  581 aa  MSBA_THICR RecName: Full=Lipid A export ATP-binding/permease
  181::283     2e-04  31%  448 aa  MNME_NEIMF RecName: Full=tRNA modification GTPase mnmE;       
  181::283     2e-04  31%  448 aa  MNME_NEIMB RecName: Full=tRNA modification GTPase mnmE;       
  181::283     2e-04  31%  448 aa  MNME_NEIMA RecName: Full=tRNA modification GTPase mnmE;       
  181::283     2e-04  31%  448 aa  MNME_NEIM0 RecName: Full=tRNA modification GTPase mnmE;       
  181::283     2e-04  31%  448 aa  MNME_NEIG2 RecName: Full=tRNA modification GTPase mnmE;       
  181::283     2e-04  31%  448 aa  MNME_NEIG1 RecName: Full=tRNA modification GTPase mnmE;       
  321::400     2e-04  39%  582 aa  MSBA_SODGM RecName: Full=Lipid A export ATP-binding/permease
   46::108     2e-04  39%  212 aa  ENGB_RICAH RecName: Full=Probable GTP-binding protein engB;
   25::86      3e-04  34%  208 aa  ENGB_UREPA RecName: Full=Probable GTP-binding protein engB;
   25::86      3e-04  34%  208 aa  ENGB_UREP2 RecName: Full=Probable GTP-binding protein engB;
   19::71      3e-04  45%  191 aa  ENGB_MARMM RecName: Full=Probable GTP-binding protein engB;
   70::171     4e-04  32%  512 aa  SPR3_YEAST RecName: Full=Sporulation-regulated protein 3;
   25::88      4e-04  34%  194 aa  ENGB_MYCAP RecName: Full=Probable GTP-binding protein engB;
    4::80      4e-04  36%  205 aa  ENGB_DESRM RecName: Full=Probable GTP-binding protein engB;
   18::65      4e-04  42%  286 aa  CBIO1_STAES RecName: Full=Cobalt import ATP-binding protein cbiO 1;
   18::65      4e-04  42%  286 aa  CBIO1_STAEQ RecName: Full=Cobalt import ATP-binding protein cbiO 1;
   93::229     4e-04  26%  525 aa  ASND1_YEAST RecName: Full=Asparagine synthetase domain-containing
  830::897     5e-04  44% 1511 aa  PDR12_YEAST RecName: Full=ATP-dependent permease PDR12;
   11::60      5e-04  40%  372 aa  MALK_MANSM RecName: Full=Maltose/maltodextrin import ATP-binding
   22::97      5e-04  39%  276 aa  HMUV_BURCH RecName: Full=Hemin import ATP-binding protein hmuV;    
   22::97      5e-04  39%  276 aa  HMUV_BURCA RecName: Full=Hemin import ATP-binding protein hmuV;    
    4::57      6e-04  36%  234 aa  THIQ_VIBF1 RecName: Full=Thiamine import ATP-binding protein thiQ; 
  307::432     6e-04  31%  684 aa  PEO1_HUMAN RecName: Full=Twinkle protein, mitochondrial;       
  332::400     6e-04  28%  582 aa  MSBA_YERPS RecName: Full=Lipid A export ATP-binding/permease
  332::400     6e-04  28%  582 aa  MSBA_YERPN RecName: Full=Lipid A export ATP-binding/permease
  332::400     6e-04  28%  582 aa  MSBA_YERPE RecName: Full=Lipid A export ATP-binding/permease
  332::400     6e-04  28%  582 aa  MSBA_YERPA RecName: Full=Lipid A export ATP-binding/permease
  332::400     6e-04  26%  582 aa  MSBA_ERWCT RecName: Full=Lipid A export ATP-binding/permease
   45::108     6e-04  35%  214 aa  ENGB_RICPR RecName: Full=Probable GTP-binding protein engB;
    3::103     6e-04  32%  217 aa  ENGB_EDWI9 RecName: Full=Probable GTP-binding protein engB;
   20::80      6e-04  36%  211 aa  ENGB_ACIC5 RecName: Full=Probable GTP-binding protein engB;
  908::954     6e-04  43% 1530 aa  BFR1_SCHPO RecName: Full=Brefeldin A resistance protein;
   15::58      8e-04  39%  252 aa  YCLP_BACSU RecName: Full=Uncharacterized ABC transporter
   26::62      8e-04  46%  264 aa  Y1087_HAEIN RecName: Full=Uncharacterized ABC transporter
    9::60      8e-04  38%  296 aa  ERA_FUSNN RecName: Full=GTP-binding protein era homolog;
   25::73      8e-04  39%  208 aa  ENGB_UREU1 RecName: Full=Probable GTP-binding protein engB;
   28::79      8e-04  41%  201 aa  ENGB_FINM2 RecName: Full=Probable GTP-binding protein engB;
    8::80      8e-04  36%  201 aa  ENGB_DESHY RecName: Full=Probable GTP-binding protein engB;
    8::80      8e-04  36%  201 aa  ENGB_DESHD RecName: Full=Probable GTP-binding protein engB;
    7::88      8e-04  37%  198 aa  ENGB_CLOB8 RecName: Full=Probable GTP-binding protein engB;
   13::101     8e-04  35%  322 aa  CDC10_YEAST RecName: Full=Cell division control protein 10;
    1::292

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MQGQIIKALAGFYYVESDGQVYQTRARGNFRKKGHTPYVGDWVDFSAEENSEGYILKIHERKNSLVRPPI
RSGA_STRR6      MQGQIIKALAGFYYVESDGQVYQTRARGNFRKKGHTPYVGDWVDFSAEENSEGYILKIHERKNSLVRPPI
RSGA_STRPN      MQGQIIKALAGFYYVESDGQVYQTRARGNFRKKGHTPYVGDWVDFSAEENSEGYILKIHERKNSLVRPPI
RSGA_STRP3      MQGKIIKSLAGFYYVESEGQVYQTRARGNFRKRGETPYVGDIVDFSAEDNSEGYILAIYPRKNSLVRPPI
RSGA_STRP1      MQGKIIKSLAGFYYVESEGQVYQTRARGNFRKRGETPYVGDIVDFSAEDNSEGYILAIHPRKNSLVRPPI
RSGA_STRP8      MQGKIIKSLAGFYYVESEGQVYQTRARGNFRKRGETPYVGDIVDFSAEDNSEGYILAIHPRKNSLVRPPI
RSGA_STRP6      MQGKIIKSLAGFYYVESEGQVYQTRARGNFRKRGETPYVGDIVDFSAEDNSEGYILAIHPRKNSLVRPPI
RSGA_STRA3      MQGRIVKSLAGFYYVESDGVVYQTRARGNFRKKGQIPYVGDWVEFSSQDQSEGYILSIEERKNSLVRPPI
RSGA_STRA5      MQGRIVKSLAGFYYVESDGVVYQTRARGNFRKKGQIPYVGDWVEFSSQDQSEGYILSIEERKNSLVRPPI
RSGA_STRMU      MQGKIIESLAGFYYVESDGQIYQTRARGNFRKKGHKPYVGDEVDFSAKENSEGYILAIHERKNSLVRPPI
RSGA_LACLA      --GRIVKSLAGFYDVESEGEVYQTRARGNFRKKGMKPVVGDFVEFSTEENSEGYILKIGERKNSLIRPSI
RSGA_ENTFA      LKGQIRKALSGFYYVYADGETYQTRARGNFRNRKITPLVGDEVLFESDNLTDGYVLEILPRRNELVRPPV
RSGA_GEOKA      -EGQIIKALSGFYYVLSEGRVFQCRGRGVFRKKKVTPLVGDRVVFQATSETEGYILEIGERQNELVRPPI
RSGA_BACC1      -EGKIVKALSGFYYVQHEEGITQCRGRGVFRKNKITPLVGDQVVFQADNPSEGYVLEVFDRKNELVRPPI
RSGA_BACAN      -EGKIVKALSGFYYVQHEEGITQCRGRGVFRKNKITPLVGDQVVFQADNPSEGYVLEVFDRKNELVRPPI
RSGA_BACCN      -EGKIIKALSGFYYVQHEEGITQCRGRGVFRKNKITPLVGDQVVFQAENQNEGYVLEVFERKNELVRPPI
RSGA2_OCEIH     -EGRIIKALSGFYYVQSDNQQFVCKGRGLFRNKKITPLVGDYVEFEPKDDNEGYIMEIKERSNELVRPPI
RSGA_BACA2      -EGKIIKALSGFYYVESQDKIIQCRGRGIFRKNKITPLVGDYAVYQAENDKEGYLLEIKERTNELIRPPI
RSGA_GEOTN      -EGQIIKALSGFYYVLSEGKVFQCRGRGVFRKQKVTPLVGDRVVFTATGEAEGYILEICERQNELVRPPV
RSGA_BACCR      -EGKIIKALSGFYYVQHEEGVTQCRGRGVFRKNKITPLVGDQVVFQADNPTEGYVLEVFDRKNELVRPPI
RSGA_BACSU      -EGKIIKALSGFYYVEDSDKVIQCRGRGIFRKNKITPLVGDYVVYQAENDKEGYLMEIKERTNELIRPPI
RSGA_LACF3      --GTIQQSLSGFYDIWSGGKLYRTRARGNFRKRGLKPVVGDQVEFEAENQREGYLLKILPRKNQLVRPMV
RSGA_GEOSW      -EGKIIKALSGFYYVLSEGKVFQCRGRGVFRKQKITPLVGDHVEFQATSETEGYIMNIRERKNWLVRPPI
RSGA_LACRJ      --GIIQQSLSGFYDVIADEKIYRTRARGNFRQRKIKPVVGDHVEFSAENQQEGYLLKILPRRNQLVRPPV
RSGA_LACRD      --GIIQQSLSGFYDVIADEKIYRTRARGNFRQRKIKPVVGDHVEFSAENQQEGYLLKILPRRNQLVRPPV
RSGA_LACSS      --GQIIRALSGFYDVQSEHKIYRTRARGNFRKRKITPLVGDFVEFESESQTEGYILEILDRKNEMIRPPV
RSGA_BACP2      -EGKIIKALSGFYYVQESGKVVQCRARGIFRKNKITPLVGDYVVYQADNDKEGYLLEVKERTNELVRPPI
RSGA2_LISIN     LEGQIIKALSGFYYVFSEGKIYQCRARGNFRKRNISPLVGDDVEFQVENKTDGYILDVLSRENALVRPPV
RSGA2_LISMO     LEGQIIKALSGFYYVFSEGKVYQCRARGNFRKRNISPLVGDDVEFQIENKTDGYILDVMSRENALVRPPV
RSGA1_LISMF     LEGQIIKALSGFYYVFSEGKVYQCRARGNFRKRNISPLVGDDVEFQIENKTDGYILDVMSRENALVRPPV
RSGA_BACSK      -EGLIVKALSGFYYVQSEGALIQCRGRGVFRKRKQTPLVGDYVEFEAENETDGYVMAIKERKNQLNRPPI
RSGA_LEUCK      -KGRIIRSLSGYYDIETDGKIQRTRARGEFRKSGQKPIVGDFVDFESE-NDDGLIWKIYPRINALVRPPI
RSGA_LEUMM      --GRIIRSLSGYYDIQPSGDIQRTRARGEFRKSKQKPLVGDFVDFESE-NDEGFIWAIHERENFLVRPPI
RSGA_STACT      --GRIIKSLSGVYRVDSDGEMFDTKPRGLFRKKKFSPIVGDIVDFEIENVTEGYIQHVHERQNELKRPPV
RSGA_BACHD      -KGTIVKALSGFYYVQNEDGLFQCRGRGNFRNRNIKPLVGDEVVFEAENKTDGYVLEIMERKNELLRPPI
RSGA_STAS1      --GRIIKSISGVYRVDVDGEMYDTKPRGLFRKNKFSPIVGDVVDFEVENVTEGYIHHVHERKNEIKRPPV
RSGA_STAHJ      --GRIIKLISGVYQVDVDGTLYDTKPRGLFRKKKFSPIVGDIVDFEIQNTSEGYIHHVHERHNELKRPPV
RSGA_PEDPA      --GQIIQLLAGFYDVTEDHKIVRTRARGNFRNQKTSPLVGDMVDFKESENDTGYITKIHTRENELVRPPL
RSGA1_LACPL     --GQIRQSLSGFYDVYADGQMYRTRARGNFRKRRITPLVGDNVEFDAATPQEGYVLNILDRQTQLVRPPV
RSGA_STAAR      --GRIVKSISGVYQVDVNGERFNTKPRGLFRKKKFSPVVGDIVEFDVQNINEGYIHQVYERKNELKRPPV
RSGA_STAES      --GRIVKLISGVYQVDVEGERFDTKPRGLFRKKKFSPVVGDIVDFEVQNTKEGYIHHVHDRNNELKRPPV
RSGA_STAAW      --GRIVKSISGVYQVDVNGERFNTKPRGLFRKKKFSPVVGDIVEFEVQNINEGYIHQVFERKNELKRPPV
RSGA_STAAS      --GRIVKSISGVYQVDVNGERFNTKPRGLFRKKKFSPVVGDIVEFEVQNINEGYIHQVFERKNELKRPPV
RSGA_STAAN      --GRIVKSISGVYQVDVNGERFNTKPRGLFRKKKFSPVVGDIVEFEVQNINEGYIHQVFERKNELKRPPV
RSGA_STAAM      --GRIVKSISGVYQVDVNGERFNTKPRGLFRKKKFSPVVGDIVEFEVQNINEGYIHQVFERKNELKRPPV
RSGA_STAEQ      --GRIVKLISGVYQVDVEGERFDTKPRGLFRKKKFSPVVGDIVDFEVQNTKEGYIHHVHDRNNELKRPPV
RSGA_STAAC      --GRIVKSISGVYQVDVNGERFNTKPRGLFRKKKFSPVVGDIVEFEVQNINEGYIHQVFERENELKRPPV
RSGA_THETN      IQGRIVRGIAGFYYVATERGIIECRARGKFRKDNIIPLVGDIAEVQLVNEKEGYILEILPRKNQLVRPPV
RSGA_ALKMQ      -KGKLIKGIAGFYYVEVNKEVYECKGRGILRKKKLTPLVGDYVEITVEDNKKGMIDDIFPRKTELIRPTV
RSGA_CLOBB      MKGKIIKGIAGFYYVKVEENLIECKARGKFRHKDVKPMVGDNVVIQVE-NGKGVIESIEKRSSELLRPAV
RSGA_CLONN      MEGIILKGIGGFYYVKTEERVYECKARGKFRNKKLTPMVGDRVIITPNDNNYGAIEEICTRDNYLIRPQV
RSGA_LACGA      -QGTIVSAISGYYDVEIENEVVRTRARGVFRDRKQKPLVGDRVVVQLDNQGMNYLIEILPRTNEIGRPAV
RSGA_CLOB6      ---------------DNSEEIIECKARGKFRHTELTPMIGDYVEISIDKNNKGAIEKIYERRSELFRPAV
RSGA_CLOAB      MQGIIIKGIAGFYYVKVEEEIYECKARGKFRLGELSPIVGDKVDITVI-NGKGVIEKIHPRTNKLIRPPV
RSGA_CLOBM      ---------------DNSEEIIECKARGKFRHTELTPMIGDYVEISVDKNNKGAIEKIYERRSELFRPAV
RSGA_CLOBJ      ---------------DNSEEIIECKARGKFRHTELTPMIGDYVEISIDKNNKGAIEKIYERRSELFRPAV
RSGA_CLOTE      MQGIITKGIGGFYYIKTEDGLYECKARGKFRLDELTPMVGDKVEIEIDNNSKGTIEKIFERKNKLIRPAV
RSGA_CLOBH      ---------------DNSEEIIECKARGKFRHTELTPMIGDYVEISIDKNNKGAIEKIYERRSELFRPAV
RSGA_CLOB1      ---------------DNSEEIIECKARGKFRHTELTPMIGDYVEISIDKNNKGAIEKIYERRSELFRPAV
RSGA_CLOP1      -----------FYYIKTDEGIIECKARGKFRYNSLKPMVGDRVTIKVE-NGKGVIEDIHERSSELIRPTV
RSGA_CLOBL      ---------------DNSEEIIECKARGKFRHTELTPMIGDYVEISIDKNNKGAIEKIYERRSELFRPAV
RSGA_CLOBK      ---------------DNSEEIIECKARGKFRHTELTPMIGDYVEISIDKNNKGAIEKIYERRSELFRPAV
RSGA_LACJO      -EGTIISAISGYYDVEIDNKVVRTRARGVFRDRKQKPLVGDRVVVQLDDQGMNYLIEILPRINEIGRPAV
RSGA_CLOPE      -----------FYYIKTDEGIIECKARGKFRYNSLKPMVGDRVTIKVE-NGKGVIEDIHERSSELIRPTV
RSGA_CLOPS      -----------FYYIKTDEGIIECKARGKFRYNSLKPMVGDRVTIKVE-NGKGVIEDIHERSSELIRPTV
RSGA_LACAC      -QGTVVGLIAGYYDVETATGIVRTRARGVFRQKKQKPAVGDRVEIQIDDKGMSYLVEILPRINRIGRPAV
RSGA_LACH4      -EGTVVGLIAGYYDVETAAGIVRTRARGVFRQKKQKPAVGDRVEIKIDDQGMSYLVKILPRLNRIGRPAV
RSGA_CLOBA      MKGKIIKGIAGFYYVKVEENLIECKARGKFRHKDVKPMVGDNVIIQVE-NGKGVIESIEKRSSELLRPAV
RSGA_EUBR3      MTGKIIKGIAGFYYVXXXXXLYECKAKGTFRKQKIKPLVGDTVDIAVEEKHIGNVERILPRKNELIRPAV
RSGA_CARHZ      MEGLVVKNYAGFYYVDTGKAIYMCKARGKFKKDNIKILTGDRVIIELVPNSEGVIESLLPRKNELIRPPI
RSGA_MYCAP      MKGKIYSINSGIYSIKDENNNFHNLALGVFRHKNIVPLVGDYVEFEKEK----YITKIYERQNEFIRPKV
RSGA_MYCPU      MIGRVYQVISGFYDIKCEDKFYRVRAIGNLRNLKLNPVVGDLVVFDES------LTKIEPRKNILIRPKV
RSGA_CLOB8      ----------------TDQGLIECKARGKFRHKDIKPMVGDDVTIKME-HGKGVIEEIHERKSELVRPTV
RSGA_MYCHJ      MKGQVVRIIAGFYDVPKNRKLYPLRGSGLLRLNETSPIVGDFVDFE----EKGFIKKIYERKNQLIRPKV
RSGA_MOOTA      MEGTLLRRYGGFYYVESEGRVWTCRLRGRFRLQETVFLPGDRVEIKPVGPGEGVIEDLKPRRTCLKRPAV
RSGA_MYCH2      MKGQVVRIIAGFYDVVDNRKLYPLRGSGLLRLNETSPIVGDFVDFE----EKGFIKKIYERKNQLIRPKV
RSGA_CLOK5      MRGTIMKGIGGFYYVNTDRGIIECRARGKFRYNGLFPMVGDKVEIKLERD-QGIIDEICPRISQLKRPAV
RSGA_CLOK1      MRGTIMKGIGGFYYVNTDRGIIECRARGKFRYNGLFPMVGDKVEIKLERD-QGIIDEICPRISQLKRPAV
RSGA_CLOCE      --GIILKGIGGFYYVEKTEDIFECKPRGVFRKNSVTPLPGDRVGFSIIDGDKGNIDEILPRSSELVRPAV
RSGA_MYCPE      MNAKILFKIANSFYDLSTKSQFNAVIRKKLKQEDRIITVGDNVEF-VKDQYEYVIEKIDERKNLLIRPKV
RSGA_MYCH7      MKGQIVRIIAGFYDVVDNRKLYPLRGSGLLRLNETSPIVGDFVDFE----EKGFIKKIYERKNQLIRPKV
RSGA_THEP1      ---------------EETGERILCKLRGKFRLQNLKIYVGDRVEYTPDETGSGVIENVLHRKNLLTKPHV
RSGA_THEMA      ---------------EETGERILCKLRGKFRLQNLKIYVGDRVEYTPDETGSGVIENVLHRKNLLTKPHV
RSGA_THENN      ---------------EETGERLLCKLRGKFRLQNLKIYVGDRVEYTPDGTGSGVIENVLHRKNLLVKPHV
RSGA_UREP2      MRAKIISVVANNFYVHLYDLKIQIKAKGIFKHNSHEPMVGDDVEVELIGNTY-LITKIYERYNQLIRPKV
RSGA_FLAJ1      MTGTVYKSTGSWYTVKSEGDFVECRMKGKFRIKGNPIAVGDIVDYELDETSDGTIHTIHERKNYIVRKSV
RSGA2_BACTN     MKGLVIKNTGSWYQVKTDGQFIECKIKGNFRLKGNPVAVGDRVQIILNQEGTAFINEIEDRKNYIIRRSA
RSGA_UREPA      MRAKIISVVANNFYVHLYDLKIQIKAKGIFKHNSHEPMVGDDVEVELIGNTY-LITKIYERYNQLIRPKV
RSGA_FLAPJ      MTGIVYKSTGSWYTVKSQGHFMECRIKGKFRMKGNPIAVGDVVDYDLDENSDGTITKIHDRKNYIVRKSV
RSGA_HAEIN      ------------------GEIY----RCNLRRTLSSLVVGDKVVWRKGNEQSGVIEAIHPRENEISRPPI
RSGA_HAEIE      ------------------GEIY----RCNLRRTLSSLVVGDKVVWRKGNEQSGVIEAIHPRENEISRPPI
RSGA_HAEI8      ------------------GEIY----RCNLRRTLSSLVVGDKVVWRKGNEQSGVIEAIHPRENEISRPPI
RSGA_HAEIG      ------------------GEIY----RCNLRRTLSSLVVGDKVVWRKGNEQSGVIEAIHPRENEISRPPI
RSGA_FUSNN      ----MINKIQGFYYVESNGQVFECKLRGILKKTNYNCVVGDRVEIS-EDNS---IVEIFKRDNLLIRPIV
RSGA_BACFR      MKGLVIKNTGSWYQVKTDGQLVECKIKGNFRLKGNPVAVGDRVQIILNQEGTAFISEIEDRKNYIIRRSA
RSGA_BACFN      MKGLVIKNTGSWYQVKTDGQLVECKIKGNFRLKGNPVAVGDRVQIILNQEGTAFISEIEDRKNYIIRRSA
RSGA_UREU1      MRAKITSVIVNNFYVYIYDLKIETKAKGIFKHDSHEPMVGDDIEVELVDGVY-LIVKIYDRYNQLIRPKV
RSGA_BACV8      MKGLVIKNTGSWYLVKTDGRTIECKIKGNFRLKGNPIAVGDYVQIIINNEGTAFISEIEDRKNYIIRRAA
RSGA_PARD8      MRGLVIKNTGSWYTVRTDGRDIESKIKGNFRKSTNPVAVGDRVVIDINKEGTAFITEIEERKNYIIRRAA
RSGA_PHYMT      --------------------------------------VGDIVIY--ENYLDRYLIEVLERHNELNRPNI
RSGA_YERPY      -----------------------TQHRCNIRRTIKSLVTGDRVGLQAQEGVKGIVEAVHERTSVLTRPDL
RSGA_YERPS      -----------------------TQHRCNIRRTIKSLVTGDRVGLQAQEGVKGIVEAVHERTSVLTRPDL
RSGA_YERPP      -----------------------TQHRCNIRRTIKSLVTGDRVGLQAQEGVKGIVEAVHERTSVLTRPDL
RSGA_YERPN      -----------------------TQHRCNIRRTIKSLVTGDRVGLQAQEGVKGIVEAVHERTSVLTRPDL
RSGA_YERPG      -----------------------TQHRCNIRRTIKSLVTGDRVGLQAQEGVKGIVEAVHERTSVLTRPDL
RSGA_YERPE      -----------------------TQHRCNIRRTIKSLVTGDRVGLQAQEGVKGIVEAVHERTSVLTRPDL
RSGA_YERPB      -----------------------TQHRCNIRRTIKSLVTGDRVGLQAQEGVKGIVEAVHERTSVLTRPDL
RSGA_YERPA      -----------------------TQHRCNIRRTIKSLVTGDRVGLQAQEGVKGIVEAVHERTSVLTRPDL
RSGA_YERP3      -----------------------TQHRCNIRRTIKSLVTGDRVGLQAQEGVKGIVEAVHERTSVLTRPDL
RSGA_AYWBP      ----VLRFLAGVYYIKDKTLVIKTTQKENSSASDFIIKVGDIVLY--ELSCDTYLIQILPRKNELKRPNV
RSGA_ONYPE      ----VLRFLAGVYYIKDETQIIKTTQKENSSASDFIIKVGDIVFY--ELSCDTYLIQILPRKNELKRPNV
RSGA_AZOPC      MKGLVIKNTGSWYQLKTDGELIKAKLKGNFRLKGNPISIGDYVLIEKDLYGTAFISTIEDRKNYIIRRAA
RSGA_ACTPJ      -QGIVVTRHAKHADVETEGEIY----RCNLRRTLKNVVVGDQVSWRKGNEQSGVIEAIYPRKNELSRPDY
RSGA_ACTP7      -QGIVVTRHAKHADVETEGEIY----RCNLRRTLKNVVVGDQVSWRKGNEQSGVIEAIYPRKNELSRPDY
RSGA_ACTP2      -QGIVVTRHAKHADVETEGEIY----RCNLRRTLKNVVVGDQVSWRKGNEQSGVIEAIYPRKNELSRPDY
RSGA_YERE8      ---------------------------------------------------KGIVEAVHERTSVLTRPDL
RSGA_SHIFL      -EGIVISRFGMHADVESDGDVH----RCNIRRTIRSLVTGDRVVWRPGKNVKGIVEAVHERTSVLTRPPI
RSGA_PHOLL      --------------------------RCNIRRTIRSLVTGDRVVWQADVKVNGIVEAVHERTSVLTRPPI
RSGA_GRAFK      MQGTVYKSTGSWYQVKADGKFYECRIKGKFRIQGNPVAVGDEVSFDLEEGVEGVIKKIKERENYIIRKSV
RSGA_ECOLI      -EGIVISRFGMHADVESDGDVH----RCNIRRTIRSLVTGDRVVWRPGKNVKGIVEAVHERTSVLTRPPI
RSGA_ECOLC      -EGIVISRFGMHADVESDGDVH----RCNIRRTIRSLVTGDRVVWRPGKNVKGIVEAVHERTSVLTRPPI
RSGA_ECODH      -EGIVISRFGMHADVESDGDVH----RCNIRRTIRSLVTGDRVVWRPGKNVKGIVEAVHERTSVLTRPPI
RSGA_ECOBW      -EGIVISRFGMHADVESDGDVH----RCNIRRTIRSLVTGDRVVWRPGKNVKGIVEAVHERTSVLTRPPI
RSGA_SHIB3      -EGIVISRFGMHADVESDGDVH----RCNIRRTIRSLVTGDRVVWRPGKNVKGIVEAVHERTSVLTRPPI
RSGA_ECOSM      -EGIVISRFGMHADVESDGDVH----RCNIRRTIRSLVTGDRVVWRPGKNVKGIVEAVHERTSVLTRPPI
RSGA_ECOSE      -EGIVISRFGMHADVESDGDVH----RCNIRRTIRSLVTGDRVVWRPGKNVKGIVEAVHERTSVLTRPPI
RSGA_ECOLU      -EGIVISRFGMHADVESDGDVH----RCNIRRTIRSLVTGDRVVWRPGKNVKGIVEAVHERTSVLTRPPI
RSGA_ECOL6      -EGIVISRFGMHADVESDGDVH----RCNIRRTIRSLVTGDRVVWRPGKNVKGIVEAVHERTSVLTRPPI
RSGA_ECOHS      -EGIVISRFGMHADVESDGDVH----RCNIRRTIRSLVTGDRVVWRPGKNVKGIVEAVHERTSVLTRPPI
RSGA_ECO81      -EGIVISRFGMHADVESDGDVH----RCNIRRTIRSLVTGDRVVWRPGKNVKGIVEAVHERTSVLTRPPI
RSGA_ECO7I      -EGIVISRFGMHADVESDGDVH----RCNIRRTIRSLVTGDRVVWRPGKNVKGIVEAVHERTSVLTRPPI
RSGA_ECO5E      -EGIVISRFGMHADVESDGDVH----RCNIRRTIRSLVTGDRVVWRPGKNVKGIVEAVHERTSVLTRPPI
RSGA_ECO57      -EGIVISRFGMHADVESDGDVH----RCNIRRTIRSLVTGDRVVWRPGKNVKGIVEAVHERTSVLTRPPI
RSGA_ECO55      -EGIVISRFGMHADVESDGDVH----RCNIRRTIRSLVTGDRVVWRPGKNVKGIVEAVHERTSVLTRPPI
RSGA_ECO45      -EGIVISRFGMHADVESDGDVH----RCNIRRTIRSLVTGDRVVWRPGKNVKGIVEAVHERTSVLTRPPI
RSGA_ECO27      -EGIVISRFGMHADVESDGDVH----RCNIRRTIRSLVTGDRVVWRPGKNVKGIVEAVHERTSVLTRPPI
RSGA_ECO24      -EGIVISRFGMHADVESDGDVH----RCNIRRTIRSLVTGDRVVWRPGKNVKGIVEAVHERTSVLTRPPI
RSGA_KLEP3      -EGIVISRFGMHADVESDGSVH----RCNIRRTIRSLVTGDRVDAADGVNVKGIVEAVHERASVLTRPPI
RSGA_ECO8A      -EGIVISRFGMHADVESDGDVH----RCNIRRTIRSLVTGDRVVWRPGKNVKGIVEAVHERTSVLTRPPI
RSGA_AQUAE      -------------YLFEDGKTYRGIPRGKVLKKTKIN-AGDYVWGEVVDPNTFAIEEVEERKNLLIRPKV
RSGA_ACTSZ      ----------------AQGEVF----RCNLRRTLAGVVVGDLVIWRQGHEKSGVIEAVKPRKNELSRPDY
RSGA_SALEP      -EGIVISRLGMHADVESDGEVH----RCNIRRTIRSLVTGDRVVWAAAENVKGIVEAVHERTSVLTRPPI
RSGA_SALDC      -EGIVISRLGMHADVESDGEVH----RCNIRRTIRSLVTGDRVVWAAAENVKGIVEAVHERTSVLTRPPI
RSGA_ESCF3      -EGIVISRFGMHADVESDGDVH----RCNIRRTIRSLVTGDRVKLAAEGNVKGIVEAVHERTSVLTRPPI
RSGA_SHEON      ------------------------------------------IESQANSGIAGIVEAVHPRHSSLSRPDL
RSGA_HAEDU      --------------------------RCNLRRTLKNVVVGDHVSWRKGSQQSGVIEAVYPRHNELSRPDY
RSGA_ANAVT      --GTVVAVQANFYKVQLDQDVREPGSRGXXKKIGQQVMVGDRVVVEEPDGGRGAIAEVLSRQTQLDRPPI
RSGA_SALTY      -EGIVISRFGMHADVESDGEVH----RCNIRRTIRSLVTGDRVVWAAAENVKGIVEAVHERTSVLTRPPI
RSGA_SALTI      -EGIVISRFGMHADVESDGEVH----RCNIRRTIRSLVTGDRVVWAAAENVKGIVEAVHERTSVLTRPPI
RSGA_SALPB      -EGIVISRFGMHADVESDGEVH----RCNIRRTIRSLVTGDRVVWAAAENVKGIVEAVHERTSVLTRPPI
RSGA_SALNS      -EGIVISRFGMHADVESDGEVH----RCNIRRTIRSLVTGDRVVWAAAENVKGIVEAVHERTSVLTRPPI
RSGA_SALHS      -EGIVISRFGMHADVESDGEVH----RCNIRRTIRSLVTGDRVVWAAAENVKGIVEAVHERTSVLTRPPI
RSGA_SALA4      -EGIVISRFGMHADVESDGEVH----RCNIRRTIRSLVTGDRVVWAAAENVKGIVEAVHERTSVLTRPPI
RSGA_HAES2      --------------------------RCNLRRTLKSVVVGDRVVWRKGKEQRGVIEAVQPRHNQIVRPPI
RSGA_PASMU      --------------------------RCNLRRTLSSLVVGDWRKGNAQQGVSGVIEAIKPRQNEIARPDY
RSGA_HAES1      ------------YAVHADVENEQGEVRCNLRRTLKSVVVGDRVVWRKGKEQRGVIEAVQPRHNQIVRPDY
RSGA1_ANASP     --GTVVAVQANFYKVQLDQEVREQGSRGXXKKIGQQVMVGDRVVVEEPDGGRGAIADVLSRQTQLDRPPI
RSGA_SALSV      -EGIVISRFGMHADVESDGEVH----RCNIRRTIRSLVTGDRVVWAAAENVKGIVEAVHERTSVLTRPPI
RSGA_MANSM      ----------------SQGEIF----RCNLRRTLANVVVGDHVVWRRGHEKSGVIEAIKPRENEIARPDY
RSGA_CYTH3      MKGIIYKSTGSWYLVKADGTYYNARLRGKFKKVTNPLSVGDFVDMNIDPPTEAMIFNIEPRTNYIIRRSA
RSGA_PSEE4      ---------------EAAGQVFRCHLRANLPAL----VTGDRVVWRAGNQGIGVIVAQMPRSTELCRPPV
RSGA_KLEP7      -EGIVISRFGMHADVESDGSVH----RCNIRRTIRSLVTGDRVDAADGVSVKGIVEAVHDRASVLTRPPI
RSGA1_VIBPA     -----------------------------------------------------------------LKPVA
RSGA_BURXL      --GLVVAAHGRHYLVAPDGAMLQCFPRG----KRSEVAVGDHVIYELASADQGVIVEIGERRNLLYRSDA
RSGA_VIBCH      ----------------------------------------------------GVVEAVEARSSVLVRPPV
RSGA_PROMH      ----------------ADGSI----TRCNIRRTISSLVTGDRVVWQTQENVRGIVEAVHERTSVLTRPPI
RSGA_HAHCH      ------------------GQIFRCYVRANI----DSLVTGDLVIWRAGPDNSGVIVARQPRESALKRPPI
RSGA_SACD2      ------------------------RLRCHLRATLGSVVTGDRIVFQ-EDDSSGIIVAIQPRSSTLVRPPV
RSGA_AZOVD      -----------------DGELAGQVCRCHLRANLPALVTGDRVVWRAGNQGGGVIVAQLPRRSELCRPDM
RSGA_PSEPK      ---------------ETAGQVFRCHLRANLPAL----VTGDRVVWRAGNQGIGVIVAQMPRSTELCRPPV
RSGA_PSEP1      ---------------ETAGQVFRCHLRANLPAL----VTGDRVVWRAGNQGIGVIVAQMPRSTELCRPPV
RSGA_PROMA      --------------------------RSRLSYKGHSVSVGDFVDWTAET---GVISFVEPRKNLITRPPV
RSGA_MICAN      LYGTVVAVQANFYQVRLDGENLLCTRRARLQKIGQSVMVGDRVRVEEANDQQGAIAEVLPRSTEIDRPAV
RSGA_BURPS      -QGRVIAAHGRHYIVADGGSMLQCFPRG---KKSEVA-VGDRVAYERTSADQGVIVEIGERRNLLYRSDA
RSGA_BURP6      -QGRVIAAHGRHYIVADGGPMLQCFPRG---KKSEVA-VGDRVAYERTSADQGVIVEIGERRNLLYRSDA
RSGA_BURP1      -QGRVIAAHGRHYIVADGGPMLQCFPRG---KKSEVA-VGDRVAYERTSADQGVIVEIGERRNLLYRSDA
RSGA_BURP0      -QGRVIAAHGRHYIVADGGPMLQCFPRG---KKSEVA-VGDRVAYERTSADQGVIVEIGERRNLLYRSDA
RSGA_PSEPW      ---------------EFAGQVFRCHLRANLPAL----VTGDRVVWRAGNQGIGVIVAQMPRSTELCRPPV
RSGA_PSEF5      ---------------ETAGQVFRCYLRANLPAL----VTGDQVVWRAGNQGIGVIVAQLPRSTELCRPPV
RSGA_PSEPG      ---------------EGAGQVFRCHLRANLPAL----VTGDRVVWRAGNQGIGVIVAQMPRSTELCRPPV
RSGA_SERP5      -----------------------TQHRCNIRRTLRSLVTGDRVVWGTHAGVKGIVEAVHERTSVLNRPDI
RSGA_BORPE      -EGLIIAAHGRHYTVEADGSLRQCFPRG----KKNGPAVGDRVRITPQGRDEGAIEAVLPRRNLLFRSDA
RSGA_BORPA      -EGLIIAAHGRHYTVEADGSLRQCFPRG----KKNGPAVGDRVRITPQGRDEGAIEAVLPRRNLLFRSDA
RSGA_BORBR      -EGLIIAAHGRHYTVEADGSLRQCFPRG----KKNGPAVGDRVRITPQGRDEGAIEAVLPRRNLLFRSDA
RSGA_PHYAS      ----VIRFLAGIYYIQDDNQILKAQKKGVLKKSNFIQKVGDIVLYGMCYDKY-LIYAILPRKNELKRPNI
RSGA_BURP8      VRGLVIAAHGRHYIVEDGSAILQCFPRG----KRSEIAVGDQVLYEPTSADQGVIVEIGERRNLLYRSDA
RSGA_BURMS      -QGRVIAAHGRHYIVADGGPMLQCFPR---RKKSEVA-VGDRVAYERTSADQGVIVEIGERRNLLYRSDA
RSGA_BURMA      -QGRVIAAHGRHYIVADGGPMLQCFPR---RKKSEVA-VGDRVAYERTSADQGVIVEIGERRNLLYRSDA
RSGA_BURM9      -QGRVIAAHGRHYIVADGGPMLQCFPR---RKKSEVA-VGDRVAYERTSADQGVIVEIGERRNLLYRSDA
RSGA_BURM7      -QGRVIAAHGRHYIVADGGPMLQCFPR---RKKSEVA-VGDRVAYERTSADQGVIVEIGERRNLLYRSDA
RSGA_RALPJ      --GLVIAAHGRHYLVERDGGGFQCFPRG----KRSECAVGDRVVYEATAVDQGVVVRVDERRNLLYRSDA
RSGA_PORGI      MDGVVIKNTGSQYLVRTDGTELYCMAKGNLRLKGNPVTVGDRVEIASQDGQPAYIKRIHPRRNYIIRRAS
RSGA_PORG3      MDGVVIKNTGSQYLVRTDGTELYCMAKGNLRLKGNPVAVGDRVEIASQDGQPAYIKRIHPRRNYIIRRAS
RSGA_CHLTE      ---------------------------------------------------------------------V
RSGA_PSEPF      ---------------ELAGQVFRCHLRANLPAL----VTGDQVVWRAGNQGIGVIVAQLPRTTELCRPPV
RSGA_SODGM      ---------------DAAGRIY----RCNLRRTLKSLVTGDKVVWRAGSEQSGIVEAVHPRRSVLTRPDV
RSGA_PECCP      ----------------TDGVVH----RCNIRRTLSSLVTGDRVVWRPGHESSGIVEAVHPRHSVLTRPPI
RSGA_BURPP      --GLVVAAHGRHYLVAPDGAMLQCFPRG----KRSEVAVGDRVVYELASADQGVIVEIGERRNLLYRSDA
RSGA_PSEFS      -----------------EGELAGSVSRCHLRANLPALVTGDKVVWRAGNQGIGVIVAQLPRTTELRRPPV
RSGA_ERWCT      --------------------------RCNIRRTISSLVTGDRVVWRPGHESSGIVEAVHPRHSVLTRPPI
RSGA_MARAV      -----IEALEG----PESGQVFRCFVRANI----DSLVTGDRVVWRPGKSKTGVIVARCERENLLQRPPV
RSGA_DICD3      --------------------------------------------------------RVHPRQSVLTRPPI
RSGA1_VIBVY     -----------------------------------------------------------------LKPVA
RSGA1_VIBVU     -----------------------------------------------------------------LKPVA
RSGA_PSESM      ---------------------------------------GDRVVWRAGNQGIGVIVAQLPRTTELRRPPV
RSGA_ALCBS      ---------------DGPGAENRTTRRCHFRATLEQLVVGDKVIWQPPKSEGGVVVAIEPRDTVLKRPDM
RSGA_SYNY3      -EGTVIAVQANYYWVRLRNVTSQPTRRTRLKKVGQKVMVGDQVRVEVAEGDLGAIAKVYPRRTVLERPPV
RSGA_GEMAT      ------------------GERFSASMRGRLKHEAHGALVGDRVTIARDQHAETWITDIHPRTSKLARRMV
RSGA_MYCGA      -----------------------------------------------ELNDQGEIIKLIERKNYLNRPKV
RSGA_CHRSD      ---------------------------------------GDHVVWRVAADGSGVVVARQPRQSVLERPPV
RSGA_ERWT9      ---------------DADGSVH----RCNIRRTIRSLVTGDRVRWEGGATVKGIVEAVHERTSVLTRPPI
RSGA_DICNV      ----------------------------DWRQKLGAIAVNDRVLITRDQPQHAIVEGIYPREKTLLKPVA
RSGA_PSEU2      ---------------------------------------GDRVVWRAGNQGIGVIVAQLPRTTELRRPPV
RSGA_PSEAE      --GQVIAHFGVQVEVESDGQVSRCHLRANLPAL----VTGDQVVWRAGNQGIGVIVAQLPRRSELCRPDM
RSGA_PSEAB      --GQVIAHFGVQVEVESDGQVSRCHLRANLPAL----VTGDQVVWRAGNQGIGVIVAQLPRRSELCRPDM
RSGA_PSEA8      --GQVIAHFGVQVEVESDGQVSRCHLRANLPAL----VTGDQVVWRAGNQGIGVIVAQLPRRSELCRPDM
RSGA_PSE14      ---------------------------------------GDRVVWRAGNQGIGVIVAQLPRTTELRRPPV
RSGA_PSEMY      ---------------ELAGQVFRCHLRANLPAL----VTGDQVVWRPGNQGDGVIVAQLPRSSELCRPDM
RSGA_NITEU      ----------------------------------------------------------------------
RSGA_BORAP      ------------------------------------------------------ILWRYNRKADLRQTIV
RSGA2_LACPL     --------------------------------------VGDWVCLSSSADNQAQIEAIAPRQSVLARGAV
RSGA1_LISMO     --GRVTAVFRDYYRVITENEEFASLKRGNFYELSSTPTVGDFVEISGDLQ----ILSVLERKTVFSRMNA
RSGA_BORBZ      ------------------------------------------------------ILWRYNKKADLRQTIV
RSGA_BORBU      ------------------------------------------------------ILWRYNKKADLRQTIV
RSGA_METAC      ------------------GAVVQAGISGALQRIGKQPVVGDFVVLLDQETGSRMVVNILPRRTCLSRGAA
RSGA2_VIBPA     --------------------------------------VGDWVILNEDQQFVRLLLSLFSRKGSKVAEQL
RSGA_NITMU      LRGEIVAAFGRHFLVKTADESTLTCV---LRGKKSGAACGDWVEIYQTASEQGVIERILPRSALLYRSDL
RSGA_RALSO      --GLVIAAHGRHYLVEKGGGLLQCFPRG----KRSECAVGDRVIFEATAVDQGXXXXXXXXXNLLHRSDA
RSGA_HAMD5      -------------------------------------------------NVKGIVEAVHERKSVLTRPDF
RSGA_BORGA      ------------------------------------------------------ILWRYNRKVDLRQAIV
RSGA_CHLP8      ----------------------------------------------------------------------
RSGA_PELCD      ---RVIRVGGGFYLLGADGE--QTATLAGQLRHGSTPAVGDWVGIDSPQEGGIRIHAILPRQTALKRATV
RSGA1_OCEIH     ------------------------------------PAVGDWVVLQEKDFNDIVIIQVLPRFSSIVRKQI
RSGA_SYNSC      --GMVVALQANYLEVELDGRLLCTR-RTRLSHRGEAVYVGDRVRVEAIDPGQGVVAEVEPRHSFLTRPPX
RSGA_SYNS3      ---------------------------------GEAVYVGDRVRVEAIDHARAVVADVEPRVSFLTRPPV
RSGA2_VIBVU     --------------------------------------VGDWVLLDEQQQFK----RLLERQSELSRKAA
RSGA_BORRA      --------------------VYEGVIKGKFREKEYSPLVGDFVCGDIYDEHKVYIKERMERRNALRQVIV
RSGA_BORDL      --------------------VYEGVIKGKFREKEYSPLVGDFVCGDIYDEHKVYIKERMERRNALRQVIV
RSGA_VARPS      ------------------------------RGKKSQAVVGDRVRWQASED-EGTIEEVVPRRNLFYRQDE
RSGA_METMA      --------------------VVQAGISGALQKIGKQPVVGDFVVLDQPELGSRMIVNILPRKTCLSRGAA
RSGA2_VIBVY     --------------------------------------VGDWVLLDEQQQFK----RLLERQSELSRKAA
RSGA_XYLFM      ---------SGYVVAEAPEVPIKVESLPAWQRRGFPPHVGDWVLLDGRRPRRTVIKRLAAGKHYRQQLIA
RSGA_LEPIC      ---------------------------GALMASGESIVTGDWVLIREIEGDELCIVKILPRKTFLRRSNA
RSGA_THEEB      --------------------------RARLKKMGQQVCVGDWVVVSHPDGQRGAIAEILPRRNQLSRPAI
RSGA_LEPIN      ---------------------------GALMASGESIVTGDWVLIREIEGDELCIVKILPRKTFLRRSNA
RSGA_STRAW      ---------------------------------------GDWVAVEPAGDPR-YVRTYLPRRSAFVRSTA
RSGA_PROMT      LKGIVVALKANFLIVEIDHKNFKDHSFDQFYRRSKLNYQGLFIDVGDYKNKRAVVSDVEPRQSFLKRPAV
RSGA_STRCO      ---------------------------------------GDWVAVEPGGNPR-YVRTYLPRRTAFVRSTA
RSGA_PROM1      LKGIVVALKANFLIVEIDHKNFKDYSFDEFNGKGLFIDVGDIVGVESIDNKRAVVSDVEPRQSFLKRPAV
RSGA_XYLFA      ----------------------------------------------------------------------
RSGA_OPITP      ------------------------------------PAVGDWVAVRLRPESVGDIHAVLPRRTAFTRRAV
RSGA_XYLFT      ----------------------------------------------------------------------
RSGA_XYLF2      ----------------------------------------------------------------------
RSGA_SYNPX      --------------------------------RGETVHVGDRVRVEAIDQARAVVSGVEPRCSWLTRPQX
RSGA_RHOBA      ---------------------------------------------SLKSEADGMIERVEPRTGMISRTSV
RSGA1_LISIN     --GRVTAVFRDFYRVITEGEFLATLKRGNFYEPSNLPAVGDFVEVSNEKQ----ILSVLQRKTIFSRMTA
RSGA2_LISMF     --GRVTAVFRDYYRVITENEEFASLKRGNFYELSSTPAVGDFVEVS----SDAQILSVLERKTVFSRMNA
RSGA2_ANASP     ------------------------------------PAVGDWVIIQTRE-SEGCIHGILPRKSKFSRKTV
RSGA_MYCGE      --------------------------------------VGDRVQLE-----DGAITKVLARKNELTRPRV
RSGA1_BACTN     --GRIIVTHKTCYEVVAEDGVYLCELTGNMRVPDEYPCTGDWVIFQPFDANKGIIVDILPRERALYRKKA
RSGA_XANCP      --------------------------------------VGDWVLMEGKR-----IVALLPRRTSIKRGAA
RSGA_XANCB      --------------------------------------VGDWVLMEGKR-----IVALLPRRTSIKRGAA
RSGA_XANC8      --------------------------------------VGDWVLMEGKR-----IVALLPRRTSIKRGAA
RSGA_XANAC      --------------------------------------VGDWVLMEGKR-----IVALLPRRTSIKRGAA
RSGA_NEIG2      ----------------------------------------------------------------------
RSGA_NEIG1      ----------------------------------------------------------------------
RSGA_XANC5      --------------------------------------VGDWVLMEGKR-----IVALLPRRTSIKRGAA
RSGA_RHILO      --------------------------------------VGDWVLVEPHSHLVQRRLTVLERRVQGGRGPA
RSGA_XANOR      --------------------------------------VGDWVLMEGKR-----IVALLPRRTSIKRGAA
RSGA_XANOM      --------------------------------------VGDWVLMEGKR-----IVALLPRRTSIKRGAA
RSGA_NEIMF      ----------------------------------------------------------------------
RSGA_XANOP      --------------------------------------VGDWVLMEGKR-----IVALLPRRTSIKRGAA
RSGA_NEIMA      ----------------------------------------------------------------------
RSGA_NEIM0      ----------------------------------------------------------------------
RSGA_PROMM      --------------------------------RGAAVHVGDWVEAIDWQERRAVVGDVEPRQSWINRPPX
RSGA_NEIMB      ----------------------------------------------------------------------
RSGA_PROM3      --------------------------------RGAAVHVGDWVEAIDWQERRAVVGDVEPRQSWINRPPX
RSGA_MYCPN      ----------------------------------------------------GVIVAVEERKNTLVRPKX
YRH1_AZOVI      ----------------------------------------------------------------------
RBSA_VIBF1      ----------------------------------------------------------------------
RBSA_HAEIN      ----------------------------------------------------------------------
RBSA_HAEI8      ----------------------------------------------------------------------
MNME_ACHLI      ----------------------------------------------------------------------
ENGB_PELTS      ----------------------------------------------------------------------
RBSA_PHOPR      ----------------------------------------------------------------------
MSBA_HAEIN      ----------------------------------------------------------------------
MSBA_COXBU      ---------------------------------------------------------------------L
ENGB_RICRS      ----------------------------------------------------------------------
ENGB_RICPU      ----------------------------------------------------------------------
ENGB_MYCGA      ----------------------------------------------------------------------
HMUV_SHEDO      ----------------------------------------------------------------------
ENGB_RICAE      ----------------------------------------------------------------------
ENGB_RICFE      ----------------------------------------------------------------------
ENGB_RICCN      ----------------------------------------------------------------------
ENGB_MYCPE      ----------------------------------------------------------------------
MSBA_THICR      ----------------------------------------------------------------------
MNME_NEIMF      ----------------------------------------------------------------------
MNME_NEIMB      ----------------------------------------------------------------------
MNME_NEIMA      ----------------------------------------------------------------------
MNME_NEIM0      ----------------------------------------------------------------------
MNME_NEIG2      ----------------------------------------------------------------------
MNME_NEIG1      ----------------------------------------------------------------------
MSBA_SODGM      ----------------------------------------------------------------------
ENGB_RICAH      ----------------------------------------------------------------------
ENGB_UREPA      ----------------------------------------------------------------------
ENGB_UREP2      ----------------------------------------------------------------------
ENGB_MARMM      ----------------------------------------------------------------------
SPR3_YEAST      ----------------------------------------------------------------------
ENGB_MYCAP      ----------------------------------------------------------------------
ENGB_DESRM      ----------------------------------------------------------------------
CBIO1_STAES     ----------------------------------------------------------------------
CBIO1_STAEQ     ----------------------------------------------------------------------
ASND1_YEAST     ----------------------------------------------------------------------
PDR12_YEAST     ----------------------------------------------------------------------
MALK_MANSM      ----------------------------------------------------------------------
HMUV_BURCH      ----------------------------------------------------------------------
HMUV_BURCA      ----------------------------------------------------------------------
THIQ_VIBF1      ----------------------------------------------------------------------
PEO1_HUMAN      -------------------------------------WLGD--DLRSWEAAKLFARKLNPKRCFLVRPG-
MSBA_YERPS      ----------------------------------------------------------------------
MSBA_YERPN      ----------------------------------------------------------------------
MSBA_YERPE      ----------------------------------------------------------------------
MSBA_YERPA      ----------------------------------------------------------------------
MSBA_ERWCT      ----------------------------------------------------------------------
ENGB_RICPR      ----------------------------------------------------------------------
ENGB_EDWI9      ----------------------------------------------------------------------
ENGB_ACIC5      ----------------------------------------------------------------------
BFR1_SCHPO      ----------------------------------------------------------------------
YCLP_BACSU      ----------------------------------------------------------------------
Y1087_HAEIN     ----------------------------------------------------------------------
ERA_FUSNN       ----------------------------------------------------------------------
ENGB_UREU1      ----------------------------------------------------------------------
ENGB_FINM2      ----------------------------------------------------------------------
ENGB_DESHY      ----------------------------------------------------------------------
ENGB_DESHD      ----------------------------------------------------------------------
ENGB_CLOB8      ----------------------------------------------------------------------
CDC10_YEAST     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VNIDQAVVIMSVKEPDFNSNLLDRFLVLLEHKGIHPIVYISKMDLLEDRGELDFYRQTYGDIGYDFVTSK
RSGA_STRR6      VNIDQAVVIMSVKEPDFNSNLLDRFLVLLEHKGIHPIVYISKMDLLEDRGELDFYQQTYGDIGYDFVTSK
RSGA_STRPN      VNIDQAVVIMSVKEPDFNSNLLDRFLVLLEHKGIHPIVYISKMDLLEDRGELDFYQQTYGDIGYDFVTSK
RSGA_STRP3      VNIDQAVVIMSAKEPEFNSNLLDRFLILLEHKAIHPVVYISKMDLLDSPEEIKAIGRQYQAIGYDFVTSL
RSGA_STRP1      VNIDQAVVIMSAKEPEFNSNLLDRFLILLEHKAIHPVVYISKMDLLDSPEEIKAIGRQYQAIGYDFVTSL
RSGA_STRP8      VNIDQAVVIMSAKEPEFNSNLLDRFLILLEHKAIHPVVYISKMDLLDSPEEIKAIGRQYQAIGYNFVTSL
RSGA_STRP6      VNIDQAVVIMSAKEPEFNSNLLDRFLILLEHKAIHPVVYISKMDLLDSPEEIKAIGRQYQAIGYNFVTSL
RSGA_STRA3      VNIDQAVVIMSAKEPDFNANLLDRFLVLLEYKMIQPIIYISKXXXXXXXXXXXXXREHYQNIGYVFCYSQ
RSGA_STRA5      VNIDQAVVIMSAKEPDFNANLLDRFLVLLEYKMIQPIIYISKXXXXXXXXXXXXXREHYQNIGYVFCYSQ
RSGA_STRMU      VNIDQAVVIISAKEPDFNHNLLDRFLILLEHRKISPIIYLSKTDLLEDLDEFKKVQKQYQKIGYYFVYYL
RSGA_LACLA      ANIDQAVIIMSTVSPNFSLNLLDRFLVFLEHKNIHPMIYISKLDLLTEMQELTDYEQIYEQIGYDVFFDA
RSGA_ENTFA      ANVDLGVVVMSMVSPNFSFNLLDRFLVSLEYKDIEPVIYLTKVDLLDERQQVTEIKQIYEALGYAVIASE
RSGA_GEOKA      ANVEQAILVFSAVSPDFSAKLLDRFLVLVESKRITPIIVISKIDLLESKEEIARYVHDYRRIGYDVIETS
RSGA_BACC1      ANVDQAILVFSAVEPDFNPGLLDRFLVLIEYHNIKPIICISKMDLVDERETVESYANDYREMGYDVLESI
RSGA_BACAN      ANVDQAILVFSAVEPDFNPGLLDRFLVLIEYHNIKPIICISKMDLVDERETVEAYANDYREMGYDVLESI
RSGA_BACCN      ANVDQAILVFSAVEPDFNPGLLDRFLVLIEYHNIKPIICISKMDLVDERKMVESYANDYREMGYAVLESI
RSGA2_OCEIH     ANIDQAIIVSSAVDPDFTTLLLDRFLVLIESKHIQPIILITKVDLLEDQLEIKLYKQHYEKIGYELVSSK
RSGA_BACA2      SNVDQAVLVFSAVQPAFSTSLLDRFLVLVEANGIHPIICITKMDLAADKEAILSYVKDYQAIGYDYVTSS
RSGA_GEOTN      ANVEQAILVFSAVSPDFSAKLLDRFLVLVESKNITPVIVISKIDLLDGKETIAQYVRDYRHIGYEVIETS
RSGA_BACCR      ANVDQAILVFSAVEPDFNPGLLDRFLVLIEYHNIKPIICISKMDLVDEKATVEAYANDYREMGYDVLESI
RSGA_BACSU      CNVDQAVLVFSAVQPSFSTALLDRFLVLVEANDIQPIICITKMDLIEDQDTEDTYAEDYRNIGYDYLTSS
RSGA_LACF3      ANVDLAVVVTAVKEPNLSTNLLDRQLVALESQGIDPVIYFSKTDLLSDQDALMLVVKGYQMIGYPVLYQR
RSGA_GEOSW      ANVEQAILVFSAVEPDFSTRLLDRFLVLVESKHIRPIIVVNKMDLVDDQTKMEQYIRDYRQIGYDVIETS
RSGA_LACRJ      ANVDMAVVVTSAKEPAFSANLLDRQLIALEAQDVTPLIYFSKTDLLTD----DEYQQLYRKIGYQVYAAR
RSGA_LACRD      ANVDMAVVVTSAKEPAFSANLLDRQLIALEAQDVTPLIYFSKTDLLTD----DEYQQLYRKIGYQVYAAR
RSGA_LACSS      ANIDQAVVIVSAVEPDFSLNLLDRFLIYLESLNIQGLVYLTKTDMISDEKEIKQYLDYYEKVGYPTFAPR
RSGA_BACP2      SNVDQAVLVFSAAEPTFSTSLLDRFLVLVEANHIEPIICITKMDLLEERETIMAYADDYRQIGYEVLTST
RSGA2_LISIN     ANIDIAILVFSAVEPDFSTNLADRFLVAIEKEDIQPVICISKMDLATDKEQIAVYKEVYETIGYDFVTNK
RSGA2_LISMO     ANIDIAILVFSAVEPDFSTNLADRFLVAIEKEDIKPVICISKMDLASEKEQIAVYKDIYEAIGYDFVTNK
RSGA1_LISMF     ANIDIAILVFSAVEPDFSTNLADRFLVAIEKEDIKPVICISKMDLASEKEQIAVYKDIYEAIGYDFVTNK
RSGA_BACSK      ANVDQAILVFSAKEPDFHTLLLDRFLVHIEQHDIKPVLIISKTDLLEERDALTRQVAMYEQIGYPYTSTK
RSGA_LEUCK      ANIDIAVIVTALKEPNFAANLLDRQLVALEAAHVKPVIYFSKADLLTDEAAITIIAEDYRQIGYTVVVAR
RSGA_LEUMM      ANIDIAVIVTAAKEPDFAPNLLDRQLVALEAANVRPLIYFSKMDLLEEHEKINHVANYYQSIGYDVIFSD
RSGA_STACT      SNIDHLVIVMSAVEPDFSTQLVDRFLVIAHSYGLNPRIVVTKKDMASDEKDLDVYRA----IGYQFVGKN
RSGA_BACHD      ANVDRAILVFSAAEPTFSPLLLDRFLVHVEANGIEPLIVISKIDXXXXXXXXXIYRNDYEQLGYKYLTST
RSGA_STAS1      SNVDHLIIVMSAVEPDFSTQLLDRFLVIAHSYHMRPRILVTKKDLLEKQHDIEKLLEVYENMSYQFISIN
RSGA_STAHJ      SNIDGLIIVMSAVEPDFSTQLLDRFLVIAHSYDLEPSILVTKKDLASENEQINAWLKIYEEIGYNFVTSQ
RSGA_PEDPA      ANIDQAVIVTAATEPSFSANLLDRQLVALAEKHIEAILYFSKTDLLSPTEFQDLQKIAYQKIGYQFPISS
RSGA1_LACPL     ANVDLGIVVTATTEQEFSTNLLDRQLVALAVAGIEPLLYFAKTDLLTD----EVYQQAYRQIGYQVICER
RSGA_STAAR      SNIDTLVIVMSAVEPNFSTQLLDRFLVIAHSYQLNARILVTKKDKIEKQFEINELLKIYENIGYEFIGNR
RSGA_STAES      SNIDELVIVMSAVEPEFSTQLLDRYLVIAHSYHLKPRILITKHDLASEQEILKIKDKIYQKIGYQFIGKD
RSGA_STAAW      SNIDTLVIVMSAVEPNFSTQLLDRFLVIAHSYQLNARVLVTKKDKIEKQFEINELLKIYENIGYEFIGNR
RSGA_STAAS      SNIDTLVIVMSAVEPNFSTQLLDRFLVIAHSYQLNARVLVTKKDKIEKQFEINELLKIYENIGYEFIGNR
RSGA_STAAN      SNIDTLVIVMSAVEPNFSTQLLDRFLVIAHSYQLNARVLVTKKDKIEKQFEINELLKIYENIGYEFIGNR
RSGA_STAAM      SNIDTLVIVMSAVEPNFSTQLLDRFLVIAHSYQLNARVLVTKKDKIEKQFEINELLKIYENIGYEFIGNR
RSGA_STAEQ      SNIDELVIVMSAVEPEFSTQLLDRYLVIAHSYHLKPRILITKHDIASEQEILKIKDKLYQKIGYQFIGKD
RSGA_STAAC      SNIDTLVIVMSAVEPNFSTQLLDRFLVIAHSYQLNARILVTKKDKIEKQFEINELLKIYENIGYEFIGNR
RSGA_THETN      ANVDQAIIVFAISKPEINRVLLDKMIVVAEINKIEPVVCINKVD-MEKREEVENLINVYRKIGYKAVGTS
RSGA_ALKMQ      ANVDQVIVVFSVTQPDPHLSLLDHFLILAETQNIDVVICLNKLDLVQ-REDVAELVGIYEKVGYPVILTS
RSGA_CLOBB      ANISLAFVVFAIKSPDINFDLLNKFLVLCEYNHIEAIVCLNKVDLVSEE-ERENVKKRINDIGYEYINAK
RSGA_CLONN      ANISQAFIVFALKNPDVNLDLLNKFLIQCELKNIKSIVCFNKIDLYGDYENHEAVKMV-SDAGYDYITNL
RSGA_LACGA      ANVSKVLLVISAVEPDFSLELLDRYLTFFAWKNVGVVIYLSKADITPTKCKLDYYQK----IGYSVFEDA
RSGA_CLOB6      ANVTQALVVFSFKNPDINIDLLNKFLLLCEYNNLKVIVCFNKMDLVNKEDYKDIISMIE-QAGYDFLNAK
RSGA_CLOAB      SNVTQAFIVFSIVNPEFSSDLLNKFLILCEFNNIKVKVCINKIDLVNEE-LLTPIKNLLNNTGYEFLNAK
RSGA_CLOBM      ANVTQALVVFSFKNPDINIDLLNKFLLLCEYNNLKAIVCFNKMDLVNKEDYKDIISMIE-QAGYDFLNAK
RSGA_CLOBJ      ANVTQALVVFSFKNPDINIDLLNKFLLLCEYNNLKAIVCFNKMDLVNKEDYKDIISMIE-QAGYDFLNAK
RSGA_CLOTE      SNISQAIIVFAFKNPNINLDLLNKFLLQCEYNEINAVVAFNKVDLVENP-EKEEVVDIIKSAGYEYLNAK
RSGA_CLOBH      ANVTQALVVFSFKNPDINIDLLNKFLLLCEYNNLKAIVCFNKMDLVNKEDYKDIISMIE-QAGYDFLNAK
RSGA_CLOB1      ANVTQALVVFSFKNPDINIDLLNKFLLLCEYNNLKAIVCFNKMDLVNKEDYKDIISMIE-QAGYDFLNAK
RSGA_CLOP1      ANVTQAFVVFAIKNPDINLDLLNRFLTLCEYNDIHAVVCLNKEDLCTXXXXXXXXXXXX-DIGYEFINAK
RSGA_CLOBL      ANVTQALVVFSFKNPDINIDLLNKFLLLCEYNNLKAIVCFNKMDLVNKEDYKDIISMIE-QAGYDFLNAE
RSGA_CLOBK      ANVTQALVVFSFKNPDINIDLLNKFLLLCEYNNLKAIVCFNKMDLVNKEDYKDIISMIE-QAGYDFLNAE
RSGA_LACJO      ANVSRVLLVISAVEPDFSLELLDRYLTFFAWKNVGVVIYLSKSDILKDQTELEYYQR----IGYPVFEDA
RSGA_CLOPE      ANVTQAFVVFAIKNPDINLDLLNRFLTLCEYNDIHAVVCLNKEDLCTXXXXXXXXXXXX-DIGYEFINAK
RSGA_CLOPS      ANVTQAFVVFAIKNPDINLDLLNRFLTLCEYNDIHAVVCLNKEDLCTXXXXXXXXXXXX-DIGYEFINAK
RSGA_LACAC      ANVSHVLLVISAVEPDFSLELLDRFLTFFSWQKVNVTIYLSKADLISEKESLDYYQKIGYPVFIDYHHLE
RSGA_LACH4      ANVSHILLVISAVEPDFSLELLDRFLTFFSWQKVKVTIYLSKTDLLKGKEDLAYYQK----IGYPVFTDY
RSGA_CLOBA      ANISLAFVVFAIKSPDINFDLLNKFLVLCEYNHIEAIVCLNKVDLVSEE-ERENVKKRINDIGYEYINAK
RSGA_EUBR3      SNIDMALVIFASAKPDPNFNLLDRFLCMMEYQHVPVTICFNKKDLITPQKQQEL-KSIYEPAGYRFTSTK
RSGA_CARHZ      ANVDQVLLVFAFADPFPSTELIDRLLVMAYALRLEVVLVFNKFDLVNPESQFEYYKKILGDTGID-----
RSGA_MYCAP      ANIDHIIIVMSIHEPEFQSFLVDKYMAFIESANIEPVLFNTKADLGTSK-----YKNEYESLGYSYKTDE
RSGA_MYCPU      ANIDQAIIVISLDQPKFSSFLLDKFLSIIEFQKIKVVIIFTKAD-LNTKEDIGYYLKTYQSTSLDDENSY
RSGA_CLOB8      ANVSLAFVVFAVKNPDINFDLLNKFLILCEYNNIEVIVCLNKIDLVSXXXXXXXXXXX-NVIGYEFINAK
RSGA_MYCHJ      ANIDQALVFISIREPNFSSLLLDKFLLVIEAKNIPVILLVTKIDLDSNFENLDYQKMNYXXXXXXXXXXE
RSGA_MOOTA      ANVEQVIIVFAXXXXXXXXXXXXXXXFLSGVEDIEAVIVWNKADISKQEGLPELYRQ----IGYNLITSA
RSGA_MYCH2      ANIDQALVFISIREPNFSSLLLDKFLLVIEAKNIPVILLVTKIDLDSNFENLDYQKMNYXXXXXXXXXXE
RSGA_CLOK5      ANVTQALVVFAFNHPEINEDLLNKFLISCEFNNLKPIVCFNXIDMIRNTGYEVIFLKAKEGYGIDKVREK
RSGA_CLOK1      ANVTQALVVFAFNHPEINEDLLNKFLISCEFNNLKPIVCFNXIDMIRNTGYEVIFLKAKEGYGIDKVREK
RSGA_CLOCE      ANVDQIAIIVAAKAPNPDYMLLDKLLITAETRNIRVLICVNKIDLDDDTAKI--VRNAYSPAGYDVIEIS
RSGA_MYCPE      ANIDTLIIVNSVKEPDFSSYGLNKFLAFYEARNINNIIYFSKMDLLQESKNMNQIISQYEQNGYIVLNSK
RSGA_MYCH7      ANIDQALVFISIREPNFSSLLLDKFLLVIEAKNIPVILLVTKIDLDSNFENLDYQKMNYXXXXXXXXXXE
RSGA_THEP1      ANVDQVILVVTVKMPETSTYIIDKFLVLAEKNELETVMVFNKMDLYDERELEEIYSELYPIVKTSAKTGM
RSGA_THEMA      ANVDQVILVVTVKMPETSTYIIDKFLVLAEKNELETVMVINKMDLYDERELEEIYSGLYPIVKTSAKTGM
RSGA_THENN      ANVDQAILVVTVKMPETSTYIIDKFLVLTEKNELETVLVINKMDIYXXXXXXXIYSKLYPIVKTSAKTGM
RSGA_UREP2      ANIDIVLIVVSIVQPDLNTLSLNKYLAFYEARNINVLIGLSKYDLANNHLKLDYKKNNYAV----FILTK
RSGA_FLAJ1      SNIDQVFLLVTIDNPPTTTSFIDRFLVTAEAYGIEAILIFNKIDTLNEQTLDDYLQHIYTEIGYKCISST
RSGA2_BACTN     ANLDQCMLVVTVNYPETSTIFIDRFLASAEAYRVPVKLVFNKVDAYDELRYLDALINLYTHIGYPCVSAK
RSGA_UREPA      ANIDIVLIVVSIVQPDLNTLSLNKYLAFYEARNINVLIGLSKYDLANNHLKLDYKKNNYAV----FILTK
RSGA_FLAPJ      SNLDYVFLLXXXXXXXXXXXFIDRFLVTAQAYGIETILVFNKIDTYNEADEQLFMQYIYQEIGYKCLRVS
RSGA_HAEIN      ANIDRIIIVSAVL-PTLSLNIIDRYLVVCEIAGITPLIVLNKVDLLEQRQEIEDQLKIYQDIGYEILMNM
RSGA_HAEIE      ANIDRIIIVSAVL-PTLSLNIIDRYLVVCEIAGITPLIVLNKVDLLEQRQEIEDQLKIYQDIGYEILMNM
RSGA_HAEI8      ANIDRIIIVSAVL-PTLSLNIIDRYLVVCEIAGITPLIVLNKVDLLEQRQEIEDQLKIYQDIGYEILMNM
RSGA_HAEIG      ANIDRIIIVSAVL-PTLSLNIIDRYLVVCEIAEIKPLIVLNKVDLLEQRQEIEDQLKIYQDIGYEILMNM
RSGA_FUSNN      ANVDYLAIQFAAKHPNIDFERINLLLLTAFYYKIKPIVIVNKIDYXXXXXXXXFLISCYQNIGL------
RSGA_BACFR      ANLDQCMLVVTVNYPETSTTFIDRFLASAEAYRVPVKILFNKVDAYDEDEYLDSLITLYTQIGYPCFTIR
RSGA_BACFN      ANLDQCMLVVTVNYPETSTTFIDRFLASAEAYRVPVKILFNKVDAYDEDEYLDSLITLYTQIGYPFKISA
RSGA_UREU1      ANVDIVLVVASIVQPDLNTLTLNKYLAFYEARNVKNVIGLSKYDLASDSLKLDYQRNNYKV----FVLTN
RSGA_BACV8      ANLDQCMLIVTINYPETSTIFIDRFLATAEAYRVPVKLIFNKTDRYDDTRYMDALINLYTYIGYPFKVSA
RSGA_PARD8      ANLDQAMLIVTVNYPITTTIFIDRFLATAEAYRVPVKLVFNKIDRYEDQRALECLIELYTSIGYPCSTTE
RSGA_PHYMT      ANFNQVILVFSLYKPRFQFRLLDXXXXXXXXXXXXXXXXFTKIDLITKKKFLNFYRIYY--VNSKNKNST
RSGA_YERPY      ANIDQIVIVSAIL-PELSLNIIDRYLVACETLEVEPLIVLNKIDLLDADGRVDGMMDIYRRIGYDVLEGM
RSGA_YERPS      ANIDQIVIVSAIL-PELSLNIIDRYLVACETLEVEPLIVLNKIDLLDADGRVDGMMDIYRRIGYDVLEGM
RSGA_YERPP      ANIDQIVIVSAIL-PELSLNIIDRYLVACETLEVEPLIVLNKIDLLDADGRVDGMMDIYRRIGYDVLEGM
RSGA_YERPN      ANIDQIVIVSAIL-PELSLNIIDRYLVACETLEVEPLIVLNKIDLLDADGRVDGMMDIYRRIGYDVLEGM
RSGA_YERPG      ANIDQIVIVSAIL-PELSLNIIDRYLVACETLEVEPLIVLNKIDLLDADGRVDGMMDIYRRIGYDVLEGM
RSGA_YERPE      ANIDQIVIVSAIL-PELSLNIIDRYLVACETLEVEPLIVLNKIDLLDADGRVDGMMDIYRRIGYDVLEGM
RSGA_YERPB      ANIDQIVIVSAIL-PELSLNIIDRYLVACETLEVEPLIVLNKIDLLDADGRVDGMMDIYRRIGYDVLEGM
RSGA_YERPA      ANIDQIVIVSAIL-PELSLNIIDRYLVACETLEVEPLIVLNKIDLLDADGRVDGMMDIYRRIGYDVLEGM
RSGA_YERP3      ANIDQIVIVSAIL-PELSLNIIDRYLVACETLEVEPLIVLNKIDLLDADGRVDGMMDIYRRIGYDVLEGM
RSGA_AYWBP      ANIDQVLLVFSLVKPNXXXXXXXXXXXXXXXXKLDVVLVFSKIDLLEPENQLSYYQKFQH---FYYINSK
RSGA_ONYPE      ANIDQVLLVFSLVKPNXXXXXXXXXXXXXXXXKLDVVLVFSKIDLLEPENQLSYYQKFQP---FYYINSK
RSGA_AZOPC      TNLDQAFLIVTVNYPITTTIFIDRFLVTTEAYRIPTLLFFNKTDLYNDMNYADILIHLYKSIGYSCATKD
RSGA_ACTPJ      ANIDQIIIVSAVL-PTLSLNIIDRYLVICETAKIPALIVLNKIDLLSESERQEVQKQLYENIGYETLCNM
RSGA_ACTP7      ANIDQIIIVSAVL-PTLSLNIIDRYLVICETAKIPALIVLNKIDLLSESERQEVQKQLYENIGYETLCNM
RSGA_ACTP2      ANIDQIIIVSAVL-PTLSLNIIDRYLVICETAKIPALIVLNKIDLLSESERQEVQKQLYENIGYETLCNM
RSGA_YERE8      ANIDQIVIVSAIL-PELSLNIIDRYLVACETLDVEPLIVLNKIDLLDADGRVDGMMDIYRRIGYNVLEGM
RSGA_SHIFL      ANIDQIVIVSAIL-PELSLNIIDRYLVACETLQIEPIIVLNKIDLLDDEGQMDIYR----NIGYRMVSSH
RSGA_PHOLL      ANIDQIVIVSAIL-PELSLNIIDRYLVACETLGIEPLIVLNKIDLLESRAWVNEIMSTYHNIGYRVLKGM
RSGA_GRAFK      SNIDQVXXXXXXXXXXXXXXXXDRFLVTAEAYDITAVLLFNKVDTIEELAEVKYLAELYRSAGYECIXXX
RSGA_ECOLI      ANIDQIVIVSAIL-PELSLNIIDRYLVACETLQIEPIIVLNKIDLLDDEGQMDIYR----NIGYRMVSSH
RSGA_ECOLC      ANIDQIVIVSAIL-PELSLNIIDRYLVACETLQIEPIIVLNKIDLLDDEGQMDIYR----NIGYRMVSSH
RSGA_ECODH      ANIDQIVIVSAIL-PELSLNIIDRYLVACETLQIEPIIVLNKIDLLDDEGQMDIYR----NIGYRMVSSH
RSGA_ECOBW      ANIDQIVIVSAIL-PELSLNIIDRYLVACETLQIEPIIVLNKIDLLDDEGQMDIYR----NIGYRMVSSH
RSGA_SHIB3      ANIDQIVIVSAIL-PELSLNIIDRYLVACETLQIEPIIVLNKIDLLDDEGQMDIYR----NIGYRMVSSH
RSGA_ECOSM      ANIDQIVIVSAIL-PELSLNIIDRYLVACETLQIEPIIVLNKIDLLDDEGQMDIYR----NIGYRMVSSH
RSGA_ECOSE      ANIDQIVIVSAIL-PELSLNIIDRYLVACETLQIEPIIVLNKIDLLDDEGQMDIYR----NIGYRMVSSH
RSGA_ECOLU      ANIDQIVIVSAIL-PELSLNIIDRYLVACETLQIEPIIVLNKIDLLDDEGQMDIYR----NIGYRMVSSH
RSGA_ECOL6      ANIDQIVIVSAIL-PELSLNIIDRYLVACETLQIEPIIVLNKIDLLDDEGQMDIYR----NIGYRMVSSH
RSGA_ECOHS      ANIDQIVIVSAIL-PELSLNIIDRYLVACETLQIEPIIVLNKIDLLDDEGQMDIYR----NIGYRMVSSH
RSGA_ECO81      ANIDQIVIVSAIL-PELSLNIIDRYLVACETLQIEPIIVLNKIDLLDDEGQMDIYR----NIGYRMVSSH
RSGA_ECO7I      ANIDQIVIVSAIL-PELSLNIIDRYLVACETLQIEPIIVLNKIDLLDDEGQMDIYR----NIGYRMVSSH
RSGA_ECO5E      ANIDQIVIVSAIL-PELSLNIIDRYLVACETLQIEPIIVLNKIDLLDDEGQMDIYR----NIGYRMVSSH
RSGA_ECO57      ANIDQIVIVSAIL-PELSLNIIDRYLVACETLQIEPIIVLNKIDLLDDEGQMDIYR----NIGYRMVSSH
RSGA_ECO55      ANIDQIVIVSAIL-PELSLNIIDRYLVACETLQIEPIIVLNKIDLLDDEGQMDIYR----NIGYRMVSSH
RSGA_ECO45      ANIDQIVIVSAIL-PELSLNIIDRYLVACETLQIEPIIVLNKIDLLDDEGQMDIYR----NIGYRMVSSH
RSGA_ECO27      ANIDQIVIVSAIL-PELSLNIIDRYLVACETLQIEPIIVLNKIDLLDDEGQMDIYR----NIGYRMVSSH
RSGA_ECO24      ANIDQIVIVSAIL-PELSLNIIDRYLVACETLQIEPIIVLNKIDLLDDEGQMDIYR----NIGYRMVSSH
RSGA_KLEP3      ANIDQIVVVSAIL-PELSLNIIDRYLVACEAQDIEPLIVLNKIDLLDDDGQMDIYR----NIGYRMVSSR
RSGA_ECO8A      ANIDQIVIVSAIL-PELSLNIIDRYLVACETLQIEPIIVLNKIDLLDDEGQMDIYR----NIGYRMVSSH
RSGA_AQUAE      ANVDRVIIVETLKMPEFNNYLLDNMLVVYEYFKVEPVIVFNKIDXXXXXXXXXXXRSIYRDAGYDVVSAK
RSGA_ACTSZ      YNIDRIIIVSAVL-PALSLNIIDRYLVICETANIPPVIVLNKIDLLEARQEAEQQLKIYRDIGYRTLMNM
RSGA_SALEP      ANIDQIVIVSAIL-PELSLNIIDRYLVGCETLQVEPLIVLNKIDLLDDEG-MDFVNEQYRNIGYRMVSSH
RSGA_SALDC      ANIDQIVIVSAIL-PELSLNIIDRYLVGCETLQVEPLIVLNKIDLLDDEG-MDFVNEQYRNIGYRMVSSH
RSGA_ESCF3      ANIDQIVIVSAIL-PELSLNIIDRYLVACETLQIEPIIVLNKIDLLDDEGQMDIYR----NIGYRMVSSH
RSGA_SHEON      YNIDQILIVSSVL-PSFTTQIIDRYLVAAEDTDIPPIIILNKIDLLEEAPAIEEALKRYQDIGYPVVSSK
RSGA_HAEDU      YNIDQIIIISAVM-PVLSLNIIDRYLVICENAGIPALIVLNKIDLLSEQERQHVQQQLYENIGYQTLCNM
RSGA_ANAVT      ANADQILLVFAVADPPLEPYQLSRFLVKAETTGLDVVLCLNKSDLISDRLLAWGYQPLF--ISVEKQINI
RSGA_SALTY      ANIDQIVIVSAIL-PELSLNIIDRYLVGCETLQVEPLIVLNKIDLLDDEG-MDFVNEQYRNIGYRMVSSH
RSGA_SALTI      ANIDQIVIVSAIL-PELSLNIIDRYLVGCETLQVEPLIVLNKIDLLDDEG-MDFVNEQYRNIGYRMVSSH
RSGA_SALPB      ANIDQIVIVSAIL-PELSLNIIDRYLVGCETLQVEPLIVLNKIDLLDDEG-MDFVNEQYRNIGYRMVSSH
RSGA_SALNS      ANIDQIVIVSAIL-PELSLNIIDRYLVGCETLQVEPLIVLNKIDLLDDEG-MDFVNEQYRNIGYRMVSSH
RSGA_SALHS      ANIDQIVIVSAIL-PELSLNIIDRYLVGCETLQVEPLIVLNKIDLLDDEG-MDFVNEQYRNIGYRMVSSH
RSGA_SALA4      ANIDQIVIVSAIL-PELSLNIIDRYLVGCETLQVEPLIVLNKIDLLDDEG-MDFVNEQYRNIGYRMVSSH
RSGA_HAES2      ANIDRIIIVSAVL-PNLSLNIIDRYLVVCESSNIPAVIVVNKADLLEARIEVGLQLEIYRKIGYELISAK
RSGA_PASMU      ANIDRIIIVSSVL-PTLSLNIIDRYLVICENAQIPAVIVVNKVDLLSDRAEVEAQLRIYQQIGYQTLMNM
RSGA_HAES1      ANIDRIIIVSAVL-PNLSLNIIDRYLVVCESSNIPAVIVVNKADLLEARTEVSLQLEIYQKIGYELISAK
RSGA1_ANASP     ANADQILLVFAVADPPLEPYQLSRFLVKAETTGLDVVLCLNKSDLISDRLLAWGYQPLF--ISVENQINI
RSGA_SALSV      ANIDQIVIVSAIL-PELSLNIIDRYLVGCETLQVEPLIVLNKIDLLDDEG-MDFVNEQYRNIGYRMVSSH
RSGA_MANSM      YNIDRIIIVSSVL-PALSLNIIDRYLVICENANIPAVILLNKVDLLTDEQEAEEQLEIYRKIGYETLMNM
RSGA_CYTH3      CNIDQSILLVTLKQPKTSIGFIDRFLISCEAFRIPAVIVFNKSDLYNEAEEYLYLKDVYEPLGYRCILTS
RSGA_PSEE4      AANVDLIVIVFAPAPEPHPNLIDRYLVAAEHAGIRPLLLLNKADLIENAPTLNAMLEVYRNLGYPLLEGM
RSGA_KLEP7      ANIDQIVVVSAIL-PELSLNIIDRYLVACEAQDIEPLIVLNKIDLLDDDGQMDIYR----NIGYRLVSSR
RSGA1_VIBPA     ANIDQMVIVSSVL-PELSLNIIDRYLVAAETLNIAPLLVLNKVDLLEDRAMYEEWLKEYERIGYKFVSKN
RSGA_BURXL      ANLDQLLIVLAT-EPHFSEDLLGRALVAAEANGLKPLIVLNKTDVTDELEGARKRLEPYRALGYTVVAAR
RSGA_VIBCH      ANVDQMVIVSSVL-PELSLNIIDRYLIASETLGIAPLIVLNKIDLLELREQYSTWLNDYRAIGYDYVSKK
RSGA_PROMH      ANIDQIIIVSAIL-PELSLNIIDRYLVACETLNIEPLIVLNKVDMLESRAMVSEWMQIYKDIGYRVLEVS
RSGA_HAHCH      ANIDQILIVIAA-EPEPHHNLVDRYLVASEAVGIPPLIILNKQDLINDRDALQQFKDQYQQLGYEWIDAS
RSGA_SACD2      ANVDQLLITIACAPEPF-SGLIDRYLAVAENLHIRPVLLFNKLDLLQS-DEIDSLRTLYTSLGYRCIDTL
RSGA_AZOVD      ANVDRIVIVFAPL-PEPHANLIDRYLVAAEHAGIRPLLLLNKADLVENAAGLDALLATYQRLGYPLLAGM
RSGA_PSEPK      AANVDLIVIVFAPAPEPHPNLIDRYLVAAEHAGLRPLLLLNKADLINDENGLHALLEVYRELGYPLLEGM
RSGA_PSEP1      AANVDLIVIVFAPAPEPHPNLIDRYLVAAEHAGLRPLLLLNKADLINDENGLHALLEVYRELGYPLLEGM
RSGA_PROMA      ANVTDVIIVVSLLDPSFDLNQVSRFLMKAEETGLKVTIVLTKRDLIDEKEKYDKKLQTWGPIPISIVNGE
RSGA_MICAN      ANIEQILLVFALAEPVLDPWLISRFLVKAESTGLEIAVCVNKIDLGEPE-QIEVWGDRLAGWGYRFVSVE
RSGA_BURPS      ANLDQLLIVLAT-EPYFSEDLLGRALIAAEANELKPIVVLNKIDV---EAALPVARERYRALGYDVLEAR
RSGA_BURP6      ANLDQLLIVLAT-EPYFSEDLLGRALIAAEANELKPIVVLNKIDV---EAALPVARERYRALGYDVLEAR
RSGA_BURP1      ANLDQLLIVLAT-EPYFSEDLLGRALIAAEANELKPIVVLNKIDV---EAALPVARERYRALGYDVLEAR
RSGA_BURP0      ANLDQLLIVLAT-EPYFSEDLLGRALIAAEANELKPIVVLNKIDV---EAALPVARERYRALGYDVLEAR
RSGA_PSEPW      AANVDLIVIVFAPAPEPHPNLIDRYLVAAEHAGIRPLLLLNKADLINDENALHALLEVYRDLGYPLLEGM
RSGA_PSEF5      AANVDMIVIVFAPMPEPHANLIDRYLVAAEHAGIRPLLLLNKADLIDEQNALNALLAVYRQLGYPLLEGM
RSGA_PSEPG      AANVDLIVIVFAPAPEPHPNLIDRYLVAAEHAGLRPLLLLNKADLINDENGLHALLEVYRELGYPLLEGM
RSGA_SERP5      ANIDQIVIVSAIL-PELSLNMIDRYLVACETLEVEPLIVLNKIDLLEARKTVDGMMDIYRHIGYRVLEGM
RSGA_BORPE      ANVDQLLIVVAV-EPTFADDLTGRSLAGAWSADIEPVIVLNKIDLPNGXXXXXXXXXXXXXXGVDHAMVH
RSGA_BORPA      ANVDQLLIVVAV-EPTFADDLTGRSLAGAWSADIEPVIVLNKIDLPNGXXXXXXXXXXXXXXGVDHAMVH
RSGA_BORBR      ANVDQLLIVVAV-EPTFADDLTGRSLAGAWSADIEPVIVLNKIDLPNGXXXXXXXXXXXXXXGVDHAMVH
RSGA_PHYAS      ANIDQVLLVFSLVKPHFQTXXXXXXXXXXQQHKLDVILVFSXXXXXXXQQNMNYYFPFYTCY---YVDSK
RSGA_BURP8      ANLDQLLIVLAT-EPHFSEDLLGRALVAAEENELKPLIVLNKIDVEAALPLARKRLQLYRGLGYTVLAAR
RSGA_BURMS      ANLDQLLIVLAT-EPYFSEDLLGRALIAAEANELKPIVVLNKIDV---EAALPVARERYRALGYDVLEAR
RSGA_BURMA      ANLDQLLIVLAT-EPYFSEDLLGRALIAAEANELKPIVVLNKIDV---EAALPVARERYRALGYDVLEAR
RSGA_BURM9      ANLDQLLIVLAT-EPYFSEDLLGRALIAAEANELKPIVVLNKIDV---EAALPVARERYRALGYDVLEAR
RSGA_BURM7      ANLDQLLIVLAT-EPYFSEDLLGRALIAAEANELKPIVVLNKIDV---EAALPVARERYRALGYDVLEAR
RSGA_RALPJ      ANLDQ-VIIMLGTEPSFSEDLLGRALVAAESLGITPLILLNKIDLLETRSRLALYR----DLGYTIVEXX
RSGA_PORGI      ANLDAAVLVCTINDPVTTTVFIDRFLATAEAYRVPVILVFNKIDCYEDRLQLDRLSAVYTAIGYPCCH--
RSGA_PORG3      ANLDAAVLVCTINDPVTTTVFIDRFLATAEAYRVPVILAFNKIDCYEDRLQLDRLSAVYTAIGYPCCH--
RSGA_CHLTE      ANIDQLVLITSFDDPPFNSRLVDRYLVFAESEKLPLLIVVNKIDLDEEEEDLEVYRQL--DCNICLVSAE
RSGA_PSEPF      AANVDMIVIVFAPLPEPHANLIDRYLVAAEHAGIRPLLLLNKFDLIDEQNALNALLAVYRTLGYPVLNGM
RSGA_SODGM      ANMDQ-IVIVSALLPELSLNIIDRYLVACETVEVEPLIVLNKIDLLTSRTEVEQLMAIYRRIGYRMVSSQ
RSGA_PECCP      ANIDQIVIVSAIL-PELSLNIIDRYLVACETLEIEPLIVLNKIDLLDDESRMDIYRANYRVLMVSSHTQQ
RSGA_BURPP      ANLDQLLVVLAT-EPHFSEDLLGRALVAAEANELKPLIVLNKTDVTDALEGARKRLEPYRALGYTVVAAR
RSGA_PSEFS      AANVDMIVIVFAPLPEPHANLIDRYLVAAEHAGIRPLLLLNKFDLIDEQNALNALLAVYRTLGYPVLNGM
RSGA_ERWCT      ANIDQIVIVSAIL-PELSLNIIDRYLVACETLEVEPLIVLNKIDLLDEKSRMDIYRALYRVLMVSSHTQQ
RSGA_MARAV      ANIDHIILVIA-PEPEPHDNLIDRYLVASESSDIPAVILLNKTDLINDRDQIEALLARYQALGYEVATPA
RSGA_DICD3      ANIDQIVIVSAIL-PELSLNIIDRYLVACETLEIEPLIVLNKIDLLDDEGRMDIYRALHYRVLMMSSHTQ
RSGA1_VIBVY     ANIDQMVIVSSVL-PELSLNIIDRYLIAAETLGIEPLLVLNKIDLLQE-AELATYREWLADIGYKILVSK
RSGA1_VIBVU     ANIDQMVIVSSVL-PELSLNIIDRYLIAAETLGIEPLLVLNKIDLLQE-AELATYREWLADIGYKILVSK
RSGA_PSESM      AANVDLIVIVFAPMPEPHANLIDRYLVAAEHAGIHPLLLLNKADLIDEQNALNALLAVYRTLGYPVLEGM
RSGA_ALCBS      ANVEQMLVVFAPL-PTPSSSLLDRYLVAAELSGIAATLVLNKADLIDDRPFVDELSDMYRHLGYPVLEQR
RSGA_SYNY3      ANAEQICLVFALTDPPLEEWQLSRFLVQAEATGLEISLCFNKQDLVQET-DVKFWGDRLAAWGYAPIIIS
RSGA_GEMAT      ANLDQVLVVFAAARPDPHPRMLDRFLVIAEANGLSARIVINKADLVSPEVSAALFADQMAPVHHTSIHTG
RSGA_MYCGA      ANLDHVVLVFSIKDPQLNLKQLFKFMVYFESQGFKPLIVFSKLDLDHDQNEFKKIVEALEQINYQVFKLN
RSGA_CHRSD      ANIAQILIVFAV-EPAPHPNLIDRYLVAAEATGITPVLVLNKTDLLPETGDLRTLLARYRAIGYRVVAAS
RSGA_ERWT9      ANINQIVIVSAIL-PELSLNIIDRYLVASETLNVEPLLVLNKTDLLDDEGRVDEQMEIYRHIGYRVLMKK
RSGA_DICNV      SNIDQLLITFA-PVPDWQNALLDRFLVAAHQAHIEPAFFCNKSDLFDAQNRLAIYHQLGYRVFYGSIYQK
RSGA_PSEU2      AANVDLIVIVFAPMPEPHANLIDRYLVAAEHAGIRPLLLLNKADLIDEQNALNALLAVYRTLGYPVLEGM
RSGA_PSEAE      ANVDRIVIVFAPR-PEPHANLIDRYLIAAEHAGIQPLLLLNKADLVDESNAIDALLNVYRTLGYPLIEAM
RSGA_PSEAB      ANVDRIVIVFAPR-PEPHANLIDRYLIAAEHAGIQPLLLLNKADLVDESNAIDALLNVYRTLGYPLIEAM
RSGA_PSEA8      ANVDRIVIVFAPR-PEPHANLIDRYLIAAEHAGIQPLLLLNKADLVDESNAIDALLNVYRTLGYPLIEAM
RSGA_PSE14      AANVDLIVIVFAPMPEPHANLIDRYLVAAEHAGIRPLLLLNKADLIDEQNALNALLAVYRTLGYPVLEGM
RSGA_PSEMY      ANVDQIVIVFAPL-PEPHANLIDRYLVAAEHAGIRPLLLLNKADLIDEQNQLEALLKVYRQLGYPLLEGM
RSGA_NITEU      -NATQLVFVLAVV-PSCNLELLDRCLVAAESQGIRPLILLNKIDLIEQRQAVAHHLMFYRELGYPVLESV
RSGA_BORAP      SNIDNILIVNSANFPEMKNFFIDRVLVVAEEQNIVPIIVINKIDKGISQ-RVEEFSEIYKNLGYKVLKTS
RSGA2_LACPL     TNINTIFICMSLNA-DFNVRRLERYLTIAWDSGALPVIVLTKADLCTD---LATKLRAVADVGVPTITCS
RSGA1_LISMO     ANFDYALIVMSLNH-DFNLNRLERYLTVAWDSGATPIIILTKADLVED---LSFYAQQLEAVAYGVPAYY
RSGA_BORBZ      SNIDNVLIVSSANFPEMKNFFIDRVLIVAEEQNIVPIIVINKIDKGISQKAQEF-SEIYENLGYKVLKTS
RSGA_BORBU      SNIDNVLIVSSANFPEMKNFFIDRVLIVAEEQNIVPIIVINKIDKGISQKAQEF-SEIYENLGYKVLKTS
RSGA_METAC      ANLDTIFIVTSVGK-DLNLRRLERYLAIVYSSGASPVILLNKIDLADDPARLEKIRDVTGDVPVIPLSSK
RSGA2_VIBPA     INVDTVFIVCSLNH-DFNLSRIERYLALVHEADVEPVIVLSKADLCDDVDELKSQVQKLDPLGLDAESTS
RSGA_NITMU      ANATQVIIVVA-PVPSFSEELINRCLVAAESQQLSVLIVLNKTDLLGPSNGLSLYRELYTLLPISARNDV
RSGA_RALSO      ANIDQ-VLIMLGTEPGFSEDLLGRALVAAESLGITPLILLNKIDXXXXXXXXXXXXXXXXXXGYAVVELS
RSGA_HAMD5      ANIDQ-IVIVSAVIPDLSLNMIDRYLVVSESXXXXXXXXXXXXXXXNERKKINLRLNIYRNIHYTVLEVS
RSGA_BORGA      SNVDNVLIVNSANFPEMKNFFIDRVLVVAEEQNIVPVIVINKIDKGISQ-RVEEFSEIYKNLGYRVLKTS
RSGA_CHLP8      -NIDQIVLITSFDDPPFNSRLVDRYLVFAESEHLPLLIVVNKIDLDEEEEDLEVYRNLDCNISAXXXXXX
RSGA_PELCD      ANVDIAIIVCGLNR-DYNPRRIERYLTLVHESGAMPLIVLNKSDICP---ETQARRAEIESIAFGLVTSA
RSGA1_OCEIH     VNVTKVFIVISADE-DLNERKLERYLTAVWESGASPHIVFSKVDLASDMDSIIEHADSFGIPLYKWNATN
RSGA_SYNSC      XXXXXXXXXXXXEQPSFDPDQASRFLLTAERTGLEVILLLTKTDLLSAAALERLVTRLQG-WGYDPLTGI
RSGA_SYNS3      ANASTVVVALAVDQPAFDPDQASRFLLTAERTSLAVQLVLTKTDLLEPEGYPPLLVSTFSGLGLSELKQR
RSGA2_VIBVU     TNVDTLFIVCSLND-DFNLSRIERYLSIAKEAHIEPVVVLTKADLSPQAEQITQVQQLSATLWVEAVNAL
RSGA_BORRA      SNIDNILIVSSATLPEFKNSFIDRTLIVAEEQGITPIILVNKVDEGINL-RVDSFIKIYEYLGYRVIKTS
RSGA_BORDL      SNIDNILIVSSATLPEFKNSFIDRTLIVAEEQGITPIILVNKVDEGINL-RVDSFIKIYEYLGYRVIKTS
RSGA_VARPS      INLDHVLILIAA-EPEFSEHQXXXXXXXXXXXXXTPIIALNKSDLAEPFERAPYRRMHHGVLPLSLKASG
RSGA_METMA      ANID-TIFIVTATGKDLNLRRLERYLAIVYSSGARPVILLNKIDLEDNPIRLEKIQSIAGNVPVIPLSAL
RSGA2_VIBVY     TNVDTLFIVCSLND-DFNLSRIERYLSIAKEAHIEPVVVLTKADLSPQAEQITQVQQLSATLWVEAVNAL
RSGA_XYLFM      ANLDTAFIVCGL-DGDFNPRRIERYCVLIASGGVEPVVVLTKVDLCVDVGAAEHFSQALAVVAVD-ARKA
RSGA_LEPIC      SNIDLLLVIMGL-DNDYSPRRIERYLFLAKVSGAQVTIVLNKKDLCMDENKFMEIKMIAGETPIEMISAL
RSGA_THEEB      ANVDQIXXXXXXXXXXXXVHPITRFLLTAEGLNVEIQVVFTKADLVSPXXXXXXXXXXXXXGYRCHVLSL
RSGA_LEPIN      SNIDLLLVIMGL-DNDYSPRRIERYLFLAKVSGAQVTIVLNKKDLCMDENKFMEIKTIAGETPIEMISAL
RSGA_STRAW      ANVDYAVVAVSLAV-ELDLGRVERFLALAWESGAQPVVVLTKADLVPDATTLSYLVQDVESVSSNLGEGL
RSGA_PROMT      ANVTLVSICISADEPLFDMEQTSRFLLTAECANIEPXXXXXXXXXXXXN-DLILYINKFKSWGYDCIPNS
RSGA_STRCO      ANVDHAVVAVSLAV-ELDLARIERFLALAWESGAQPLVVLTKADLVPDPVTLAYLVQDVETVSAEQGEGL
RSGA_PROM1      ANVTLVSICISADEPLFDMEQTSRFLLTAECANIEPXXXXXXXXXXXXN-DLILYINKFKSWGYDCIPNS
RSGA_XYLFA      -NLDTAFIVCGL-DGDFNPRRIERYCVLIGSGGVEPVVVLTKVDLCADVGAAEHSSQALAVVAVD-AREA
RSGA_OPITP      GDADDTVFLVTGLDRDFNLRRIERYLAVARASEAQPVVVLNKSDLHPDRGEAEVRRITRTAPVVTLSAAR
RSGA_XYLFT      -NLDTAFIVCGL-DGDFNPRRIERYCVLIASGGVEPVVVLTKVDLCXXXXXXXXXLREHSSQALAVVAKA
RSGA_XYLF2      -NLDTAFIVCGL-DGDFNPRRIERYCVLIASGGVEPVVVLTKVDLCXXXXXXXXXLREHSSQALAVVAKA
RSGA_SYNPX      XXXXXXXXXXXXDQPAFDPDQASRFLLTAERTGLPVQLLLTKGDLMEEHQRFALVERLMG-WGYDLVVSS
RSGA_RHOBA      SNIDAMLIIASAEQPGIKPALIDRMILTAHQCQIEPIVIINKVDLI-DLVDLQPLIGVYSSLGYRVLPTS
RSGA1_LISIN     ANFDYALIVMSLNH-DFNLNRLERYLTVAWDSGATPIIILTKADLVDDLTPFTMELET---VAYGVPTYY
RSGA2_LISMF     ANFDYALIVMSLNH-DFNLNRLERYLTVAWDSGATPIIILTKADLVED---LTAFAQQLETVAYGVPAYY
RSGA2_ANASP     ANVDTVFLVCGL-DGDFNPRRIERYLILAWESGANPVIVLNKADLCNSLDECISEVEAVA-IGVPILTNN
RSGA_MYCGE      ANVDQIVLIQSLVQPKINWIQLLKLLVYFNAKLIDEIILITKTDLMEKQKLIDLKQFNY---QLFFVSKN
RSGA1_BACTN     SYVDKAFIVQSLDD-NFNVRRAERFIAQVMEEKIKPVLVLNKADLGCDRQKIDEAIKHIARQFPVFITSI
RSGA_XANCP      ANIDTVFIVCGL-DADFNPRRIERYLLLVGGGGAEPVVVLTKADQTEXXXXXXXXXXXXQNIALRAVNAK
RSGA_XANCB      ANIDTVFIVCGL-DADFNPRRIERYLLLVGGGGAEPVVVLTKADQTEXXXXXXXXXXXXQNIALRAVNAK
RSGA_XANC8      ANIDTVFIVCGL-DADFNPRRIERYLLLVGGGGAEPVVVLTKADQTEXXXXXXXXXXXXQNIALRAVNAK
RSGA_XANAC      ANIDTVFIVCGL-DADFNPRRIERYLLLVGGGGAQPVVVLTKADQTEXXXXXXXXXXXXQNIPLRAVNAK
RSGA_NEIG2      ------------------------------------VIVLNKADLPETALWLEKLK-FYETLGYPVIETR
RSGA_NEIG1      ------------------------------------VIVLNKADLPETALWLEKLK-FYETLGYPVIETR
RSGA_XANC5      ANIDTVFIVCGL-DADFNPRRIERYLLLVGGGGAQPVVVLTKADQTEXXXXXXXXXXXXQNIPLRAVNAK
RSGA_RHILO      ANVDTLFIVTSCNA-DFNIARLERYLALANEAGTTPVILLTKADTAEDA---EAYRKQAAALQRELVTLN
RSGA_XANOR      ANIDTVFIVCGL-DADFNPRRIERYLLLVGGGGAQPVVVLTKADQTEHXXXXXXXXXXXXNIPLRAVNAK
RSGA_XANOM      ANIDTVFIVCGL-DADFNPRRIERYLLLVGGGGAQPVVVLTKADQTEHXXXXXXXXXXXXNIPLRAVNAK
RSGA_NEIMF      ----------------------------------------NKADLPETREKLKFYET----LGYPVIETR
RSGA_XANOP      ANIDTVFIVCGL-DADFNPRRIERYLLLVGGGGAQPVVVLTKADQTEHXXXXXXXXXXXXNIPLRALNAK
RSGA_NEIMA      ------------------------------------VIVLNKADLPETREKLKFYET----LGYPVIETR
RSGA_NEIM0      ------------------------------------VIVLNKADLPETREKLKFYET----LGYPVIETR
RSGA_PROMM      XXXXXXXXXXXXKQPCFDADQASRFLLSAEQTGVDVHLILTKRDLISDQLEQQLVRRGWGYRPMAVSVQT
RSGA_NEIMB      ----------------------------------------NKADLPETREKLKFYET----LGYPVIETR
RSGA_PROM3      XXXXXXXXXXXXKQPCFDADQASRFLLSAEQTGVDVHLILTKRDLISDQLEQQLVRRGWGYRPMAVSVQT
RSGA_MYCPN      XXXXXXXXXQSLIEPKINWQQLFKLLIHFHAQNVARLVLVITKNDLEFEPAEKARLSELTSFGYQFFTAP
YRH1_AZOVI      ----------------------------------------------------------------------
RBSA_VIBF1      ----------------------------------------------------------------------
RBSA_HAEIN      ----------------------------------------------------------------------
RBSA_HAEI8      ----------------------------------------------------------------------
MNME_ACHLI      ----------------------------------------------------------------DILTKS
ENGB_PELTS      ----------------------------------------------------------------EFITSA
RBSA_PHOPR      ----------------------------------------------------------------------
MSBA_HAEIN      ------------------------------------------------KGELEFKNVSFAYQGKDELALN
MSBA_COXBU      IAIPIAIVLFFATQPSFHASIVSAMIMMLRQKGIAAAESIFKLDVEKDRGERHLVRARYQGVSFAYDNSK
ENGB_RICRS      ----------------------------------------------------------------------
ENGB_RICPU      ----------------------------------------------------------------------
ENGB_MYCGA      ----------------------------------------------------------------------
HMUV_SHEDO      ----------------------------------------------------------------------
ENGB_RICAE      ----------------------------------------------------------------------
ENGB_RICFE      ----------------------------------------------------------------------
ENGB_RICCN      ----------------------------------------------------------------------
ENGB_MYCPE      ----------------------------------------------------------------------
MSBA_THICR      -----------------------------------------KIELSNVNGQIDFNNVSFSYLGTEKTALN
MNME_NEIMF      ---------------------------------------IDFLEAADARGKLDGLRRAVDDV----LANA
MNME_NEIMB      ---------------------------------------IDFLEAADARGKLDGLRRAVDDV----LANA
MNME_NEIMA      ---------------------------------------IDFLEAADARGKLDGLRRAVDDV----LANA
MNME_NEIM0      ---------------------------------------IDFLEAADARGKLDGLRRAVDDV----LANA
MNME_NEIG2      ---------------------------------------IDFLEAADARGKLDGLRRAVDDV----LANA
MNME_NEIG1      ---------------------------------------IDFLEAADARGKLDGLRRAVDDV----LANA
MSBA_SODGM      ---------------------------------------ILDMETEKDEGTVEVER-VKGDIAFDHVTGK
ENGB_RICAH      ----------------------------------------------------------------------
ENGB_UREPA      ----------------------------------------------------------------------
ENGB_UREP2      ----------------------------------------------------------------------
ENGB_MARMM      ----------------------------------------------------------------------
SPR3_YEAST      ------------------------------------------LPLLDNKKAQEINTNSHGDIGIKNLPRQ
ENGB_MYCAP      ----------------------------------------------------------------------
ENGB_DESRM      -------------------------------------------------------------VAAEFVTSA
CBIO1_STAES     ---------------------------------------------------------------YEFEAIK
CBIO1_STAEQ     ---------------------------------------------------------------YEFEAIK
ASND1_YEAST     ----------------FNGELYNKEI----SQGDNDSLYIASMNLKEGMGVIDVIKSLEGEYAYTIYDVN
PDR12_YEAST     ------------------------------------------VDLEKVIAEKDVFTWNHLDIPYDGATRK
MALK_MANSM      --------------------------------------------------------KSYGDVHI----SK
HMUV_BURCH      ----------------------------------------------------------------------
HMUV_BURCA      ----------------------------------------------------------------------
THIQ_VIBF1      ----------------------------------------------------------FSDVKYRYYTDL
PEO1_HUMAN      ---DQQPRPLEALNGGFNLSRILRTALPAWHKSI-----VSFRQLREELGELSNVEQAAGLRWSRFPDLN
MSBA_YERPS      -----------------------------------------KLEVERAKGDIEFRHVTFYYPGKDTPALN
MSBA_YERPN      -----------------------------------------KLEVERAKGDIEFRHVTFYYPGKDTPALN
MSBA_YERPE      -----------------------------------------KLEVERAKGDIEFRHVTFYYPGKDTPALN
MSBA_YERPA      -----------------------------------------KLEVERAKGDIEFRHVTFYYPGKDTPALN
MSBA_ERWCT      -----------------------------------------KREIERAKGELEFRQVNFAYPARENLALK
ENGB_RICPR      ----------------------------------------------------------------------
ENGB_EDWI9      -------------------------------------------------------RQTYNYHVTHFVTSA
ENGB_ACIC5      ----------------------------------------------------------------------
BFR1_SCHPO      ----------------------------------------------------------------------
YCLP_BACSU      ------------------------------------------------------------------VVLE
Y1087_HAEIN     ----------------------------------------------------------------------
ERA_FUSNN       ----------------------------------------------------------------------
ENGB_UREU1      ----------------------------------------------------------------------
ENGB_FINM2      ----------------------------------------------------------------------
ENGB_DESHY      ----------------------------------------------------------------EFVTSA
ENGB_DESHD      ----------------------------------------------------------------EFVTSA
ENGB_CLOB8      ----------------------------------------------------------------DFITSK
CDC10_YEAST     -------------------------------------------------------------VGFDTITNQ


                         +         .         .         .         .         *         .:210
query           EELLSLLTGKVTVFMGQTGVGKSTLLNKLVPDLNLETGEISDSLGRGRHTTRAVSFYNLNGGKIADTPGF
RSGA_STRR6      EELLSLLTGKVTVFMGQTGVGKSTLLNKIAPDLNLETGEISDSLGRGRHTTRAVSFYNLNGGKIADTPGF
RSGA_STRPN      EELLSLLTGKVTVFMGQTGVGKSTLLNKIAPDLNLETGEISDSLGRGRHTTRAVSFYNLNGGKIADTPGF
RSGA_STRP3      EELLPLLADKITVFMGQTGVGKSTLLNRIAPELALETGEISDSLGRGRHTTRAVSFYNTHGGKIADTPGF
RSGA_STRP1      EELLPLLADKITVFMGQTGVGKSTLLNRIAPELALEIGEISDSLGRGRHTTRAVSFYNTHGGKIADTPGF
RSGA_STRP8      EELLPLLADKITVFMGQTGVGKSTLLNRIAPELALETGEISDSLGRGRHTTRAVSFYNTHGGKIADTPGF
RSGA_STRP6      EELLPLLADKITVFMGQTGVGKSTLLNRIAPELALETGEISDSLGRGRHTTRAVSFYNTHGGKIADTPGF
RSGA_STRA3      EELLPLLADKVTVFMGQTGVGKSTLLNKIAPELKLETGEISDSLGRGRHTTRAVSFYNVHKGKIADTPGF
RSGA_STRA5      EELLPLLANKVTVFMGQTGVGKSTLLNKIAPELKLETGEISGSLGRGRHTTRAVSFYNVHKGKIADTPGF
RSGA_STRMU      EDLTPLLKDKITVFMGQTGVGKTTLLNTLAPDLALETNEISDSLGRGRHTTRAVTLYNIYGGKIADTPGF
RSGA_LACLA      EHLVSNLAGKVTVFMGQTGAGKTTLLNKIAPEMQLATGETSEKLGRGRHTTRHVEFFELAGGLIADTPGF
RSGA_ENTFA      DELERFFPERLTVFMGQSGAGKSTLLNQISPELQLATAEISQSLGRGKHTTRHVELIPLYDGLVADTPGF
RSGA_GEOKA      DELALRLRGRVSVVAGQSGVGKSSLLNALRPDLRLKTGDISTHLGRGKHTTRHVELLEVAGGLVADTPGF
RSGA_BACC1      DILKPFLEGCVSVVAGQSGVGKSSMLNVLRPELELKTNDISSHLGRGKHTTRHVELIAIGSGLVADTPGF
RSGA_BACAN      DILKPFLEGCVSVVAGQSGVGKSSMLNVLRPELELKTNDISSHLGRGKHTTRHVELIAIGSGLVADTPGF
RSGA_BACCN      EILKPFLEECVSVVAGQSGVGKSSMLNVLRPDLELKTNDISSHLGRGKHTTRHVELISIGSGLVADTPGF
RSGA2_OCEIH     NELEPYFDEKVSVFAGQSGVGKSSLINVLDPSLLLETAEISKSLGRGKHTTRHVELMKIGNGLVADTPGF
RSGA_BACA2      KEN-SGLTGKTTVFAGQSGVGKSSLLNAISPELELKTNEISTHLGRGKHTTRHVELIHTSGGLVADTPGF
RSGA_GEOTN      DELMSHLCGRVSVVAGQSGVGKSSLLNALRPDLQLKTGDISTHLGRGKHTTRHVELLAIAGGLVADTPGF
RSGA_BACCR      DILKPYLENCVSVVAGQSGVGKSSMLNVLRPELELKTNDISSHLGRGKHTTRHVELIAIGSGLVADTPGF
RSGA_BACSU      KDQDSLFQDKTTVFAGQSGVGKSSLLNAISPELGLRTNEISEHLGRGKHTTRHVELIHTSGGLVADTPGF
RSGA_LACF3      PELRKILTGKVVTMMGQTGAGKSTLLNHLAPDLNLATGEISQALKRGRHTTRKVSLMQVGDALIADTPGF
RSGA_GEOSW      EQLLSYLEGHISVFAGQSGVGKSSLLNALRPDLQLKTNDISTHLGRGKHTTRHVELLEIGGGLVADTPGF
RSGA_LACRJ      ENLMEGLKGNIVTMMGQTGAGKSTLLNHLAPQLKLATGEISQALQRGRHTTRKVSLLDVNGALIADTPGF
RSGA_LACRD      ENLMEGLKGNIVTMMGQTGAGKSTLLNHLAPQLKLATGEISQALQRGRHTTRKVSLLDVNGALIADTPGF
RSGA_LACSS      QAIEDTFPDKTTVFTGQTGAGKSTLLNHIDPKLNLATAEISQSLNRGKHTTRHIELIPLNDGLVGDTPGF
RSGA_BACP2      EKLTPHFHNKITVFAGQSGVGKSSLLNAMSPELALKTDDISSHLGRGKHTTRHVELIRTANGLIADTPGF
RSGA2_LISIN     EAIKDYISGKTAVIAGQSGVGXXXXXXXXXXXXXXXXAEISNSLGRGKHTTRHVELMPIGDGFVADTPGF
RSGA2_LISMO     EAIKDYISGKTAVIAGQSGVGXXXXXXXXXXXXXXXXAEISNSLGRGKHTTRHVELMPIGDGFVADTPGF
RSGA1_LISMF     EAIKDYISGKTAVIAGQSGVGXXXXXXXXXXXXXXXXAEISNALGRGKHTTRHVELMPIGDGFVADTPGF
RSGA_BACSK      QELLPLLANQVSVIAGQSGVGKSSLLNALAPEAKIETNEISXXXXXXXXXXXXXXXXPIGEGLVADTPGF
RSGA_LEUCK      QALQSLLDGRVSVFMGQTGAGKSTLLNQLSPKLGLETGIVSKALSRGKHTTRQVTLIKVNDALIADTPGF
RSGA_LEUMM      EALKMMLKDHVSVFMGQTGAGKSTLLNHLSPQLGLETGEVSKALSRGKHTTRQVTLIEVDEALIADTPGF
RSGA_STACT      DNIETIFDSGLAVLSGQSGVGKSTLLNAYRPDLAIETNQISKSLNRGKHTTRHVELFERKGGFVADTPGF
RSGA_BACHD      IEQLGLFDDHVSVIAGQSGVGKSSLLNAINPALDIETNQISSHLGRGKHTTRHVELIPFGSGLVADTPGF
RSGA_STAS1      EDIEQVFSSGLAVLSGQSGVGKSTLLNKYFPNIEIETQHISKALNRGRHTTRHVELFERAKGFIADTPGF
RSGA_STAHJ      QEVVATWPKGLIVLSGQSGVGKSTFINAFKPELNLETNHISKSLNRGKHTTRHVELFERESGFIADTPGF
RSGA_PEDPA      QELKESFKNQLTIFMGQTGAGKSTLLNRIDSKLNIATGEVSQALNRGKHTTRKVSLIPIEDGLVADTPGF
RSGA1_LACPL     TAFXXXXXGHVAVVMGQTGAGKSTLLNHLQPGLALATGEISQALNRGKHTTRKVSLIPIADGLVADTPGF
RSGA_STAAR      KKIVEAWSAGLIVLSGQSGVGKSTFLNHYRPELNLETNDISKSLNRGKHTTRHVELFERQNGYIADTPGF
RSGA_STAES      SNYTATVSDGLIVLSGQSGVGKSTFLNSYQPQLKLETNDISKSLNRGKHTTRHVELYDRKGGYIADTPGF
RSGA_STAAW      KKIVEAWPAGLIVLSGQSGVGKSTFLNHYRPELNLETNDISKSLNRGKHTTRHVELFERQNGYIADTPGF
RSGA_STAAS      KKIVEAWPAGLIVLSGQSGVGKSTFLNHYRPELNLETNDISKSLNRGKHTTRHVELFERQNGYIADTPGF
RSGA_STAAN      KKIVEAWPAGLIVLSGQSGVGKSTFLNHYRPELNLETNDISKSLNRGKHTTRHVELFERQNGYIADTPGF
RSGA_STAAM      KKIVEAWPAGLIVLSGQSGVGKSTFLNHYRPELNLETNDISKSLNRGKHTTRHVELFERQNGYIADTPGF
RSGA_STAEQ      SNYTATVSDGLIVLSGQSGVGKSTFLNSYQPQLKLETNDISKSLNRGKHTTRHVELYDRKGGYIADTPGF
RSGA_STAAC      KKIVEAWPAGLIVLSGQSGVGKSTFLNHYRPELNLETNDISKSLNRGKHTTRHVELFERQNGYIADTPGF
RSGA_THETN      EELKSYLKDKISFFAGPSGVGKSSLINLIQSNIRLKTGELSEKLGRGRHTTRSVEFLPLDGGYVLDTPGF
RSGA_ALKMQ      EQLEKVLRGKTTVFAGPSGVGKSTLLNRILPHVTLQTGELSSKIARGKHTTRHVELISLETGWVVDTPGF
RSGA_CLOBB      EGLKEKINGNITVLCGPSGAGKSTLINKLTNKEHMLTGIVSEKIGRGKHTTRHSELIEVSNGYIVDTPGF
RSGA_CLONN      DELKSKLKGNINVFCGPSGVGKSTILNKLVGKEVMETGIISERLKRGKHTTRHSELVEVNNGFVVDTPGF
RSGA_LACGA      EELERQLPDQIWTLAGQSGAGKSTLLNKLENEANQETGAISTALNRGKHTTRQVKLFKYSSGFIADTPGF
RSGA_CLOB6      EEIKKLIKDNVTVFCGPSGVGKSTMLNKIIGKETMITGNISEKLKRGKHTTRHSELIYVDEGLLVDTPGF
RSGA_CLOAB      SELKESLKDNITVVCGPSGVGKSTLMNSIAGSNVMKTGDISEKLKRGKNTTRHSELIEVAGGFIVDTPGF
RSGA_CLOBM      EEIKKLIKDNVTVFCGPSGVGKSTMLNKIIGKETMITGNISEKLKRGKHTTRHSELIYVDEGLLVDTPGF
RSGA_CLOBJ      EEIKKLIKDNVTVFCGPSGVGKSTMLNKIIGKETMITGNISEKLKRGKHTTRHSELIYVDEGLLVDTPGF
RSGA_CLOTE      EKIREKLKGNLNVLCGPSGAGKSTIINKLVGKDVMETGQISEKLKRGKHTTRHSELIEVEDGFLVDTPGF
RSGA_CLOBH      EEIKKLIKDNVTVFCGPSGVGKSTMLNKIIGKETMITGNISEKLKRGKHTTRHSELIYVDEGLLVDTPGF
RSGA_CLOB1      EEIKKLIKDNVTVFCGPSGVGKSTMLNKIIGKETMITGNISEKLKRGKHTTRHSELIYVDEGLLVDTPGF
RSGA_CLOP1      EALKERLEHNITVLCGPSGAGKSTLLNSFIDREHMETGSVSEKIGRGKHTTRHSELIDVDNGYLVDTPGF
RSGA_CLOBL      KEIKKLIKDNVTVFCGPSGVGKSTMLNKIIGKETMITGNISEKLKRGKHTTRHSELIYVDEGLLVDTPGF
RSGA_CLOBK      KEIKKLIKDNVTVFCGPSGVGKSTMLNKIIGKETMITGNISEKLKRGKHTTRHSELIYVDEGLLVDTPGF
RSGA_LACJO      EKLENELPDQIWTLAGQSGAGKSTLLNQLESEAKQVTGAISTALNRGKHTTRQVTLFKYGSGFIADTPGF
RSGA_CLOPE      EALKERLEHNITVLCGPSGAGKSTLLNSFIDREHMETGSVSEKIGRGKHTTRHSELIDVDNGYLVDTPGF
RSGA_CLOPS      EALKERLEHNITVLCGPSGAGKSTLLNAFIDREHMETGSVSEKIGRGKHTTRHSELIDVDNGYLVDTPGF
RSGA_LACAC      EKIGDMIKNQIWTLAGQSGAGKSTLLNHLKKDANQTTGAISTSLNRGKHTTRKVELFKLGHGFLADTPGF
RSGA_LACH4      HDVQMIKEGQIWTLAGQSGAGKSTLLNHLKKDANQVTGAISASLNRGKHTTRKVELFKLGEGFLADTPGF
RSGA_CLOBA      EGLKEKINGNITVLCGPSGAGKSTLINKLTDKEHMLTGIVSEKIGRGKHTTRHSELIEVSNGYIVDTPGF
RSGA_EUBR3      DEIKHVLEGRTTTVAGPSGVGKSSIINCLQDDVQMETGHISEKIERGKHTTRHSEIIPIKDGTIMDTPGF
RSGA_CARHZ      -ELTDYLNQKISVLAGPSGVGKSTLINRLVPGAKLATGEVSPKIKRGRHTTRHVELIKLPGGFIADTPGF
RSGA_MYCAP      KNIAKLFTNKTNVLMGQSGVGKTTLVNKITGS-NFAVQAISKFANRGKHTTRIVQIVNVDNGELIDTPGF
RSGA_MYCPU      KKLNDIFEKKISVLVGQSGVGKTTILNKVSLN-NFFTQNISKALGRGKHSTRVVKMIDFNNGQIIDTPGF
RSGA_CLOB8      ERLEEKIRGNITVFCGPSGAGKSTLINKLSNKEHMETGNVSVKLGRGKHTTRHSELIEVADGYIVDTPGF
RSGA_MYCHJ      VELKAELEKKLNFVIGQTGVGKTSFINNFL-DKKFAIQEISQTLNRGKHTTRVVQIIEKENFRIIDSPGF
RSGA_MOOTA      DELKALLAGRLSTFAGPSGVGKSSLLNAIQPGLNLRTGEVSSKGGRGRHTTRQAELIRLDGGWVADTPGF
RSGA_MYCH2      VELKAELEKKLNFVIGQTGVGKTSFINNFL-DKKFAIQEISQTLNRGKHTTRVVQIIEKENFRIIDSPGF
RSGA_CLOK5      ------LKDNITVLCGPSGVGKSTILNAIYGKELMETGQISHKLNRGKHTTRHSEIIELEDGFMVDTPGF
RSGA_CLOK1      ------LKDNITVLCGPSGVGKSTILNAIYGKELMETGQISHKLNRGKHTTRHSEIIELEDGFMVDTPGF
RSGA_CLOCE      KRLKEELKGHITVFAGQSGVGKSTILNHIMESWVMETGSVSNKIERGKHTTRHAELLELKGGYVADTPGF
RSGA_MYCPE      EKILNMIKNNVVCFAGQSGVGKSTLINFLIPDLELRTQEISQALNRGKHTTTSSLMIPFNEGFVIDTPGF
RSGA_MYCH7      IPVXXXXXXXXNFVIGQTGVGKTSFINNFL-DKKFAIQEISQTLNRGKHTTRVVQIIEKENFRIIDSPGF
RSGA_THEP1      EELKEYLKGKISTMAGLSGVGKSSLLNAINPGLKLRVSEVSEKLQRGRHTTTTAQLLKFDGGYVVDTPGF
RSGA_THEMA      EELKEYLKGKISTMAGLSGVGKSSLLNAINPGLKLRVSEVSEKLQRGRHTTTTAQLLKFDGGYVVDTPGF
RSGA_THENN      EELKKYLKGKISTMAGLSGVGKSSLLNAINPGLKLRVSEVSQKLQRGRHTTTSAQLLRFDGGYVVDTPGF
RSGA_UREP2      ENDILLLKEKIKCLAGNSGVGKSTLINKLDPSIQQRTQEISHFLNRGKHTTTSTKLISFANGFLVDTPGF
RSGA_FLAJ1      EKLKEMMVGKVSMFSGHSGVGKSTLVNAMEPSLHLKTSVISEQSKQGQHTTTFAEMYDLSDARIIDTPGI
RSGA2_BACTN     EAIKKDLEGKITLFSGHSGVGKSTLINAILPGTKVKTGEISTYHNKGMHTTTFSEMFSVDGGYIIDTPGI
RSGA_UREPA      ENDILLLKEKIKCLAGNSGVGKSTLINKLDPSIQQRTQEISHFLNRGKHTTTSTKLISFANGFLVDTPGF
RSGA_FLAPJ      EELKNIMKNKVTMFSGHSGVGKSTLVNAMEPTLHLKTKTISEQSKQGQHTTTFAEMYDLSGAQIIDTPGI
RSGA_HAEIN      EKLTALLAQGTAIFVGQSGVGKSSLINHILPSVNAQVGDVSETSGLGQHTTTSSRLYHLQGGNLIDSPGI
RSGA_HAEIE      EKLTALLAQGTAIFVGQSGVGKSSLINHILPSVNAQVGDVSETSGLGQHTTTSSRLYHLQGGNLIDSPGI
RSGA_HAEI8      EKLTALLAQGTAIFVGQSGVGKSSLINHILPSVNAQVGDVSETSGLGQHTTTSSRLYHLQGGNLIDSPGI
RSGA_HAEIG      EKLTALLAQGTAIFVGQSGVGKSSLINHILPSVNAQVGDVSETSGLGQHTTTSSRLYHLQGGNLIDSPGI
RSGA_FUSNN      EEVENFLKDKITVIGGPSGVGKSSFINFLQSERILKTGEISERLQRGKHTTRDSNMIKMKGGYIIDTPGF
RSGA_BACFR      EEL----KGRVTLFSGHSGVGKSTLINALVPGLEVKTAEISAYHNKGMHTTTFSEMFPVPGGYIIDTPGI
RSGA_BACFN      DAIREELKGRVTLFSGHSGVGKSTLINALVPGLEVKTAEISAYHNKGMHTTTFSEMFPVPGGYIIDTPGI
RSGA_UREU1      EHDISLLKKFIKCLAGNSGVGKSTLINKLDPSIKQRTQEISQFLNRGKHTTTSTKLISFANGFLVDTPGF
RSGA_BACV8      DEVKKDLEGKVTLLSGNSGVGKSTLINAILPEQTLKTGEISDYHNKGMHTTTFSEMFPVDGGGIIDTPGI
RSGA_PARD8      EGLDALLKDKITLLSGHSGVGKSTIINKLVPGVNLRTGDISEYHNKGMHTTTFSEMIPLGGGYLIDTPGI
RSGA_PHYMT      HHLMDIFSNKITVLAGQTGVGKSTFLNSLKPSLQLKTQEISKKLGLGKHTTKNAQLYEFNGGYIADTPGF
RSGA_YERPY      EAFENALTGRISIFAGQSGVGKSSLLNALLPDNEILVNTVSGNSGLGQHTTTAARLYHFHGGDVIDSPGV
RSGA_YERPS      EAFENALTGRISIFAGQSGVGKSSLLNALLPDNEILVNTVSGNSGLGQHTTTAARLYHFHGGDVIDSPGV
RSGA_YERPP      EAFENALTGRISIFAGQSGVGKSSLLNALLPDNEILVNTVSGNSGLGQHTTTAARLYHFHGGDVIDSPGV
RSGA_YERPN      EAFENALTGRISIFAGQSGVGKSSLLNALLPDNEILVNTVSGNSGLGQHTTTAARLYHFHGGDVIDSPGV
RSGA_YERPG      EAFENALTGRISIFAGQSGVGKSSLLNALLPDNEILVNTVSGNSGLGQHTTTAARLYHFHGGDVIDSPGV
RSGA_YERPE      EAFENALTGRISIFAGQSGVGKSSLLNALLPDNEILVNTVSGNSGLGQHTTTAARLYHFHGGDVIDSPGV
RSGA_YERPB      EAFENALTGRISIFAGQSGVGKSSLLNALLPDNEILVNTVSGNSGLGQHTTTAARLYHFHGGDVIDSPGV
RSGA_YERPA      EAFENALTGRISIFAGQSGVGKSSLLNALLPDNEILVNTVSGNSGLGQHTTTAARLYHFHGGDVIDSPGV
RSGA_YERP3      EAFENALTGRISIFAGQSGVGKSSLLNALLPDNEILVNTVSGNSGLGQHTTTAARLYHFHGGDVIDSPGV
RSGA_AYWBP      QKLKHIFANQITVLAGQTGVGKSTLLKVLIPDAQLKTQEISESLGRGKHTTKNAQLYDFNGGFIVDTPGF
RSGA_ONYPE      QKLKHIFANQITVLAGQTGVGKSTLLKALIPDAKLKTQEISESLGRGKHTTKNAQLYEFNGGFIVDTPGF
RSGA_AZOPC      EDLLKLLRGKITLFYGHSGVGKSTIVNRLIPNAKQKVQSISKHHNKGMHTTTFSKMLELSSGYIIDTPGI
RSGA_ACTPJ      EKLDRYLSRGTSIFVGQSGVGKSSLINQLLPEVNALTGAVSDISGLGQHTTTSSRLYHLQGGNLIDSPGI
RSGA_ACTP7      EKLDRYLSRGTSIFVGQSGVGKSSLINQLLPEVNALTGAVSDISGLGQHTTTSSRLYHLQGGNLIDSPGI
RSGA_ACTP2      EKLDRYLSRGTSIFVGQSGVGKSSLINQLLPEVNALTGAVSDISGLGQHTTTSSRLYHLQGGNLIDSPGI
RSGA_YERE8      EAFEQALAGRISIFAGQSGVGKSSLLNALLPDNEILVNTVSDNSGLGQHTTTAARLYHFHGGDVIDSPGV
RSGA_SHIFL      TQLAEALTGRISIFAGQSGVGKSSLLNALLGQKEILTNDVSDNSGLGQHTTTAARLYHFHGGDVIDSPGV
RSGA_PHOLL      EELTKMLAGRITIFAGQSGVGKSSLLNTLLPEDEEEVNQVSDVSGLGQHTTTASRLYHFHGGDVIDSPGV
RSGA_GRAFK      XXXXXXMIGNTSMISGHSGTGKSTLINAIEPALDLKTSEISRQHSQGQHTTTFAEMFDLSNARIIDTPGI
RSGA_ECOLI      TQLEEALTGRISIFAGQSGVGKSSLLNALLGQKEILTNDISDNSGLGQHTTTAARLYHFHGGDVIDSPGV
RSGA_ECOLC      TQLEEALTGRISIFAGQSGVGKSSLLNALLGQKEILTNDISDNSGLGQHTTTAARLYHFHGGDVIDSPGV
RSGA_ECODH      TQLEEALTGRISIFAGQSGVGKSSLLNALLGQKEILTNDISDNSGLGQHTTTAARLYHFHGGDVIDSPGV
RSGA_ECOBW      TQLEEALTGRISIFAGQSGVGKSSLLNALLGQKEILTNDISDNSGLGQHTTTAARLYHFHGGDVIDSPGV
RSGA_SHIB3      TQLEEALTGRISIFAGQSGVGKSSLLNALLGQKEILTNDVSDNSGLGQHTTTAARLYHFHGGDVIDSPGV
RSGA_ECOSM      TQLEEALTGRISIFAGQSGVGKSSLLNALLGQKEILTNDVSDNSGLGQHTTTAARLYHFHGGDVIDSPGV
RSGA_ECOSE      TQLEEALTGRISIFAGQSGVGKSSLLNALLGQKEILTNDVSDNSGLGQHTTTAARLYHFHGGDVIDSPGV
RSGA_ECOLU      TQLEEALTGRISIFAGQSGVGKSSLLNALLGQKEILTNDVSDNSGLGQHTTTAARLYHFHGGDVIDSPGV
RSGA_ECOL6      TQLEEALTGRISIFAGQSGVGKSSLLNALLGQKEILTNDVSDNSGLGQHTTTAARLYHFHGGDVIDSPGV
RSGA_ECOHS      TQLEEALTGRISIFAGQSGVGKSSLLNALLGQKEILTNDVSDNSGLGQHTTTAARLYHFHGGDVIDSPGV
RSGA_ECO81      TQLEEALTGRISIFAGQSGVGKSSLLNALLGQKEILTNDVSDNSGLGQHTTTAARLYHFHGGDVIDSPGV
RSGA_ECO7I      TQLEEALTGRISIFAGQSGVGKSSLLNALLGQKEILTNDVSDNSGLGQHTTTAARLYHFHGGDVIDSPGV
RSGA_ECO5E      TQLEEALTGRISIFAGQSGVGKSSLLNALLGQKEILTNDVSDNSGLGQHTTTAARLYHFHGGDVIDSPGV
RSGA_ECO57      TQLEEALTGRISIFAGQSGVGKSSLLNALLGQKEILTNDVSDNSGLGQHTTTAARLYHFHGGDVIDSPGV
RSGA_ECO55      TQLEEALTGRISIFAGQSGVGKSSLLNALLGQKEILTNDVSDNSGLGQHTTTAARLYHFHGGDVIDSPGV
RSGA_ECO45      TQLEEALTGRISIFAGQSGVGKSSLLNALLGQKEILTNDVSDNSGLGQHTTTAARLYHFHGGDVIDSPGV
RSGA_ECO27      TQLEEALTGRISIFAGQSGVGKSSLLNALLGQKEILTNDVSDNSGLGQHTTTAARLYHFHGGDVIDSPGV
RSGA_ECO24      TQLEEALTGRISIFAGQSGVGKSSLLNALLGQKEILTNDVSDNSGLGQHTTTAARLYHFHGGDVIDSPGV
RSGA_KLEP3      TQLEAALTDRISIFAGQSGVGKSSLLNALLGEDQILTNDVSDVSGLGQHTTTAARLYHFHGGDVIDSPGV
RSGA_ECO8A      TQLEEALTGRISIFAGQSGVGKSSLLNALLGQKEILTNDVSDNSGLGQHTTTAARLYHFHGGDVIDSPGV
RSGA_AQUAE      DELVDYLEGFICILAGPSGVGKSSILSRLTGE-ELRTQEVSEKTERGRHTTTGVRLIPFGKGSVGDTPGF
RSGA_ACTSZ      EKLTALLSQGTSIFVGQSGVGKSSLVNQIMPEVNAQTAEISENSGLGQHTTTSSRLYHLQGGDLIDSPGI
RSGA_SALEP      TQLEEALTGRISIFAGQSGVGKSSLLNALLGLQNILTNDVSNVSGLGQHTTTAARLYHFHGGDVIDSPGV
RSGA_SALDC      TQLEEALTGRISIFAGQSGVGKSSLLNALLGLQNILTNDVSNVSGLGQHTTTAARLYHFHGGDVIDSPGV
RSGA_ESCF3      TQLEEALTGRISIFAGQSGVGKSSLLNALLGQKEILTNDVSDNSGLGQHTTTAARLYHFHGGDVIDSPGV
RSGA_SHEON      ETIKALLKDKVSVFAGQSGVGKSSLVNALLPEAELLVGDVSDNSGLGQHTTTTAKLLHLSGGDLIDSPGV
RSGA_HAEDU      DKLDRYLANGTSIFVGQSGVGKSSLINQLLPEVHAITGAISDISGLGQHTTTASRLYHLQGGNLIDSPGI
RSGA_ANAVT      DQIAKYLSNKITVVAGPSGVGKSSLINALIPDINLRVGEVSGKLARGRHTTRHVELFELNGGLLADTPGF
RSGA_SALTY      TQLEEALTGRISIFAGQSGVGKSSLLNALLGLQNILTNDVSNVSGLGQHTTTAARLYHFHGGDVIDSPGV
RSGA_SALTI      TQLEEALTGRISIFAGQSGVGKSSLLNALLGLQNILTNDVSNVSGLGQHTTTAARLYHFHGGDVIDSPGV
RSGA_SALPB      TQLEEALTGRISIFAGQSGVGKSSLLNALLGLQNILTNDVSNVSGLGQHTTTAARLYHFHGGDVIDSPGV
RSGA_SALNS      TQLEEALTGRISIFAGQSGVGKSSLLNALLGLQNILTNDVSNVSGLGQHTTTAARLYHFHGGDVIDSPGV
RSGA_SALHS      TQLEEALTGRISIFAGQSGVGKSSLLNALLGLQNILTNDVSNVSGLGQHTTTAARLYHFHGGDVIDSPGV
RSGA_SALA4      TQLEEALTGRISIFAGQSGVGKSSLLNALLGLQNILTNDVSNVSGLGQHTTTAARLYHFHGGDVIDSPGV
RSGA_HAES2      EKLTALLSEGTSIFVGQSGVGKSSLINYILPEVNAQTGKLSQVSGLGQHTTTSSRLYHLSGGNLIDSPGI
RSGA_PASMU      EKLTALFDEGTSIFVGQSGVGKSSLINHILPEVNAQVGDISENSGLGQHTTTSSRLYHLQGGQLIDSPGI
RSGA_HAES1      DKLTALLSEGTSIFVGQSGVGKSSLINYILPEVNAQTGKLSQVSGLGQHTTTSSRLYHLSGGNLIDSPGI
RSGA1_ANASP     DQIAKYLSNKITVVAGPSGVGKSSLINALIPNINLRVGEVSGKLARGRHTTRHVELFELNGGLLADTPGF
RSGA_SALSV      TQLEEALTGRISIFAGQSGVGKSSLLNALLGLQNILTNDVSNVSGLGQHTTTAARLYHFHGGDVIDSPGV
RSGA_MANSM      EKLTALLADGTSIFVGQSGVGKSSLINYILPEVNAQTGEISETSGLGQHTTTSSRLYHLQGGNLIDSPGI
RSGA_CYTH3      DELMPLLQNKIXXXXXXXXXXKSTLINKIFPQLDIKTDIISDHSQKGKHTTTFAEMYDLNESKVIDTPGI
RSGA_PSEE4      QRLQQMLDGHISVFVGQSGVGKSSLVNSLLPDAGTRVGDLSEWSGQGTHTTTTARLYHFNGGDLIDSPGI
RSGA_KLEP7      TQLEAALTDRISIFAGQSGVGKSSLLNALLSEDQILTNDVSDVSGLGQHTTTAARLYHFHGGDVIDSPGV
RSGA1_VIBPA     SDLEVQLRDRINIFVGQSGVGKSSLVNALMPELEVEEGAISENSGLGQHTTTAARLYHITGGDLIDSPGV
RSGA_BURXL      AALIERLHGHSTLLLGQSGMGKSTLVNLLIPDAEVATREISTALNSGRHTTTFTRLYPLTGGSLIDSPGF
RSGA_VIBCH      TDLEVKLRDRTNVFVGQSGVGKSSLVNALLPELDVEEGAISETSGLGQHTTTAARLYHISGGDLIDSPGV
RSGA_PROMH      EALTQALIGRISIFAGQSGVGKSSLLNTLLPPMSILVNQVSDNSGLGQHTTTASRLYHFPGGDVIDSPGV
RSGA_HAHCH      DDLKQHLAHKTSIFVGQSGVGKSSLIKMLLPEEDVKVGDLSENVRKGTHTTTTAKLFHLSGGDLIDSPGI
RSGA_SACD2      DELRNTLQDNTSVFVGQSGVGKSSIIKKLLPDQEIAIGALSDAIDKGRHTTTHSELFHFPGGDCIDSPGI
RSGA_AZOVD      QELQAALDGHVSVFVGQSGVGKSSLVNSLLPGVDTRVGALSEQTGKGMHTTTTARLFHFGGGELIDSPGI
RSGA_PSEPK      QRLQQQLDGHISVFVGQSGVGKSSLVNSLLPDAGTRVGDLSEWSGQGTHTTTTARLYHFNGGDLIDSPGI
RSGA_PSEP1      QRLQQQLDGHISVFVGQSGVGKSSLVNSLLPDAGTRVGDLSEWSGQGTHTTTTARLYHFNGGDLIDSPGI
RSGA_PROMA      QKLSARLKSKLGVLCGPSGVGKSSLINYLLPKISIPIGKLSKKLKRGRHTTRHVELFSISDSFIADTPGF
RSGA_MICAN      EALLAQLNHKITLLAGPSGVGKSSLINCLIPEINQRVGDVSGKLQKGRHTTRHVQLFALNRGLLADSPGF
RSGA_BURPS      AQLAPRLAGHSTILLGQSGMGKSTLVNLLVPDAEAATREISAALNSGRHTTTFTRLYPLDGGALIDSPGF
RSGA_BURP6      AQLAPRLAGHSTILLGQSGMGKSTLVNLLVPDAEAATREISAALNSGRHTTTFTRLYPLDGGALIDSPGF
RSGA_BURP1      TQLAPRLAGHSTILLGQSGMGKSTLVNLLVPDAEAATREISAALNSGRHTTTFTRLYPLDGGALIDSPGF
RSGA_BURP0      AQLAPRLAGHSTILLGQSGMGKSTLVNLLVPDAEAATREISAALNSGRHTTTFTRLYPLDGGALIDSPGF
RSGA_PSEPW      QRLQQMLDGHISVFVGQSGVGKSSLVNSLLPAADTRVGDLSEWSGQGTHTTTTARLYHFNGGDLIDSPGI
RSGA_PSEF5      EQLQALLDGRISVFVGQSGVGKSSLVNSLLPEVETRVGPLSEFSGQGTHTTTTARLFHFGGGELIDSPGI
RSGA_PSEPG      QRLQQQLDGHISVFVGQSGVGKSSLVNSLLPDAGTRVGDLSEWSGQGTHTTTTARLYHFNGGDLIDSPGI
RSGA_SERP5      EAFEQALADRISIFAGQSGVGKSSLLNALLPDKQILVNQVSDVSGLGQHTTTAARLYHFHGGDVIDSPGV
RSGA_BORPE      ERLAPRLAGRTSLLLGQSGMGKSTLLNTLVPHAQAATREYSAALDMGRHTTTSTRLYHLPGGDLIDSPGF
RSGA_BORPA      ERLAPRLAGRTSLLLGQSGMGKSTLLNTLVPHAQAATREYSAALDMGRHTTTSTRLYHLPGGDLIDSPGF
RSGA_BORBR      ERLAPRLAGRTSLLLGQSGMGKSTLLNTLVPHAQAATREYSAALDMGRHTTTSTRLYHLPGGDLIDSPGF
RSGA_PHYAS      QQLKNIFEQKITVLAGQTGVGKSTLLKALIPDANLKTQEISESLGRGKHTTKNAQLYLFNNGFIADTPGF
RSGA_BURP8      ATLEAHLNGHSTLLLGQSGMGKSTLVNLLIPDAEVATREISTALNSGRHTTTFTRLYPLPGGALIDSPGF
RSGA_BURMS      TQLAPRLAGHSTILLGQSGMGKSTLVNLLVPNAEAATREISAALNSGRHTTTFTRLYPLDGGALIDSPGF
RSGA_BURMA      TQLAPRLAGHSTILLGQSGMGKSTLVNLLVPNAEAATREISAALNSGRHTTTFTRLYPLDGGALIDSPGF
RSGA_BURM9      TQLAPRLAGHSTILLGQSGMGKSTLVNLLVPNAEAATREISAALNSGRHTTTFTRLYPLDGGALIDSPGF
RSGA_BURM7      TQLAPRLAGHSTILLGQSGMGKSTLVNLLVPNAEAATREISAALNSGRHTTTFTRLYPLDGGALIDSPGF
RSGA_RALPJ      XXXXXXXXXRASILIGQSGMGKSSLLNLLIPGVDAQTREISEKLDSGKHTTTFTRLYHLQGGMLIDSPGF
RSGA_PORGI      ---VSAITGEXXXXAGHSGVGKSSLINALIPHADLRTGAISQAHHTGMHTTQMIDFPDLSGSALIDTPGI
RSGA_PORG3      ---VSAITGEXXXXAGHSGVGKSSLINALIPHADLRTGAISQAHHTGMHTTQMIDFPDLSGSALIDTPGI
RSGA_CHLTE      EELRELLRDRVSAFSGHSGVGKSTLINLLVGCEELRTAETSGKTGKGVHTTTSSAMFQLGGGYVIDTPGI
RSGA_PSEPF      EQLQKQLDGRISVFVGQSGVGKSSLVNSLLPEVETRVGPLSELSGQGTHTTTTARLFHFGGGELIDSPGI
RSGA_SODGM      DPFREALTGRTSIFTGQSGVGKSSLLNALLPPEHILVNNVSDNSGLGQHTTTTARLYHFSGGHLIDSPGV
RSGA_PECCP      PELEQALTDRISIFAGQSGVGKSSLLNALLAEERILVNEVSDNSGLGQHTTTASRLYHFHGGDVIDSPGV
RSGA_BURPP      AALIEHLQGHSTLLLGQSGMGKSTLVNLLIPDAEVATREISTALNSGRHTTTFTRLYPLEGGALIDSPGF
RSGA_PSEFS      EQLQQQLDGRISVFVGQSGVGKSSLVNSLLPEVDTRVGPLSELSGQGTHTTTTARLFHFGGGELIDSPGI
RSGA_ERWCT      PELEQALTDRISIFAGQSGVGKSSLLNALLAEKRILVNEVSDNSGLGQHTTTASRLYHFHGGDVIDSPGV
RSGA_MARAV      PEVEALVRNQTSVFVGQSGVGKSSIIQTLLPDELLRVGAVSESTGKGVHTTTTAKLFHLGGGDLIDSPGI
RSGA_DICD3      QELEAALTGRVSIFAGQSGVGKSSLLNALLDDAQILVNDVSDASGLGQHTTTAARLYHFHGGDVIDSPGV
RSGA1_VIBVY     RELEAQLQDRINIFVGQSGVGKSSLVNALIPXXXXXXXXXXXXXXXXQHTTTAARLYHISGGNLIDSPGV
RSGA1_VIBVU     RELEAQLQDRINIFVGQSGVGKSSLVNALIPXXXXXXXXXXXXXXXXQHTTTAARLYHISGGNLIDSPGV
RSGA_PSESM      QSLQSQLDGHISVFVGQSGVGKSSLVNSLLPETDTRVGPLSEVSGQGTHTTTTARLFHFRGGDLIDSPGI
RSGA_ALCBS      EGLTPLLAGKTSVFVGQSGVGKSSLINGVLPEADLQVGELSSNSGLGQHTTVTARLVHLTGGQLIDSPGI
RSGA_SYNY3      EKLQEKLRSRISLMAGPSGVGKSSLINLLVPGVEQQVKNVSGKLRKGRHTTRHVELFDLHGGLLADTPGF
RSGA_GEMAT      EGLEALVEHRSSALSGPSGVGKSSLMNALFPGLDLRTAAVSDAVNKGRHTTVGAMLHPLHGGFIADTPGL
RSGA_MYCGA      ERLKNLLFNKVTIFCGHSGVGKSTLLKRLDNSLDIWTQAVSAKLKRGKNTTTATKLYKFLDGYLVDSPGF
RSGA_CHRSD      TQLHACLTERTSVFVGQSGVGKSSLIDRLLPDMQLRVGALSADSRKGXXXXXXXXLYHLPGGELIDSPGI
RSGA_ERWT9      EELEEALIGRVSIFAGQSGVGKSSXXXXXXXXXXXXTKDVSDVSGLGQHTTTAARLYHFHGGDVIDSPGV
RSGA_DICNV      EELTHWLSGRQTVICGQSGVGKSSFIHYLMPDIDVWTQAVSAARGFGQHTTRNARRYPLDAHTIIDTPGV
RSGA_PSEU2      QSLQSQLDGHISVFVGQSGVGKSSLVNSLLPETDTRVGPLSEVSGQGTHTTTTARLFHFRGGDLIDSPGI
RSGA_PSEAE      DELRGALDGHVSVFVGQSGVGKSSLVNALLPGVDTRVGDLSXXXXXXXXXXXXARLFHFGGGDLIDSPGI
RSGA_PSEAB      DELRGALDGHVSVFVGQSGVGKSSLVNALLPGVDTRVGDLSXXXXXXXXXXXXARLFHFGGGDLIDSPGI
RSGA_PSEA8      DELRGALDGHVSVFVGQSGVGKSSLVNALLPGVDTRVGDLSXXXXXXXXXXXXARLFHFGGGDLIDSPGI
RSGA_PSE14      QTLQSQLDGHISVFVGQSGVGKSSLVNSLLPETDTRVGPLSEVSGQGTHTTTTARLFHFRGGDLIDSPGI
RSGA_PSEMY      EQLKKRLDGHVSVFVGQSGVGKSSLVNGLLPGVDTRVGALSELXXXXXXXXXXARLFHFGGGQLIDSPGI
RSGA_NITEU      QPLIPLLSGQTSLLAGQSGVGKSTLLNALVPRAQQATAEISDALDSGRHTTTHVRLFHFDASSIIDSPGF
RSGA_BORAP      KEIKEVLRNSRTSFIGQSGVGKSSLINLIDSKASQSVNEISHKYSRGKHTTYAISFYS-ESGIIVDTPGI
RSGA2_LACPL     VETGQLTTGQTVAFVGSSGVGKSTLINRLLGQDILATKSIRTDDNKGRHTTTSRQLIPLTGACVIDTPGM
RSGA1_LISMO     VDNLSLKPNSTLILLGSSGVGKSSFINSLAGTDLMKTAGIREDDSKGKHTTTHREMHLLNGWIVIDTPGM
RSGA_BORBZ      KEVKEVLKNSRTSFIGQSGVGKSSLINLIDSRASQSVNEISHKYSRGKHTTVYSISFHSDSGIIVDTPGI
RSGA_BORBU      KEVKEVLKNSRTSFIGQSGVGKSSLINLIDSRASQSVNEISHKYSRGKHTTVYSISFHSDSGIIVDTPGI
RSGA_METAC      TGLDALNPGETVALVGSSGVGKSTLINAFLGETVQKTADIRKDDEKGRHTTTVRQMFLLNGAVLIDNPGI
RSGA2_VIBPA     KLMSWCNEGQTVAFIGSSGVGKSTLVNALLGQQEQSTGHIREDDSKGRHTTTSRSIHLLPGGILIDTPGM
RSGA_NITMU      KPLLPYLEDNLSVLVGQSGMGKSTIINALVPDAERATGDISPTLDAGRHTTTHARLYHLDNARIIDSPGI
RSGA_RALSO      XXXXXXXXGRSSILIGQSGMGKSSLLNLLIPGVDAQTREISEKLDSGKHTTTFTRLYHLHGGTLIDSPGF
RSGA_HAMD5      AQLQANLLDRVSIFSGQSGVGKSSLLNTLLPEQQILVEALSEKSALGQHTTTTSRLYHFQGGDLIDSPGI
RSGA_BORGA      KEVKEILRNSRTSFIGQSGVGKSSLINLIDSRASQSVNEISEKYSRGKHTTYSISFHSEN-WIIVDTPGI
RSGA_CHLP8      XXXXXXXXXXXSAFSGHSGVGKSTLINLLVGREELRTAETSGKTGKGVHTTTSSAMFQLGGGYVIDTPGI
RSGA_PELCD      QELASLKAGSTLVLIGSSGAGKSTLLNRLACAEHQQTSEISAAVGKGMHTTTHRELFPLPGGALVDTPGL
RSGA1_OCEIH     EELANIHEDDSVVLIGSSGAGKSTLINALLTEKVLKTGSVREDDKRGRHTTTHRELFNLTGGVIIDTPGM
RSGA_SYNSC      DALRQRLAGQLSVLCGPSGVGKSSLLNQLCPDLQLRTAAVSGRLQRGRHTTRHVELFPLGSARVADTPGF
RSGA_SYNS3      -----LAESSLSVLCGPSGVGKSSLLNALIPELDLRIGSVSGRLQRGRHTTRHVELHHLGAARVADTPGF
RSGA2_VIBVU     DPVSVAALGRTVAFIGSSGVGKSTLTNTLLGEETQQTGGIREDDSKGRHTTTARSVHMIDGALIIDTPGM
RSGA_BORRA      DEVKKIIKNSRTSFIGQSGVGKSSLINVIDLNASQAINEISYKYARGRHTTVYAVAFHSDNKILIDTPGI
RSGA_BORDL      DEVKKIIKNSRTSFIGQSGVGKSSLINVIDLNASQAINEISYKYARGRHTTVYAVAFHSDNKILIDTPGI
RSGA_VARPS      ESLMKLLAGKSTLVLGPSGAGKSTLINLLVPGATALTGEISQALNSGKHTTTSTTWYWVDEARLIDSPGF
RSGA_METMA      SEALSLNPGETVALVGSSGVGKSTLINSLLGETVQRTGGIREDDEKGRHTTTVRQMFLLNGAVLIDNPGI
RSGA2_VIBVY     DPAVSALQGRTVAFIGSSGVGKSTLTNTLLGEETQQTGGIREDDSKGRHTTTARSVHMIDGALIIDTPGM
RSGA_XYLFM      EPVVALLPGRTVALLGSSGAGKSTLTNTLLGEQRMKVGEVRQRDSRGRHTTTHRALLPLSGACLIDTPGM
RSGA_LEPIC      DQTRTILQGKTIAFLGSSGAGKSTIINSLLGGEIQKTNEVKVSDGTGKHTTTRRELFLLSGGVLMDNPGI
RSGA_THEEB      QALRPHLANKITVVCGPSGVGKSSLIRHLTPREDIRVGAVSDHWHRGRHTTRHVELFPLEGGWIADTPGF
RSGA_LEPIN      DQTRTILQGKTITFLGSSGAGKSTIINSLLGGEIQKTNEVKVSDGTGKHTTTRRELFLLSGGVLMDNPGI
RSGA_STRAW      DVLAAVLSGGTSVLLGQSGAGKSTLANALLGEDVMKVHATRDVDGKGRHTTTTRNLLALGGGVLIDTPGL
RSGA_PROMT      QGIDSLIERKLTVLAGPSGVGKTSLINHLIPTVSLPTSSVSKKLKRGTHTTRHVELFAINGSLLADTPGF
RSGA_STRCO      DVLAAVVSGGTAVLLGQSGAGKSTLANALLGEAAMDVQAIRDVDGKGRHTTTTRNLLALGGGVLIDTPGL
RSGA_PROM1      QGIDSLIERKLTVLAGPSGVGKTSLINHLIPTVSLPTSSVSKKLKRGTHTTRHVELFAINGSLLADTPGF
RSGA_XYLFA      EPVAALLPGRTVALLGSSGAGKSTLTNTLLGEQRMKVGEVRQRDSRGRHTTTHRALLPLSGACLIDTPGM
RSGA_OPITP      GDGIALVPGATVALLGSSGAGKSTLINRLLGKQRQDTGPLSHAMNKGRHTTTHRELLALPGGALVDTPGL
RSGA_XYLFT      EPVVALLPGRTVALLGSSGAGKSTLTNTLLGEQRMKVGEVRQRDSRGRHTTTHRALLPLSGACLIDTPGM
RSGA_XYLF2      EPVVALLPGRTVALLGSSGAGKSTLTNTLLGEQRMKVGEVRQRDSRGRHTTTHRALLPLSGACLIDTPGM
RSGA_SYNPX      QEVLSLKDTELAVLCGPSGVGKSSVLNCLMPHLALRVGAVSGRLQRGRHTTRHVELFPIPGSRVADTPGF
RSGA_RHOBA      AELRALLKDRQTALAGQSGVGKSSLLNAVQPGLGLAIGAVSSDNDKGKHTTTASQLIPLDGGAVFDTPGI
RSGA1_LISIN     VDNLSLKPNXXXXXXXXXXXXXXXFINSLAGADLMKTSEIREDDSKGKHTTTHREMHLLNGWIIIDTPGM
RSGA2_LISMF     VDNLSLKPNXXXXXXXXXXXXXXXFINSLAGTDLMKTAGIREDDSKGKHTTTHREMHLLNGWIVIDTPGM
RSGA2_ANASP     QGIDTLKAGQTVALLGSSGVGKSTITNQLKGASVQAVQPVRQGDDRGRHTTTNRELILLTGGLIVDTPGM
RSGA_MYCGE      EELIDIFSKKLSVFTGQSGVGKSSLINRLDPSLKQKIQALSVN-KFGKNXXXXXXLFSFRGGFICDTPGF
RSGA1_BACTN     RQPQTILRLRESIXXXXXXXXXXXLVNALCGKSVLNTSDISLSTGKGRHTSTRREMVLMDGGVLIDTPGV
RSGA_XANCP      DESVAALRGRTAVLVGSSGAGKSTLTNTLLGTQKMKTNAVRENDSRGRHTTTHRALIPLSGACLIDTPGM
RSGA_XANCB      DESVAALRGRTAVLVGSSGAGKSTLTNTLLGTQKMKTNAVRENDSRGRHTTTHRALIPLSGACLIDTPGM
RSGA_XANC8      DESVAALRGRTAVLVGSSGAGKSTLTNTLLGTQKMKTNAVRENDSRGRHTTTHRALIPLSGACLIDTPGM
RSGA_XANAC      DDSVAALRGRTAVLVGSSGAGKSTLTNTLLGTQKMKTNAVRENDSRGRHTTTHRALIPLSGACLIDTPGM
RSGA_NEIG2      DSLRPVLQGHSNILLGQSGMGKSTLTNALLGSQTARTGDISAALDSGKHTTTHARLYDLNGTQLIDSPGL
RSGA_NEIG1      DSLRPVLQGHSNILLGQSGMGKSTLANALLGSQTARTGDISAALDSGKHTTTHARLYDLNGTQLIDSPGL
RSGA_XANC5      DDSVAALRGRTAVLVGSSGAGKSTLTNTLLGTQKMKTNAVRENDSRGRHTTTHRALIPLSGACLIDTPGM
RSGA_RHILO      PRIXXXXXXQTVALIGSSGVGKSTLVNTLAGSAQQQTGAIREHDAKGRHTTTARSLHAIGGGWVIDTPGM
RSGA_XANOR      DPASVLGDGRTAVLVGSSGAGKSTLTNTLLGTEKMKTNGVRENDSRGRHTTTHRALIPLSGACLIDTPGM
RSGA_XANOM      DPASVLGDGRTAVLVGSSGAGKSTLTNTLLGTEKMKTNGVRENDSRGRHTTTHRALIPLSGACLIDTPGM
RSGA_NEIMF      DLLRPVLQGHSNILLGQSGMGKSTLTNALLGSQTARTGDISAALDSGKHTTTHARLYDLNGTQLIDSPGL
RSGA_XANOP      DPASVLGDGRTAVLVGSSGAGKSTLTNTLLGTEKMKTNGVRENDSRGRHTTTHRALIPLSGACLIDTPGM
RSGA_NEIMA      ASLRPALQGHSNILLGQSGMGKSTLTNALLGSQTARTGDISAALDSGKHTTTHARLYDLNGTQLIDSPGL
RSGA_NEIM0      ASLRPALQGHSNILLGQSGMGKSTLTNALLGSQTARTGDISAALDSGKHTTTHARLYDLNGTQLIDSPGL
RSGA_PROMM      GEGLGALKNKLSVFCGPSGVGKTXXXXXXXXXXXXRVGAVSGRLKRGRHTTRHVELFRLEGSLVADTPGF
RSGA_NEIMB      ASLRPALQGHSNILLGQSGMGKSTLTNALLGSQTARTGDISAALDSGKHTTTHARLYDLNGTQLIDSPGL
RSGA_PROM3      GEGLGALKNKLSVFCGPSGVGKTXXXXXXXXXXXXRVGAVSGRLQRGRHTTRHVELFRLEGSLVADTPGF
RSGA_MYCPN      NADLPLLQNRFSVFMGQSGVGKSSLINRLDSQIHQAIQALS-AHQFGKNTTTSTVMFPFQNGFICDTPGF
YRH1_AZOVI      ----------------------------------------------------------------------
RBSA_VIBF1      ---LNVYPGKVMALMGENGAGKSTLMKSLTGIYAMDAGEI-------RYEGKAVNF---NGPKHSQESGI
RBSA_HAEIN      ---LSVYAGRVMALMGENGAGKSTLMKVL-------TGIYSKDAGTIEYLNRSVNF---NGPKASQEAGI
RBSA_HAEI8      ---LSVYAGRVMALMGENGAGKSTLMKVL-------TGIYSKDAGTIEYLNRSVNF---NGPKASQEAGI
MNME_ACHLI      KRTQYIREGVKTVIVGRPNVGKSSLLNAL---LNEERAIVSDIAGTTRDTIDA--FVNLDGVQLIDTAG-
ENGB_PELTS      AKTADYPAGNIVALAGRSNVGKSSLLNRLVNRKSL--ARISSTPGR----TRLINFFLVNGFRLVDLPGY
RBSA_PHOPR      ---LNVYPGKVMALMGENGAGKSTLMKSLTGIYAMDAGEI-------RYQGKAVNF---DGPRHSQEAGI
MSBA_HAEIN      NISFSVPAGKTVALVGRSGSGKSTIANLVTRFYDIEQGEI------------------------------
MSBA_COXBU      KTILSEISGQMVAIVGRSGAGKSTLINLLPRFYDASTGVI------------------------------
ENGB_RICRS      -------------FVGKSNVGKSSLINTICNNKNL--AKVSNTAGR----TRQINFFNLADKLIVDLPGY
ENGB_RICPU      -------------FVGKSNVGKSSLINTICNNKNL--AKVSNTAGR----TRQINFFNLADKLIVDLPGY
ENGB_MYCGA      ---------KEVCLIGRSNVGKSTIINGLA---NAKIAQTSKTPGR----TVTMNFYEISNQRIVDLPGY
HMUV_SHEDO      ---LDIRSGEVTALLGPNGAGKSSLLKALCQSLKTESGEIS-----------------------------
ENGB_RICAE      -------------FVGKSNVGKSSLINTICSNKNL--AKVSNTPGR----TRQINFFNLADKLIVDLPGY
ENGB_RICFE      -------------FVGKSNVGKSSLINTICNNKNL--AKVSNTPGR----TRQINFFNLADKLIVDLPGY
ENGB_RICCN      -------------FVGKSNVGKSSLINTICNNKNL--AKVSNTPGR----TRQINFFNLADKLIVDLPGY
ENGB_MYCPE      ---------KEICFIGRSNVGKSSLINALA---NAKIAKTSNTPGR----TQLANFYDFDKFRLIDLPGY
MSBA_THICR      NFSLSIPARKTTALVGQSGSGKTTLANLITRFYQVNHGTIT-----------------------------
MNME_NEIMF      QQGAILREGLNVVLVGAPNVGKSSLLNALAGD---EVAIVTDIAGTTRDAVRERILIDGVPVHIVDTAGL
MNME_NEIMB      QQGAILREGLNVVLVGAPNVGKSSLLNALAGD---EVAIVTDIAGTTRDAVRERILIDGVPVHIVDTAGL
MNME_NEIMA      QQGAILREGLNVVLVGAPNVGKSSLLNALAGD---EVAIVTDIAGTTRDAVRERILIDGVPVHIVDTAGL
MNME_NEIM0      QQGAILREGLNVVLVGAPNVGKSSLLNALAGD---EVAIVTDIAGTTRDAVRERILIDGVPVHIVDTAGL
MNME_NEIG2      QQGAILREGLNVVLVGAPNVGKSSLLNALAGD---EVAIVTDIAGTTRDAVRERILIDGVPVHIVDTAGL
MNME_NEIG1      QQGAILREGLNVVLVGAPNVGKSSLLNALAGD---EVAIVTDIAGTTRDAVRERILIDGVPVHIVDTAGL
MSBA_SODGM      ETSLSIPTGHTVALVGRSGSGKSTIANLLTRFYDIQQGQI------------------------------
ENGB_RICAH      -------------FVGKSNVGKSSLINTICNNKNL--AKVSNTPGR----TRQINFFNLADKLIVDLPGY
ENGB_UREPA      --------------IGRSNVGKSSLINALA---NKKIARTSNTPGR----TQLVNFFDFNNFRLVDLPGY
ENGB_UREP2      --------------IGRSNVGKSSLINALA---NKKIARTSNTPGR----TQLVNFFDFNNFRLVDLPGY
ENGB_MARMM      -------------FAGRSNVGKSSLINALTNQKGL--ARASGEPGR----TRELNFFNVEGGRIVDLPGY
SPR3_YEAST      RELLNAKNGIDFTLMGQSGLGKTTFINSL-----FSTSLIDDDIKENKPIIRYKSIVEGDGTNVIDTPGF
ENGB_MYCAP      -------------FWGRSNVGKSSLLNALV---NQKISYVSKQPGR----TQFINYFQEENRFIVDLPGY
ENGB_DESRM      VNPGGYPPGNLVAFVGRSNVGKSSLINKVVNRKGL--AKTSSTPGR----TQLINFFNINNDQMVDLPGY
CBIO1_STAES     NVSLTLEQGKYYAIIGQTGSGKSTLIQHLNALLKPTTGSVN-----------------------------
CBIO1_STAEQ     NVSLTLEQGKYYAIIGQTGSGKSTLIQHLNALLKPTTGSVN-----------------------------
ASND1_YEAST     SSKL---------YFGRDPIGRRSLSYSVTPDNELYVASVTGSAGSFQDCIGGVIYEYDTRTKLLNSNQR
PDR12_YEAST     --LLSVKPGKMTALMGESGAGKTTLLNVLAQRINM-----------------------------------
MALK_MANSM      DINLEINEGEFVVFVGPSGCGKSTLLRMIAGLEDITTGEL------------------------------
HMUV_BURCH      ---LSIEPGRVTALLGRNGAGKSTLLKTFAGEL---TGSVAP------HGVRVTGDVTLNGEPLADAPRL
HMUV_BURCA      ---LSIEPGRVTALLGRNGAGKSTLLKTFAGEL---TGSVAP------HGVRVTGDVTLNGEPLADAPRL
THIQ_VIBF1      FEFLNVEQGSVVAILGPSGAGKSTLLSLLAGFIEPESGDIT-----------------------------
PEO1_HUMAN      RILKGHRKGELTVFTGPTGSGKTTFISEYALDL-------------------------------------
MSBA_YERPS      DINIHLEAGKTVALVGRSGSGKSTIANLLTRFYDVSEGSI------------------------------
MSBA_YERPN      DINIHLEAGKTVALVGRSGSGKSTIANLLTRFYDVSEGSI------------------------------
MSBA_YERPE      DINIHLEAGKTVALVGRSGSGKSTIANLLTRFYDVSEGSI------------------------------
MSBA_YERPA      DINIHLEAGKTVALVGRSGSGKSTIANLLTRFYDVSEGSI------------------------------
MSBA_ERWCT      NINLHIPVGKTVALVGRSGSGKSTIASLITRFYDIQSGEI------------------------------
ENGB_RICPR      ------------VFVGKSNVGKSSIINTICNNKSL--AKVSNTPGR----TRQINFFNIDKLIIVDLPGY
ENGB_EDWI9      PDIRHLPTGIEVAFAGRSNAGKSSALNTLTNQKSL--ARTSKTPGR----TQLINLFEVEDGRLVDLPGY
ENGB_ACIC5      ------VTAPEFAFLGRSNVGKSSLINAL---LGSKQAKVSSTPGR----TRAINFFSLTTSPERQQPNF
BFR1_SCHPO      -----VVPGKLTALMGESGAGKTTLLNVLAQ--RVDTGVVTGDMGRGLDST-------------------
YCLP_BACSU      ETSVTIQKGKITSFIGPNGAGKSTLLSIMSRLIKKDSGEI------------------------------
Y1087_HAEIN     ---LQVKKGKITAIMGPSGIGKTTLLKLIGGQLMPEQGEI------------------------------
ERA_FUSNN       --------------VGRPNVGKSTLINKLVSE---KVAIVSDKAGTTRDNIKGILNFKDNQYIFIDTPG-
ENGB_UREU1      --------------IGRSNVGKSSLINALA---NEKIARTSNTPGR----TQLVNFFDFNSFRLVDLPGY
ENGB_FINM2      -------------FCGRSNVGKSSFINSILDRKNL--ARTSSKPGK----TRTVNFYNANNERLVDLPGY
ENGB_DESHY      VNIKGYLTGPEIALAGRSNVGKSSLINKFINRRNLA------RTGNTPGKTQMLNFYRINDWSFVDLPGY
ENGB_DESHD      VNIKGYLTGPEIALAGRSNVGKSSLINKFINRRNLA------RTGNTPGKTQMLNFYRINDWSFVDLPGY
ENGB_CLOB8      KNQYPIDNRVEVAFVGRSNVGKSSLINSLTNRKKL--AKVSQTPGK----TRLVNFFLINDDYLVDLPGY
CDC10_YEAST     IEHRLLKKGFQFNIMGQSGLGKSTLINTLFASIDSATGDDISALPVTKTTEMKISTHTLVEDRVIDTPGF


                         .         .         .         +         .         .         .:280
query           SSLDYEVSRAEDLNQAFPEIATVSRDCKFRTCTHTHEPSCAVKPAVEEGVIATFRFDNYLQFLSEIENRR
RSGA_STRR6      SSLDYEVSRAEDLNQAFPEIATVSRDCKFRTCTHTHEPSCAVKPAVEEGVIATFRFDNYLQFLSEIENRR
RSGA_STRPN      SSLDYEVSRAEDLNQAFPEIATVSRDCKFRTCTHTHEPSCAVKPAVEEGVIATFRFDNYLQFLSEIENRR
RSGA_STRP3      SSLDYDIANAEDLNEAFPELRRLSHECKFRSCTHTHEPKCAVKAALETGELWPVRYEHYLQFLSEIENRR
RSGA_STRP1      SSLDYDIANAEDLNEAFPELRRLSHECKFRSCTHTHEPKCAVKAALETGELWPVRYEHYLQFLSEIENRR
RSGA_STRP8      SSLDYDIANAEDLNEAFPELRRLSHKCKFRSCTHTHEPKCAVKAALETGELWPVRYEHYLQFLSEIENRR
RSGA_STRP6      SSLDYDIANAEDLNEAFPELRRLSHKCKFRSCTHTHEPKCAVKAALETGELWPVRYEHYLQFLSEIENRR
RSGA_STRA3      SSLDYEVDNAEDLNESFPELRRLSHFCKFRSCTHTHEPKCAVKEALTQGQLWQVRYDNYLQFLSEIENRR
RSGA_STRA5      SSLDYEVDNAEDLNESFPELRRLSHFCKFRSCTHTHEPKCAVKEALTQGQLWQVRYDNYLQFLSEIESRR
RSGA_STRMU      SSLDYEITSSEELNAAFPELLKLSAACKFRSCTHTHEPGCAVKLALAQRKIWEKRYQTYLQILSEIENRR
RSGA_LACLA      SSLDYEVTNRPDLNAAFPEILRISHDCKFRECTHTHEPSCAVKLALENHEILESRYDNYLQILDEINHTR
RSGA_ENTFA      SAIDFLEMEAVELPKQFPEFVAAASHCKFRECMHHKEPGCEVKRQVEAGTIATSRYENYLQFLMEIENRR
RSGA_GEOKA      SALEFNQIELDELPHYFPEFRTYGEGCKFRGCLHIAEPKCAVREAVEAGEIPSYRYDHYVSFVAEMKERK
RSGA_BACC1      SSLDFIDIEVEDLTYCFPELKEASQYCKFRGCTHLSEPKCAVKAAVEEGKITEYRYKNYKQFVEEIRERK
RSGA_BACAN      SSLDFIDIEVEDLTYCFPELKEASQYCKFRGCTHLSEPKCAVKAAVEEGKITEYRYKNYKQFVEEIRERK
RSGA_BACCN      SSLDFIDIEVEDLTFCFPELKEESQYCKFRGCTHLSEPKCAVKAAVEEGRIADYRYEHYKQFVEEIRERK
RSGA2_OCEIH     SVLEFREIEAEELADSFPEFNARMHLCKFRGCMHDKEPKCAVKEAVENEEIAVFRYNHYLRFLEEIQTRK
RSGA_BACA2      SSLEFTGIEEEELGSTFPEIREISASCKFRGCLHLKEPKCAVKQAVEEGEIQPYRYEHYKEFMQEIKERK
RSGA_GEOTN      SALEFDHIELDELPYYFPEFRAYGEGCKFRGCLHVAEPKCAVREAAEAGDIAPYRYDHYLSFVAEMKERK
RSGA_BACCR      SSLDFIDIEVEDLTYCFPELKEASQYCKFRGCTHLSEPKCAVKAAVEEGKITEYRYKNYKQFVEEIRERK
RSGA_BACSU      SSLEFTDIEEEELGYTFPDIREKSSSCKFRGCLHLKEPKCAVKQAVEDGELKQYRYDHYVEFMTEIKDRK
RSGA_LACF3      SSYEDFQMTVEELPHFFPEMQALAPECKFRGCLHIKEPSCAVKNALKHGKIMNSRYDNYLQFHELIANQK
RSGA_GEOSW      SAXXXXXXXXXXXXXXXXXXXXRSEECKFRGCLHIAEPKCAVREAVESGKIPSYRYENYISFVEEIKERK
RSGA_LACRJ      SSYETFDMTVNDLPQLFPEMAKISADCKFRGCLHIKEPQCAVKEAVNNGIIMKSRYNDYLQFHELIANQK
RSGA_LACRD      SSYETFDMTVNDLPQLFPEMAKISADCKFRGCLHIKEPQCAVKEAVNNGIIMKSRYNDYLQFHELIANQK
RSGA_LACSS      SSLGILNVTSETLVSRYPEFREIGQDCKFRTCQHVMEPKCAVKAAVDAGEIMQSRYTNYLQFRAELKDIR
RSGA_BACP2      SSLEFTGIEAEDLGLYFLDIRDRSGDCKFRGCLHVKEPGCAIKDAVEHDQIKEYRYQHYLEFLTEIKDRK
RSGA2_LISIN     SSIEWDDLQPETLQFCFPEMEDRRSGCKFRGCMHDNEPNCAVKTAVEANEIADFRYKHYIQILQELKNRK
RSGA2_LISMO     SSIEWDDLQPETLQFCFPEIEDRRSGCKYRGCMHENEPSCAVKTAVEANEIAEFRYKHYIQILQELKNRK
RSGA1_LISMF     SSIEWDDLQPETLQFCFPEMEDRRSGCKFRGCMHDNEPNCAVKTAVEANEIAEFRYKHYIQILQELKNRK
RSGA_BACSK      SSLEFTDMEAEDLRFCFPEFLSLMDDCKFRGCLHDKEPKCAIKDAVETGEVDSFRYKHYLQFLHEIQDQK
RSGA_LEUCK      SSYEVFDFSAEALDDYFPEFVAVRDGCRFRGCLHLNEPACAVKEAVSLGAIPESRYNSYKAFYELIKSQK
RSGA_LEUMM      SSYEVFDFPVEELDDYFPEFVEKRQDCRFRGCLHLNEPGCAIKEAVAVGTITQSRYNSYKAFYELIKAQK
RSGA_STACT      SALDFDHIHKDEVKDYFLEIQEYGQGCKFRNCNHIKEPQCNVKAQVEAGNIAQFRYDHYVQLFEEIANRK
RSGA_BACHD      SSLDFIDMEPEELSHYFPEMRDRLPSCKFRGCTHTQEPKCAVKEALAQGEIREFRYEHYVTFLEEVKTQH
RSGA_STAS1      SALDYDHIQKDEIKNYFMEIHEYGATCKFRDCNHINEPKCNVKAELENGNIAQFRYDHYLQLFKEISNRK
RSGA_STAHJ      SALDFGHIDKDELKHYFIEMNRFGEECKFRNCNHIKEPKCHVKQQLENGYLAQFRYDHYIQLYNEISNRK
RSGA_PEDPA      STYAVFEMADTQLKEYFIDFKKLSQNCRFRECLHLNEPGCAVKAAVEDGSVLSSRYANYEQFIELIRNQK
RSGA1_LACPL     SSYEVFDIAANELTHYFPEFVRLSVDCKYRGCVHINEPQCAVKQALAAGELLASRYDNYLQF--------
RSGA_STAAR      SALDFDHIDKDEIKDYFLELNRYGETCKFRNCNHIKEPNCNVKHQLEIGNIAQFRYDHYLQLFNEISNRK
RSGA_STAES      SALDFNHIEKEQLKDFFIDIHEAGEQCKFRNCNHIKEPQCHVKALVEKGEIPQFRYDHYQQLYNEISNRK
RSGA_STAAW      SALDFDHIDKDEIKDYFLELNRYGETCKFRNCNHIKEPNCNVKHQLEIGNIAQFRYDHYLQLFNEISNRK
RSGA_STAAS      SALDFDHIDKDEIKDYFLELNRYGETCKFRNCNHIKEPNCNVKHQLEIGNIAQFRYDHYLQLFNEISNRK
RSGA_STAAN      SALDFDHIDKDEIKDYFLELNRYGETCKFRNCNHIKEPNCNVKHQLEIGNIAQFRYDHYLQLFNEISNRK
RSGA_STAAM      SALDFDHIDKDEIKDYFLELNRYGETCKFRNCNHIKEPNCNVKHQLEIGNIAQFRYDHYLQLFNEISNRK
RSGA_STAEQ      SALDFNHIEKEQLKDFFIDIHEAGEQCKFRNCNHIKEPQCHVKTLVEKGEIPQFRYDHYQQLYNEISNRK
RSGA_STAAC      SALDFDHIDKDEIKDYFLELNRYGETCKFRNCNHIKEPNCNVKHQLEIGNIAQFRYDHYLQLFNEISNRK
RSGA_THETN      TALEIDIPK-EELRNYFREFIEFQENCRFNSCLHVNEPDCAVTEAVDEGIIDRQRYISY-----------
RSGA_ALKMQ      SSLNIDFLKEEELADYFIDFEPFAKDCRFLSCVHLNEPICGVKTALKAGQLVQSRYNSYLQMIGEIKKNR
RSGA_CLOBB      STLEIELMNKEDLKYCFPEFEEHNESCKYRGCLHNKEPKCTVKQAVEEGKINKYRYEFYIKTLEEI----
RSGA_CLONN      STLDLKFDSKEELKDYFREFYEYKDQCKFNGCLHHKEPKCGVKDAVNNEEINKDRYEFYVKTLEEI----
RSGA_LACGA      SAIDLFKIKVDELENYFYDLKDASVKCKFRRCQHIKEPGCEVKKLIEEGKIAKSRYDSYLKIRQEIENRM
RSGA_CLOB6      SSLDINFMEKEDLLYCIPEFRDFIGECKFTGCLHHREPNCAVKKAVEEGHIHKNRYDFYIKTLEEIMNRR
RSGA_CLOAB      SSLDLNFIDRYELKDLFPEFYEYNGSCKYSTCVHDKEPGCEVKKAVEEGNINIERYNFYVDTLNKLSVRR
RSGA_CLOBM      SSLDINFMEKEDLLHCIPEFRDFIGECKFTGCLHHREPNCAVKKAVEEGHIHKNRYDFYIKTLEEFMNRR
RSGA_CLOBJ      SSLDINFMEKEDLLHCIPEFRDFIGECKFTGCLHHREPNCAVKKAVEEGHIHKNRYDFYIKTLEEFMNRR
RSGA_CLOTE      SSLSIEDIEKEEIQFLFPEFIKYINGCKFTGCLHYKEPSCVVKNALEQGKIHKKRYEFYIQIIEE-----
RSGA_CLOBH      SSLDINFMEKEDLLHCIPEFRDFIGECKFTGCLHHREPNCAVKKAVEEGHIHKDRYNFYIKTLEEFMNRR
RSGA_CLOB1      SSLDINFMEKEDLLHCIPEFRDFIGECKFTGCLHHREPNCAVKKAVEEGHIHKDRYNFYIKTLEEFMNRR
RSGA_CLOP1      TTLDVTFIDRDSLKYCFPEFNDYNNLCKFNGCNHYKEPKCAVKEAVEEGKINKLRYDFYIKTLEEIINRR
RSGA_CLOBL      SSLDINFMEKEDLLHCIPEFRDFIGECKFTGCLHHREPNCAVKKAVEEGHIHKNRYDFYIKTLEEFMNRR
RSGA_CLOBK      SSLDINFMEKEDLLHCIPEFRDFIGECKFTGCLHHREPNCAVKKAVEEGHIHKNRYDFYIKTLEEFMNRR
RSGA_LACJO      SAIDLFKIKVDDLRNYFYDLKEASANCKFRGCQHIKEPGCEVKKLVEEGKIARSRYESYLKIRQEIDNRM
RSGA_CLOPE      TTLDVTFIDRDSLKYCFPEFNDYNNLCKFNGCNHYKEPKCAVKEAVEEGKINKLRYEFYIKTLEEIINRR
RSGA_CLOPS      TTLDVTFIDRDSLKYCFPEFNDYNNLCKFNGCNHYKEPKCAVKEAVEEGKINKLRYEFYIKTLEEIINRR
RSGA_LACAC      SSIDLTPIKLNELCNYFIEFKRASKKCKFRGCQHIKEPGCEVKKLLEEGKILHSRYDDYLAMRTEIEGRM
RSGA_LACH4      SSIDLTPIKLNELCNYFVEFKRASSKCKFRGCQHLKEPGCEVKKLLEEGQIMQHRYDDYLAMRTEIEGRL
RSGA_CLOBA      STXXXXXXXXXXXXYCFPEFEEHNESCKYRGCLHNKEPKCAIKQDVEDGKINKYRYEFYVKTLEEI----
RSGA_EUBR3      SSMDVPGFEKEDLWTCYPEFVEYEPYCRFQGCSHINEPDCGVKEALSEGKISQVRYDNYKLLYEELKNRQ
RSGA_CARHZ      SNLTLPEMDKLELQSYFPEFNQNRKYCYFPNCLHVKEPNCRVRELLETGEIPPFRYENYLTFLEEI----
RSGA_MYCAP      SSLDINLTK-QQLAYSYKQFKELGKFCKFKTCFHQNEPECNIKQAVKDNIIPQFRYNNYLKLLQEVENEQ
RSGA_MYCPU      SSIEIQMSQ-KDLSKSFESFDKYSQRCKYRHCLHQNEEDCNIKQLVQSQEIPLFRYNNYLKLLDEVK---
RSGA_CLOB8      STLEIDLMDKNSLKYCFPEFTQYNDKCKYRGCLHYKEPNCALKEAVESEKINRYRYEFYVRALEEI----
RSGA_MYCHJ      SSFSYSEISKNEIRNAFKIFKKFSSDCKFRSCFHFQEKTCGIKRALKDGKIPENRYKNYLYFLGKYEKK-
RSGA_MOOTA      SRLDLPAITREEVAAYFPEMEPLRGRCRYASCLHRKEPGCAVVAAVEAGLIIKHRYEHYLTFLAEVIARE
RSGA_MYCH2      SSFSYSEISKNEIRNAFKIFKKFSSDCKFRSCFHFQEKTCGIKRALKDGKIPENRYKNYLYFLGKYEKK-
RSGA_CLOK5      SSLDIGHITKDKLQYCFPEFIEFIGICKFTGCVHHKEPDCAVKSALYDDKINKRRYDFYVKTLNEISSKK
RSGA_CLOK1      SSLDIGHITKDKLQYCFPEFIEFIGICKFTGCVHHKEPDCAVKSALYDDKINKRRYDFYVKTLNEISSKK
RSGA_CLOCE      SSFEIIDIPYNQLERYYPEFLPYINTCRFNSCSHITEPGCRVIEALERSEIDNNRYQRYIQLYKALKD--
RSGA_MYCPE      GSLDLNMTQLE-LANSFTDFRNNSVHCKFKNCLHTNEQNCFIKKMVDENKIYKQRYLDYLKMFSEIK---
RSGA_MYCH7      SSFSYSEISKNEIRNAFKIFKKFSSDCKFRSCFHFQEKTCAIKRALKDGKIPENRYKNYLYFLGKYEKK-
RSGA_THEP1      ANLEISDIEPEELKNYFKEFG--DKQCFFSDCNHVDEPDCGVKEAVENGEIAESRYENYVKMFYELLGRR
RSGA_THEMA      ANLEINDIEPEELKHYFKEFG--DKQCFFSDCNHVDEPECGVKEAVENGEIAESRYENYVKMFYELLGRR
RSGA_THENN      ANLEIGDIEPEELKYYFKEFN--EKQCFFSDCNHIDEPECGVKEAVENGEIAESRYENYVKMFHELLGR-
RSGA_UREP2      GNLEVNLTKNEMAN-AFNDFANYARFCKFSNCLHIEEPECAIKKAVDEKLIVNWRYDDYLKIIKELPN--
RSGA_FLAJ1      KGFGIVDMEPTEISGYFPEFFKLKDQCKFNNCLHKEEPHCAIKAALEKDEIAWSRYNSYLKILEGDEEHY
RSGA2_BACTN     KGFGTFDMEEEEIGHYFPEIFKVSADCKYGNCTHRHEPGCAVREAVEKHLISESRYTSYLNMLEDKE---
RSGA_UREPA      GNLEVNLTKNEMAN-AFNDFANYARFCKFSNCLHIEEPECAIKKAVDEKLIVN-RYDDYLKIIKELPN--
RSGA_FLAPJ      KGFGIVDMEKEEISGYFPEFFKLKDQCKFNNCLHKDEPKCAVKDALEKDKISYSRYNSYLKIL---EGDD
RSGA_HAEIN      REFGLWHLDAEQITKGYREFQYVLGTCKFRDCKHLSDPGCALREAVEQGKISPVRYDNYIESLSETKSQR
RSGA_HAEIE      REFGLWHLDAEQITKGYREFQYVLGTCKFRDCKHLSDPGCALREAVEQGKISPVRYDNYIESLSETKSQR
RSGA_HAEI8      REFGLWHLDAEQITKGYREFQYVLGTCKFRDCKHLSDPGCALREAVEQGKISPVRYDSYIESLSETKSQR
RSGA_HAEIG      REFGLWHLDAEQITKGYREFQYVLGTCKFRDCKHLSDPGCALREAVEQGKISPVRYDNYIESLSETKSQR
RSGA_FUSNN      SSIEVNIENREELISLFPEFLNID-SCKFLNCSHIHEPGCNVKKQVEENKISKERYDFYKKTLEILLER-
RSGA_BACFR      KGFGTFDMEEEEIGHYFPEIFKTSANCKYGNCTHRQEPGCAVRKAVEEHYISESRYTSYLSMLEDKE---
RSGA_BACFN      KGFGTFDMEEEEIGHYFPEIFKTSANCKYGNCTHRQEPGCAVRKAVEEHYISESRYTSYLSMLEDKE---
RSGA_UREU1      GNLEVNLTKNEMAN-AFSDFANYARFCKFSNCLHIDEPHCAIKKAVNDDQIVNWRYDDYLKIMKKLPN--
RSGA_BACV8      KGFGTFDMEEEEVGHYFKEIFEYSAHCKYGNCTHRHEPGCAVRDAVEKHLISESRYTSYLNMLEDKE---
RSGA_PARD8      KGFGTIEMADAEISHYFRELFKYSEECRFNNCTHRHEPGCAVIQAVNDGLISESRYKSYLSILDD-----
RSGA_PHYMT      SKLDLTIFDYEELKFFYPDFLLYSDKCYFKDCSHIKEINCGVKKALKLSLIPDWRYDNYLKFIEKIQEQK
RSGA_YERPY      REFGLWHLAPEQITQGFVEFRDYLGHCKFRDCSHTNDPGCALREAVEQGKIAEERFDNYHRILESMEQAK
RSGA_YERPS      REFGLWHLAPEQITQGFVEFRDYLGHCKFRDCSHTNDPGCALREAVEQGKIAEERFDNYHRILESMEQAK
RSGA_YERPP      REFGLWHLAPEQITQGFVEFRDYLGHCKFRDCSHTNDPGCALREAVEQGKIAEERFDNYHRILESMEQAK
RSGA_YERPN      REFGLWHLAPEQITQGFVEFRDYLGHCKFRDCSHTNDPGCALREAVEQGKIAEERFDNYHRILESMEQAK
RSGA_YERPG      REFGLWHLAPEQITQGFVEFRDYLGHCKFRDCSHTNDPGCALREAVEQGKIAEERFDNYHRILESMEQAK
RSGA_YERPE      REFGLWHLAPEQITQGFVEFRDYLGHCKFRDCSHTNDPGCALREAVEQGKIAEERFDNYHRILESMEQAK
RSGA_YERPB      REFGLWHLAPEQITQGFVEFRDYLGHCKFRDCSHTNDPGCALREAVEQGKIAEERFDNYHRILESMEQAK
RSGA_YERPA      REFGLWHLAPEQITQGFVEFRDYLGHCKFRDCSHTNDPGCALREAVEQGKIAEERFDNYHRILESMEQAK
RSGA_YERP3      REFGLWHLAPEQITQGFVEFRDYLGHCKFRDCSHTNDPGCALREAVEQGKIAEERFDNYHRILESMEQAK
RSGA_AYWBP      SKLDLTTFSPRTLKNFYPDFLEHVCDCFFESCFHLQEEKCGVKKALENGQILPSRYQNYVIFCEEIKNQ-
RSGA_ONYPE      SKLDLTTFCPRTLKNFYPDFVEHVCDCFFESCLHLQEEKCGVKKSLENGKILPSRYQNYVSFYEEIKNQ-
RSGA_AZOPC      KGFGIFDIEKEEISHYFPDIFRFSPYCKFYNCTHQKEPACAVREAIKNHYISKSRYISYINILEDVD---
RSGA_ACTPJ      REFGLWHLEPEQITLGYREFQSVLGTCKFRDCKHKSDPGCAVREAVEKGEINAIRFENYHRL---IESRD
RSGA_ACTP7      REFGLWHLEPEQITLGYREFQSVLGTCKFRDCKHKSDPGCAVREAVEKGEINAIRFENYHRL---IESRD
RSGA_ACTP2      REFGLWHLEPEQITLGYREFQSVLGTCKFRDCKHKSDPGCAVREAVEKGEINAIRFENYHRL---IESRD
RSGA_YERE8      REFGLWHLAPEQITQGFVEFRDYLGHCKFRDCSHTNDPGCALREAVEQGKIAEERFDNYHRILESMEQAK
RSGA_SHIFL      REFGLWHLEPEQITQGFVEFHDYLGLCKYRDCKHDTDPGCAIREAVEEGKIAETRFENYLESMAQVKTRK
RSGA_PHOLL      REFGLWHLTSEQVTQGFVEFRDYLGGCKFRDCKHRDDPACALRKAVEDNEINQERFENYHRILDSMD---
RSGA_GRAFK      KGFGVVDMDREEIGDYFPEFFERKQDCKFHNCLHIEEPKCAIKDSLEEGEIAWSRYKSYLQIMEGEEDRV
RSGA_ECOLI      REFGLWHLEPEQITQGFVEFHDYLGLCKYRDCKHDTDPGCAIREAVEEGKIAETRFENYLESMAQVKTRK
RSGA_ECOLC      REFGLWHLEPEQITQGFVEFHDYLGLCKYRDCKHDTDPGCAIREAVEEGKIAETRFENYLESMAQVKTRK
RSGA_ECODH      REFGLWHLEPEQITQGFVEFHDYLGLCKYRDCKHDTDPGCAIREAVEEGKIAETRFENYLESMAQVKTRK
RSGA_ECOBW      REFGLWHLEPEQITQGFVEFHDYLGLCKYRDCKHDTDPGCAIREAVEEGKIAETRFENYLESMAQVKTRK
RSGA_SHIB3      REFGLWHLEPEQITQGFVEFHDYLGLCKYRDCKHDTDPGCAIREAVEEGKIAETRFENYLESMAQVKTRK
RSGA_ECOSM      REFGLWHLEPEQITQGFVEFHDYLGLCKYRDCKHDTDPGCAIREAVEEGKIAETRFENYLESMAQVKTRK
RSGA_ECOSE      REFGLWHLEPEQITQGFVEFHDYLGLCKYRDCKHDTDPGCAIREAVEEGKIAETRFENYLESMAQVKTRK
RSGA_ECOLU      REFGLWHLEPEQITQGFVEFHDYLGLCKYRDCKHDTDPGCAIREAVEEGKIAETRFENYLESMAQVKTRK
RSGA_ECOL6      REFGLWHLEPEQITQGFVEFHDYLGLCKYRDCKHDTDPGCAIREAVEEGKIAETRFENYLESMAQVKTRK
RSGA_ECOHS      REFGLWHLEPEQITQGFVEFHDYLGLCKYRDCKHDTDPGCAIREAVEEGKIAETRFENYLESMAQVKTRK
RSGA_ECO81      REFGLWHLEPEQITQGFVEFHDYLGLCKYRDCKHDTDPGCAIREAVEEGKIAETRFENYLESMAQVKTRK
RSGA_ECO7I      REFGLWHLEPEQITQGFVEFHDYLGLCKYRDCKHDTDPGCAIREAVEEGKIAETRFENYLESMAQVKTRK
RSGA_ECO5E      REFGLWHLEPEQITQGFVEFHDYLGLCKYRDCKHDTDPGCAIREAVEEGKIAETRFENYLESMAQVKTRK
RSGA_ECO57      REFGLWHLEPEQITQGFVEFHDYLGLCKYRDCKHDTDPGCAIREAVEEGKIAETRFENYLESMAQVKTRK
RSGA_ECO55      REFGLWHLEPEQITQGFVEFHDYLGLCKYRDCKHDTDPGCAIREAVEEGKIAETRFENYLESMAQVKTRK
RSGA_ECO45      REFGLWHLEPEQITQGFVEFHDYLGLCKYRDCKHDTDPGCAIREAVEEGKIAETRFENYLESMAQVKTRK
RSGA_ECO27      REFGLWHLEPEQITQGFVEFHDYLGLCKYRDCKHDTDPGCAIREAVEEGKIAETRFENYLESMAQVKTRK
RSGA_ECO24      REFGLWHLEPEQITQGFVEFHDYLGLCKYRDCKHDTDPGCAIREAVEEGKIAETRFENYLESMAQVKTRK
RSGA_KLEP3      REFGLWHLEAEQITHGFVEFHDYLGHCKYRDCKHDNDPGCALREAVENGKIAESRFENYHRILESME---
RSGA_ECO8A      REFGLWHLEPEQITQGFVEFHDYLGLCKYRDCKHDTDPGCAIQEAVEEGKIAETRFENYLESMAQVKTRK
RSGA_AQUAE      SKVEATMVKPREVRNYFREF--LRYQCKYPDCTHTNEPGCAVKEAVKNGEISCERYKSYLKII-------
RSGA_ACTSZ      REFGLWHLDADQITKGYREFRHFLGACKFRDCKHLNDPQCALREAVEQGKIHPVRFDNYHRLIS------
RSGA_SALEP      REFGLWHLEPEQITQGFVEFHDYLGHCKYRDCKHDADPGCAIREAVENGAIAETRFENYLESMAQVKTRK
RSGA_SALDC      REFGLWHLEPEQITQGFVEFHDYLGHCKYRDCKHDADPGCAIREAVENGAIAETRFENYLESMAQVKTRK
RSGA_ESCF3      REFGLWHLEPEQITQGFVEFHDYLGLCKYRDCKHDTDPGCAIREAVDEGKIAETRFENYLESMAQVKTRK
RSGA_SHEON      REFALWHLPAQRVGWCFIEFRDFLGGCKFRDCKHGDDPGCALKAAVDAGKISEDRFNNYHRIIASLDEQR
RSGA_HAEDU      REFGLWHLTPEQITLGYCEFQTILGNCKFRDCKHNTDPGCAIKHAVEKGLINPIRFENYHRL---IESRD
RSGA_ANAVT      NQPDVDCS-PEELVHYFPELAVAS--CRFNDCLHRDEPDCAVRGDWE-------RYEHYLEFLADIARQT
RSGA_SALTY      REFGLWHLEPEQITQGFVEFHDYLGHCKYRDCKHDADPGCAIREAVENGAIAETRFENYLESMAQVKTRK
RSGA_SALTI      REFGLWHLEPEQITQGFVEFHDYLGHCKYRDCKHDADPGCAIREAVENGAIAETRFENYLESMAQVKTRK
RSGA_SALPB      REFGLWHLEPEQITQGFVEFHDYLGHCKYRDCKHDADPGCAIREAVENGAIAETRFENYLESMAQVKTRK
RSGA_SALNS      REFGLWHLEPEQITQGFVEFHDYLGHCKYRDCKHDADPGCAIREAVENGAIAETRFENYLESMAQVKTRK
RSGA_SALHS      REFGLWHLEPEQITQGFVEFHDYLGHCKYRDCKHDADPGCAIREAVENGAIAETRFENYLESMAQVKTRK
RSGA_SALA4      REFGLWHLEPEQITQGFVEFHDYLGHCKYRDCKHDADPGCAIREAVENGAIAETRFENYLESMAQVKTRK
RSGA_HAES2      REFGLWHLDREQITNGYREFQYFLGTCKFRDCKHLHDPGCAIQLAVKEGKIDPLRFENYITSLSETKSQR
RSGA_PASMU      REFGLWHLDQEQITRGYREFQYFLGTCKFRDCKHLNDPGCALREAMEQGKIHSVRFANYHRLIASLEETK
RSGA_HAES1      REFGLWHLDREQITNGYREFQYFLGTCKFRDCKHLHDPGCAIQLAVKEGKIDPLRFENYITSLSETKSQR
RSGA1_ANASP     NQPDVDCS-PEELVHYFPEARLAIASCRFNDCSHRDEPDCAVRGDWE-------RYEHYLEFLADIARQT
RSGA_SALSV      REFGLWHLEPEQITRGFVEFHDYLGHCKYRDCKHDADPGCAIREAVENGAIAETRFENYLESMAQVKTRK
RSGA_MANSM      REFGLWHLEPAQITNGYREFQYFLGTCKFRDCKHIDDPGCALREAVELGKIHPVRFDNYHRLISSREENK
RSGA_CYTH3      KELGLFEIENDVLSHYFPEMRSLMGQCRFHNCKHTNEPGCRVKEYVEAFKIAPTRYESYCSIIFEKDTHR
RSGA_PSEE4      REFGLGHVSRDDVEDGFIEFRELIGNCRFRDCKHDREPGCALLKALEDGQVSQQRMSSYRSIIASL----
RSGA_KLEP7      REFGLWHLEAEQITNGFVEFHDYLGRCKYRDCKHDTDPGCALREAVENGKIAESRFENYHRILESM----
RSGA1_VIBPA     REFGLWHLEAEEVTKAFVEFRPYLGGCKFRDCKHNDDPGCILREAVEKGEVSEVRFENYHRILSMMENKA
RSGA_BURXL      QEFGLHHLTEGRLERAFPEFRPLLPNCRFYNCHHLHEPGCAILEAVADGRIRRERHALYAQLVHE-----
RSGA_VIBCH      REFGLWHLETDDVTKAYVEFRPYLGGCKFRDCKHGDDPGCLLREAVSKGEISALRFDNYHRIVSMTENKA
RSGA_PROMH      REFGLWHLTPEQVTKGFIEFRPFLGGCKFRDCKHNDDPGCLITEAVDKGEIAPTRFENYLESMSQVKVRK
RSGA_HAHCH      REFGLWHIDEHTLEDGFVEFRPHLGHCRFRNCRHIQEPGCALQSAQESGEILTSRMESFLRIRESLQEQ-
RSGA_SACD2      REFGLWHLSPKEVTYGFIEIRDIAGLCKFRDCSHTHEPSCAVLNAVEDGSLHPERYENFQRIVQSLDD--
RSGA_AZOVD      REFSLGHVRRADVEAGFIEFRDLLGHCRFRDCRHDREPGCALLKALDEGRIQPQRMASYRHILASL----
RSGA_PSEPK      REFGLGHVSRDDVEDGFIEFRDLFGTCRFRDCKHDREPGCALLKALEEGRIKPQRMNSYRSIIASL----
RSGA_PSEP1      REFGLGHVSRDDVEDGFIEFRDLFGTCRFRDCKHDREPGCALLKALEEGRIKPQRMNSYRSIIASL----
RSGA_PROMA      NKPEF-YTEPSQVPQLFPELRSLIKKCKFRNCMHLNEPDCAISRDWE-------RYSNYKNFLQEMLN--
RSGA_MICAN      NQPDIN-CLPEELTFYFPEVRAALGNCQFNDCTHRREPNCVVRGDWE-------RYQHYLEFLEE-----
RSGA_BURPS      QEFGLYHLTEGRLERAFPEFRPLLAHCRFYNCHHLHEPGCAILEALADGRIAPTRHALYAQLVHE-----
RSGA_BURP6      QEFGLYHLTEGRLERAFPEFRPLLAHCRFYNCHHLHEPGCAILEALADGRIAPTRHALYAQLVHE-----
RSGA_BURP1      QEFGLYHLTEGRLERAFPEFRPLLAHCRFYNCHHLHEPGCAILEALADGRIAPTRHALYAQLVHE-----
RSGA_BURP0      QEFGLYHLTEGRLERAFPEFRPLLAHCRFYNCHHLHEPGCAILEALADGRIAPTRHALYAQLVHE-----
RSGA_PSEPW      REFGLGHVSRDDVEDGFIEFRDLFGTCRFRDCKHDREPGCALLEALEDGRIKQQRMNSYRSIIASL----
RSGA_PSEF5      REFGLHVSRA-DVEAGFIEFNDLLGTCRFRDCKHDREPGCALLKALEDGRIQQQRMNSYRSILASL----
RSGA_PSEPG      REFGLGHVSRDDVEDGFIEFRDLFGTCRFRDCKHDREPGCALLKALDEGRIKPQRMNSYRSIIASL----
RSGA_SERP5      REFGLWHLEPEQVTQAYVEFRDYLGGCKFRDCRHDTDPGCAIRGAMEKGDIAKERFENYHRILESM----
RSGA_BORPE      QAFGLQHLNGEQILRGFPEFAPHIEHCRFYNCTHRHEPGCGVLAALQAGQIDAGRYALYLRILDE-----
RSGA_BORPA      QAFGLQHLNGEQILRGFPEFAPHIEHCRFYNCTHRHEPGCGVLAALQAGQIDAGRYALYLRILDE-----
RSGA_BORBR      QAFGLQHLNGEQILRGFPEFAPHIEHCRFYNCTHRHEPGCGVLAALQAGQIDAGRYALYLRILDE-----
RSGA_PHYAS      SKLDLGGFSYQNLKNFYPDFLKYVDNCYFGTCLHLQETQCGVKEALTQGKIIPSRYSNYCYFMXXXXXXX
RSGA_BURP8      QEFGLHHLTEGKLERAFPEFRPLLAECRFYNCHHLHEPGCAILEAVADGRIAKERHALYAQLVHE-----
RSGA_BURMS      QEFGLYHLTEGRLERAFPEFRPLLAHCRFYNCHHLHEPGCAILEALADGRIAPTRHALYAQLVHE-----
RSGA_BURMA      QEFGLYHLTEGRLERAFPEFRPLLAHCRFYNCHHLHEPGCAILEALADGRIAPTRHALYAQLVHE-----
RSGA_BURM9      QEFGLYHLTEGRLERAFPEFRPLLAHCRFYNCHHLHEPGCAILEALADGRIAPTRHALYAQLVHE-----
RSGA_BURM7      QEFGLYHLTEGRLERAFPEFRPLLAHCRFYNCHHLHEPGCAILEALADGRIAPTRHALYAQLVHE-----
RSGA_RALPJ      QEFGLHHLSEGMLERAFPEFRPRLTECRFYNCRHLQEPGCGILGAMAEGKIDPRRHQLYAQLLHESEQQK
RSGA_PORGI      KGFGTLEMGEYEVSHYFPEIFAASKGCRFGNCTHTHEPGCAVLEALRRGEIAESRYISYLSILED-----
RSGA_PORG3      KGFGTLEMGEYEVSHYFPEIFAASKGCRFGNCTHTHEPGCAVLEALRRGEIAESRYISYLSILED-----
RSGA_CHLTE      REFNLAGITRENLRFYYTEFLRYMPECTFSSCSHTVEPGCAVIAAVESGSIARERYESYLALLDSL----
RSGA_PSEPF      REFGLHVSRA-DVEAGFIEFNDLLGTCRFRDCKHDREPGCALLKALEDGRVQQQRMNSYRSIIASL----
RSGA_SODGM      RELGLWHLAPERIARGFIEFREYLGTCKFRDCRHDTDPGCAIRGAVESGTIAHERFDNY-----------
RSGA_PECCP      REFGLWHLEPEQVTRGFIELRQYIGSCKFRDCKHENDPGCAINAALDRGEIAVERYDNYLESMAQVKTRK
RSGA_BURPP      QEFGLHHLTEGRLERAFPEFRPLLPNCRFYNCHHLQEPGCAILEAVADGRIRRERHALYAQLVHE-----
RSGA_PSEFS      REFGLGHVSRSDVEAGFIEFNDLIGTCRFRDCKHDREPGCALLKALEDGRVQQQRMNSYRSIIASL----
RSGA_ERWCT      REFGLWHLEPEQVTSGFIELREYIGSCKFRDCKHENDPGCAINAARERGDIARERFDNYLESMTQVKMRK
RSGA_MARAV      REFGLWHMTPQEVEYGFREIRPLIGLCKFRNCRHMGDPGCALDAAAEAGDISPERLKSFHRILQDMTDQQ
RSGA_DICD3      REFGLWHLEPEQVTRGFIEFRDYLGSC--XDCKHDTDPGCAIRAALERGEIAPERFDNYLESMAQVKTRK
RSGA1_VIBVY     REFGLWHLEPEEITKAYLEFRPYLGGCKFRDCKHADDPGCIIREAVENGEISEVRYDNYHRIISMAENKA
RSGA1_VIBVU     REFGLWHLEPEEITKAYLEFRPYLGGCKFRDCKHADDPGCIIREAVENGEISEVRYDNYHRIISMAENKA
RSGA_PSESM      REFGLHVSRA-DVEAGFIEFNDLIGTCRFRDCKHDREPGCALLKGLEDGRVQQQRMNSYRSIIASL----
RSGA_ALCBS      REFGLWHIGEDDLLHGYRELSELAGYCKFRNCSHRNEPGCALILAAQNGDIDEERLANFYQISDTLEDGR
RSGA_SYNY3      NQPDLAVEPAQ-LIHLFPEAQLTGQECFFKDCLHRGEPDCAVGQDWE-------RYEHYLTFLEEVENSR
RSGA_GEMAT      REVGLWGIEAGQVASCFPEFRPLLSACRFADCIHTVEPGCAVREAVEAGDVSPGRYESYVKLRDELMGR-
RSGA_MYCGA      SIYDLNLTK-QQLSCGLIEFAQYQTKCKFNDCLHENSADCYLKKKI------------------------
RSGA_CHRSD      REFGLGHLEEHQVAQGFIEFQPYLGHCRFRDCRHRQEPGCALRDAVERGDILASRFDSYRHIVDGLTTR-
RSGA_ERWT9      REFGLWHLEPEQITRGFVEFRDYLGGCKFRDCKHDTDPGCAIREAVDKGEIDASRFVNYLESMSEVQ---
RSGA_DICNV      RGFSLTHLQHSEVVSGFPEIHQYTHECRFNDCSHQHEPDCGVQRALERGDISLERFNSMMQICAERE---
RSGA_PSEU2      REFGLHVSRA-DVEAGFIEFNDLIGTCRFRDCKHDREPGCALLKGLEDGRVQQQRMNSYRSIIASL----
RSGA_PSEAE      REFGLGHVSRDDVEAGFIEFRDLLGHCRFRDCKHDREPGCALLQALEDGRIMPQRMASYRHILASM----
RSGA_PSEAB      REFGLGHVSRDDVEAGFIEFRDLLGHCRFRDCKHDREPGCALLQALEDGRIMPQRMASYRHILASM----
RSGA_PSEA8      REFGLGHVSRDDVEAGFIEFRDLLGHCRFRDCKHDREPGCALLQALEDGRIMPQRMASYRHILASM----
RSGA_PSE14      REFGLHVSRA-DVEAGFIEFNDLIGTCRFRDCKHDREPGCALLKGLEDGRVQQQRMNSYRSIIASL----
RSGA_PSEMY      REFGLGHVSRDDVEAGFIEFHDLLGRCRFRDCKHDREPGCALLQALEDGRIQAQRMASYRHILASL----
RSGA_NITEU      QEFGLQQLDEASLARGFIEFRPFLGQCKFRDCRHIAEPGCKLLLAAQEGMLNSRRIACYHKLVKGLKKSH
RSGA_BORAP      KEFGIETLPFENLRYYFKEFENFASLCKYKSCLHVSEPCCSVISSLGNG-ISKLRYESYLKILSELKN--
RSGA2_LACPL     RELQIFMG---DLNQTFAEIAALATQCKFNDCTHTSEPGCAVRAAVEVGTVTSERLQSYQKLQREM----
RSGA1_LISMO     REFGVGFNQA-GLETTFSDVEELAEGCRFHDCSHTQEPNCAVQAALEDGTLTMQHYENWLKLQREM----
RSGA_BORBZ      KEFGIETLPFENLKYYFKEFENFASFCKYKSCLHVSEPYCSVTSSLDNG-ISKLRYESYLKILSELKN--
RSGA_BORBU      KEFGIETLPFENLKYYFKEFENFASFCKYKSCLHVSEPYCSVTSSLDNG-ISKLRYESYLKILSELKN--
RSGA_METAC      REIQLGDS-AEGLEKAFSEIVDAARNCKFKDCTHRNEPGCAVLQAVRDGIIPEERLESYHRLTDELSFQS
RSGA2_VIBPA     REIQL-VDCEAGVSEAFADVEALADHCRFGDCKHQTEPGCAVQAAIENGSLEVRRFNNYQKLLRE-----
RSGA_NITMU      QQFGLQHLSIEAIAWGFREFRPYIGKCKFNNCRHSGEPGCALANAMRESEVSVRRIDLYHKLIASLNTNR
RSGA_RALSO      QEFGLHHLTEGMLERAFPEFRPRLTECRFYNCRHLQEPGCGILGAMAEGKIDPRRHALYAQLLHESEQQK
RSGA_HAMD5      REFGLWHLTQEQIIQGFIEFRDYVGHCKFRDCAHIDDPCCALRDAVQKGHIAKERFDNYHQILSEI----
RSGA_BORGA      KEFGVETLPFENLKYYFKEFENFASFCKYKSCLHVSEPHCSVTNSLGNG-ISKPRYESYLKILSELKN--
RSGA_CHLP8      REFNLAGITRENLRFYYTEFLRFMPECAFSSCSHTVEPGCAVIAAVESGRIDAERYESYLALLDSLD---
RSGA_PELCD      RELHLWGESEAGLASTFPEVIGFAAQCRFSDCQHDQEPDCGIRQALHDGTLDPARLESYLKQRAEI----
RSGA1_OCEIH     RELQLWTEDGDTLSHTFSDINHLIAECKFTDCKHDTEPDCAVKEALETGDLEEGRWNSYLKLQREL----
RSGA_SYNSC      NRPDLP-EDPQELGVLFPELRKQPWPCRFRDCLHRGEPGCGV----------------------------
RSGA_SYNS3      NRPDLP-DDPRNLEVLFPEVQLEQHPCRFRDCLHRDEPGCGV----------------------------
RSGA2_VIBVU     RELQL-ADCSEGVSETFAEIETLAQHCRFKDCQHQQEPGCAVQQAIDNGTLEARRLQNYFKLLREQAYNA
RSGA_BORRA      KEFGIEGLGYLELKYYFKEFKYFNDLCRFNSCLHINEPNCFVISQI-GFKIAEARYNSYLKIFSELKR--
RSGA_BORDL      KEFGIEGLGYLELKYYFKEFKYFNDLCRFNSCLHINEPNCFVISQI-GFKIAEARYNSYLKIFSELKR--
RSGA_VARPS      QEFGLNHIAPMQLAGLMPDIAEHANDCKFYNCTHLHEPGCGVIANVDPGPISATRYRIYGELFAELSQSR
RSGA_METMA      REIQLGDS-AEGIEKAFSEIVDAASNCKFKDCTHRDEPGCAVLKAVKDGIIPEERLASYHRLTDEL----
RSGA2_VIBVY     RELQL-ADCSEGVSETFAEIETLAQHCRFKDCQHQQEPGCAVQQAINNGTLEARRLQNYFKLQREQAYNA
RSGA_XYLFM      RELKF--TGEEDLVEEFADIELLATQCRFRDCAHQVEPGCAVRAAIGCGTLDPQRLHHYFKLRGEI----
RSGA_LEPIC      REVGLFSEGSEDLEEVFPEIAVAAEECRFNDCSHNEEPNCGVVAAVKDGRISEARYFSYLKLSKEL----
RSGA_THEEB      NQPELPPD-PRQLAAAFPEIQRLSQDCLFDNCRHDQEPGCCVRGNWE-------RYPLYIEYLHQLE---
RSGA_LEPIN      REVGLFSEGSEDLEEVFPEIAVAAEECRFNDCSHNEEPNCGVVAAVKDGRISEARYFSYLKLSKEL----
RSGA_STRAW      RGVGLWDAET-GVNQVFSEIEALAAECRFHDCAHTAEPGCAVLAALDTGELPERRLDSYRKLLRE-----
RSGA_PROMT      NRPEI-VCEPSDFAFLFPEFRTSNSQCKFRNCLHRDEPGCVIDKDLE-------RYPFYRQNLEEMINSP
RSGA_STRCO      RGVGL-FDAGNGVDQVFAEIAELAEECRFHDCAHESEPGCAVLAAIDSGALPERRLESYRKLMRE-----
RSGA_PROM1      NRPEI-VCEPSDFAFLFPEFRTSNSQCKFRNCLHRDEPGCVIDKDLE-------RYPFYRENLEEMINSP
RSGA_XYLFA      RELKF--TGEEDLVEEFADIELLATQCRFRDCAHQAEPGCAVRAAIGCGTLDPQRLHHYFKLRGEI----
RSGA_OPITP      RELQLWGVDESAVAETFPEVAALAAECRFPDCTHQREPGCAVRAALDDGTLDPTRWASY-----------
RSGA_XYLFT      RELKF--TGEEDLVEEFADIELLATQCRFRDCAHQAEPGCAVRAAIGCGTLDPQRLHHYFKLRGEI----
RSGA_XYLF2      RELKF--TGEEDLVEEFADIELLATQCRFRDCAHQAEPGCAVRAAIGCGTLDPQRLHHYFKLRGEI----
RSGA_SYNPX      NRPDLPDDPSE-LGMLFPELRVQLSPCRFRDCLHRQEPGCGINREWE-------RFEFYKDALQE-----
RSGA_RHOBA      RQFQLWDISAGEVAGLMPDLRPYVSGCRYPDCLHLAEDDCAVK---------------------------
RSGA1_LISIN     REFGIGLNQA-GLETTFSDVEELSKDCRFHDCSHTSEPGCAVQESLADGTLSLKHYENWQKLQREM----
RSGA2_LISMF     REFGVGFNQA-GLETTFSDVEELAEGCRFHDCSHTQEPGCAVKAALEDGTLTMQHYENWLKLQREM----
RSGA2_ANASP     REIQIWAGD-ESLQETFADIETLAPECRFRNCQHHNEPGCAVQQALLEGELDYSRFLGYQKLQKELNAQK
RSGA_MYCGE      NVISIKNLKIL-AAQHFVGFQKMISKCHFSNCYHQYEKDCFVTTSVMKNRYPSWLYEKYRKMIN------
RSGA1_BACTN     REFGLAIDNPDSLTEMF-EISDYAESCRFSDCKHIDEPGCAVLEAVHNGTLDHKVYESYLKLRRE-----
RSGA_XANCP      REL--KPTGEEDLAEGFSDVEALAAQCRFNDCAHIAEPGCAVRAAIEADQLDPERVANYMKLRVEVASAA
RSGA_XANCB      REL--KPTGEEDLAEGFSDVEALAAQCRFNDCAHIAEPGCAVRAAIEADQLDPERVANYMKLRVEVASAA
RSGA_XANC8      REL--KPTGEEDLAEGFSDVEALAAQCRFNDCAHIAEPGCAVRAAIEADQLDPERVANYMKLRVEVASAA
RSGA_XANAC      REL--KPTGEEDLAEGFSDVEALAAQCRFNDCAHIAEPGCAVRAAIDAGELDPERVANYMKLRMEVASAA
RSGA_NEIG2      QEFGLHHLQAADLPHYFPDFRHLVGQCRFHNCTHRAEPGCAFKAAAETGAASPER---------------
RSGA_NEIG1      QEFGLHHLQAADLPHYFPDFRHLVGQCRFHNCTHRAEPGCAFKAAAETGAASPER---------------
RSGA_XANC5      REL--KPTGEEDLAEGFSDVEALAAQCRFNDCAHIAEPGCAVRAAIDAGELDPERVANYMKLRVEVASAA
RSGA_RHILO      RTLQVS-DVGYGIDTLFAEITELAPLCKFRDCTHVHEPGCAVQAALKAGTLDPERLARWRKLSDE-----
RSGA_XANOR      REL--KPTGEEDLAEGFSDVEALAAQCRFNDCAHIAEPGCAVRAAIEADLLDPERVANYMKLRVEVASAA
RSGA_XANOM      REL--KPTGEEDLAEGFSDVEALAAQCRFNDCAHIAEPGCAVRAAIEADLLDPERVANYMKLRVEVASAA
RSGA_NEIMF      QEFGLHHLQAADLPRYFPDFRHLVGQCRFHNCTHRAEPGCAFKAAAETGAASPER---------------
RSGA_XANOP      REL--KPTGEEDLAEGFSDVEALAAQCRFNDCAHIAEPGCAVRAAIEADLLDPERVANYMKLRVEVASAA
RSGA_NEIMA      QEFGLHHLQAADLPRYFPDFRHLVGQCRFHNCTHRAEPGCAFKAAAE-----------------------
RSGA_NEIM0      QEFGLHHLQAADLPRYFPDFRHLVGQCRFHNCTHRAEPGCAFKAAAE-----------------------
RSGA_PROMM      NRPELPAD-LRKLAVLFPELDGQLEDCRFRDCFHRDEPGCGVDKSWE-------RYPIYKRFLEEME---
RSGA_NEIMB      QEFGLHHLQAADLPRYFPDFRHLVGQCRFHNCTHRAEPGCAFKAAAQTGAASPER---------------
RSGA_PROM3      NRPELPAD-PRKLAVLFPEFDGQIEDCRFRDCFHRDEPGCGVDKSWE-------RYPIYKRFLEEME---
RSGA_MYCPN      NVIDFP-NLKQLAAQHFVGFASLIGQCHFSNCTHQSEKGCFIVSAVTQKSYSLWLYESYLKLIN------
YRH1_AZOVI      -----------DVEAGFIEFRDLLGHCRFRDCRHDREPGCALLKALDEGRIQPQRMASYRHILASL----
RBSA_VIBF1      SIIHQELNLIPELTIA------------------------------------------------------
RBSA_HAEIN      SIIHQELNLVGNLTIA------------------------------------------------------
RBSA_HAEI8      SIIHQELNLVGNLTIA------------------------------------------------------
MNME_ACHLI      ----------------------------------------------------------------------
ENGB_PELTS      ----------------------------------------------------------------------
RBSA_PHOPR      SIIHQELNLIPELTIA------------------------------------------------------
MSBA_HAEIN      ----------------------------------------------------------------------
MSBA_COXBU      ----------------------------------------------------------------------
ENGB_RICRS      GFANVPISVKE-----------------------------------------------------------
ENGB_RICPU      GFANVPISVKE-----------------------------------------------------------
ENGB_MYCGA      GYARIKKSQKEEIS--------------------------------------------------------
HMUV_SHEDO      ----------------------------------------------------------------------
ENGB_RICAE      GFANVPISVKE-----------------------------------------------------------
ENGB_RICFE      GFANVPISVKE-----------------------------------------------------------
ENGB_RICCN      GFANVPISVKE-----------------------------------------------------------
ENGB_MYCPE      GYAKVSKSKHFELSKIISE---------------------------------------------------
MSBA_THICR      ----------------------------------------------------------------------
MNME_NEIMF      RETDDVVER-------------------------------------------------------------
MNME_NEIMB      RETDDVVER-------------------------------------------------------------
MNME_NEIMA      RETDDVVER-------------------------------------------------------------
MNME_NEIM0      RETDDVVER-------------------------------------------------------------
MNME_NEIG2      RETDDVVER-------------------------------------------------------------
MNME_NEIG1      RETDDVVER-------------------------------------------------------------
MSBA_SODGM      ----------------------------------------------------------------------
ENGB_RICAH      GFAHVPISVKE-----------------------------------------------------------
ENGB_UREPA      GFAKVSKEKQTDL---------------------------------------------------------
ENGB_UREP2      GFAKVSKEKQTDL---------------------------------------------------------
ENGB_MARMM      ----------------------------------------------------------------------
SPR3_YEAST      GN--------------------------------------------------------------------
ENGB_MYCAP      GYAQLSKEKIEEMN--------------------------------------------------------
ENGB_DESRM      ----------------------------------------------------------------------
CBIO1_STAES     ----------------------------------------------------------------------
CBIO1_STAEQ     ----------------------------------------------------------------------
ASND1_YEAST     SHLPYEVTSEIDLN--FTSLSEVSKN--------------------------------------------
PDR12_YEAST     ----------------------------------------------------------------------
MALK_MANSM      ----------------------------------------------------------------------
HMUV_BURCH      ACLRAVLPQA--AQPAFP----------------------------------------------------
HMUV_BURCA      ACLRAVLPQA--AQPAFP----------------------------------------------------
THIQ_VIBF1      ----------------------------------------------------------------------
PEO1_HUMAN      ----------------------------------------------------------------------
MSBA_YERPS      ----------------------------------------------------------------------
MSBA_YERPN      ----------------------------------------------------------------------
MSBA_YERPE      ----------------------------------------------------------------------
MSBA_YERPA      ----------------------------------------------------------------------
MSBA_ERWCT      ----------------------------------------------------------------------
ENGB_RICPR      GFANVPISVKE-----------------------------------------------------------
ENGB_EDWI9      GYAEVPEEMKRKWQQALGE---------------------------------------------------
ENGB_ACIC5      LFAD------------------------------------------------------------------
BFR1_SCHPO      ----------------------------------------------------------------------
YCLP_BACSU      ----------------------------------------------------------------------
Y1087_HAEIN     ----------------------------------------------------------------------
ERA_FUSNN       ----------------------------------------------------------------------
ENGB_UREU1      ----------------------------------------------------------------------
ENGB_FINM2      ----------------------------------------------------------------------
ENGB_DESHY      ----------------------------------------------------------------------
ENGB_DESHD      ----------------------------------------------------------------------
ENGB_CLOB8      GYA--KVSKAE-----------------------------------------------------------
CDC10_YEAST     ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           ETYKKVSKKIPK
RSGA_STRR6      ETYKKVSKKIPK
RSGA_STRPN      ETYKKVSKKIPK
RSGA_STRP3      ETYKKVIKR---
RSGA_STRP1      ETYKKVIKR---
RSGA_STRP8      ETYKKVIKR---
RSGA_STRP6      ETYKKVIKR---
RSGA_STRA3      ETYKKVIKR---
RSGA_STRA5      ETYKKVIKR---
RSGA_STRMU      ETYKKVLKR---
RSGA_LACLA      ETYEKKRKK---
RSGA_ENTFA      PVYKKKS-----
RSGA_GEOKA      PRY---------
RSGA_BACC1      PRY---------
RSGA_BACAN      PRY---------
RSGA_BACCN      PRY---------
RSGA2_OCEIH     PRY---------
RSGA_BACA2      PRY---------
RSGA_GEOTN      PRY---------
RSGA_BACCR      PRY---------
RSGA_BACSU      PRY---------
RSGA_LACF3      PNYQK-------
RSGA_GEOSW      PRY---------
RSGA_LACRJ      PNYKK-------
RSGA_LACRD      PNYKK-------
RSGA_LACSS      PVYKK-------
RSGA_BACP2      PRY---------
RSGA2_LISIN     PRY---------
RSGA2_LISMO     PRY---------
RSGA1_LISMF     PRY---------
RSGA_BACSK      RRY---------
RSGA_LEUCK      PKYK--------
RSGA_LEUMM      PKYK--------
RSGA_STACT      ERY---------
RSGA_BACHD      K-----------
RSGA_STAS1      ERY---------
RSGA_STAHJ      VRY---------
RSGA_PEDPA      PEY---------
RSGA1_LACPL     ------------
RSGA_STAAR      VRY---------
RSGA_STAES      VRY---------
RSGA_STAAW      VRY---------
RSGA_STAAS      VRY---------
RSGA_STAAN      VRY---------
RSGA_STAAM      VRY---------
RSGA_STAEQ      VRY---------
RSGA_STAAC      VRY---------
RSGA_THETN      ------------
RSGA_ALKMQ      ------------
RSGA_CLOBB      ------------
RSGA_CLONN      ------------
RSGA_LACGA      PEYLK-------
RSGA_CLOB6      K-----------
RSGA_CLOAB      ------------
RSGA_CLOBM      K-----------
RSGA_CLOBJ      K-----------
RSGA_CLOTE      ------------
RSGA_CLOBH      K-----------
RSGA_CLOB1      K-----------
RSGA_CLOP1      ------------
RSGA_CLOBL      K-----------
RSGA_CLOBK      K-----------
RSGA_LACJO      PEYLK-------
RSGA_CLOPE      ------------
RSGA_CLOPS      ------------
RSGA_LACAC      PEYLK-------
RSGA_LACH4      PEYLK-------
RSGA_CLOBA      ------------
RSGA_EUBR3      K-----------
RSGA_CARHZ      ------------
RSGA_MYCAP      K-----------
RSGA_MYCPU      ------------
RSGA_CLOB8      ------------
RSGA_MYCHJ      ------------
RSGA_MOOTA      RSF---------
RSGA_MYCH2      ------------
RSGA_CLOK5      K-----------
RSGA_CLOK1      K-----------
RSGA_CLOCE      ------------
RSGA_MYCPE      ------------
RSGA_MYCH7      ------------
RSGA_THEP1      K-----------
RSGA_THEMA      K-----------
RSGA_THENN      ------------
RSGA_UREP2      ------------
RSGA_FLAJ1      RT----------
RSGA2_BACTN     ------------
RSGA_UREPA      ------------
RSGA_FLAPJ      ETYR--------
RSGA_HAEIN      ------------
RSGA_HAEIE      ------------
RSGA_HAEI8      ------------
RSGA_HAEIG      ------------
RSGA_FUSNN      ------------
RSGA_BACFR      ------------
RSGA_BACFN      ------------
RSGA_UREU1      ------------
RSGA_BACV8      ------------
RSGA_PARD8      ------------
RSGA_PHYMT      K-----------
RSGA_YERPY      ------------
RSGA_YERPS      ------------
RSGA_YERPP      ------------
RSGA_YERPN      ------------
RSGA_YERPG      ------------
RSGA_YERPE      ------------
RSGA_YERPB      ------------
RSGA_YERPA      ------------
RSGA_YERP3      ------------
RSGA_AYWBP      ------------
RSGA_ONYPE      ------------
RSGA_AZOPC      ------------
RSGA_ACTPJ      ET----------
RSGA_ACTP7      ET----------
RSGA_ACTP2      ET----------
RSGA_YERE8      ------------
RSGA_SHIFL      ------------
RSGA_PHOLL      ------------
RSGA_GRAFK      DQYQK-------
RSGA_ECOLI      ------------
RSGA_ECOLC      ------------
RSGA_ECODH      ------------
RSGA_ECOBW      ------------
RSGA_SHIB3      ------------
RSGA_ECOSM      ------------
RSGA_ECOSE      ------------
RSGA_ECOLU      ------------
RSGA_ECOL6      ------------
RSGA_ECOHS      ------------
RSGA_ECO81      ------------
RSGA_ECO7I      ------------
RSGA_ECO5E      ------------
RSGA_ECO57      ------------
RSGA_ECO55      ------------
RSGA_ECO45      ------------
RSGA_ECO27      ------------
RSGA_ECO24      ------------
RSGA_KLEP3      ------------
RSGA_ECO8A      ------------
RSGA_AQUAE      ------------
RSGA_ACTSZ      ------------
RSGA_SALEP      ------------
RSGA_SALDC      ------------
RSGA_ESCF3      ------------
RSGA_SHEON      ------------
RSGA_HAEDU      ET----------
RSGA_ANAVT      QLYQQ-------
RSGA_SALTY      ------------
RSGA_SALTI      ------------
RSGA_SALPB      ------------
RSGA_SALNS      ------------
RSGA_SALHS      ------------
RSGA_SALA4      ------------
RSGA_HAES2      ------------
RSGA_PASMU      ------------
RSGA_HAES1      ------------
RSGA1_ANASP     QLYQQ-------
RSGA_SALSV      ------------
RSGA_MANSM      ------------
RSGA_CYTH3      ------------
RSGA_PSEE4      ------------
RSGA_KLEP7      ------------
RSGA1_VIBPA     NRQYSRNKK---
RSGA_BURXL      ------------
RSGA_VIBCH      NRQYSRSKK---
RSGA_PROMH      ------------
RSGA_HAHCH      ------------
RSGA_SACD2      ------------
RSGA_AZOVD      ------------
RSGA_PSEPK      ------------
RSGA_PSEP1      ------------
RSGA_PROMA      ------------
RSGA_MICAN      ------------
RSGA_BURPS      ------------
RSGA_BURP6      ------------
RSGA_BURP1      ------------
RSGA_BURP0      ------------
RSGA_PSEPW      ------------
RSGA_PSEF5      ------------
RSGA_PSEPG      ------------
RSGA_SERP5      ------------
RSGA_BORPE      ------------
RSGA_BORPA      ------------
RSGA_BORBR      ------------
RSGA_PHYAS      XXYVK-------
RSGA_BURP8      ------------
RSGA_BURMS      ------------
RSGA_BURMA      ------------
RSGA_BURM9      ------------
RSGA_BURM7      ------------
RSGA_RALPJ      ------------
RSGA_PORGI      ------------
RSGA_PORG3      ------------
RSGA_CHLTE      ------------
RSGA_PSEPF      ------------
RSGA_SODGM      ------------
RSGA_PECCP      ------------
RSGA_BURPP      ------------
RSGA_PSEFS      ------------
RSGA_ERWCT      ------------
RSGA_MARAV      ------------
RSGA_DICD3      ------------
RSGA1_VIBVY     NRQYSRNKK---
RSGA1_VIBVU     NRQYSRNKK---
RSGA_PSESM      ------------
RSGA_ALCBS      ERY---------
RSGA_SYNY3      ET----------
RSGA_GEMAT      ------------
RSGA_MYCGA      ------------
RSGA_CHRSD      ------------
RSGA_ERWT9      ------------
RSGA_DICNV      ------------
RSGA_PSEU2      ------------
RSGA_PSEAE      ------------
RSGA_PSEAB      ------------
RSGA_PSEA8      ------------
RSGA_PSE14      ------------
RSGA_PSEMY      ------------
RSGA_NITEU      ETNKRV------
RSGA_BORAP      ------------
RSGA2_LACPL     ------------
RSGA1_LISMO     ------------
RSGA_BORBZ      ------------
RSGA_BORBU      ------------
RSGA_METAC      KKAEIGLKRLEK
RSGA2_VIBPA     ------------
RSGA_NITMU      ------------
RSGA_RALSO      ------------
RSGA_HAMD5      ------------
RSGA_BORGA      --YKNYAK----
RSGA_CHLP8      ------------
RSGA_PELCD      ------------
RSGA1_OCEIH     ------------
RSGA_SYNSC      ------------
RSGA_SYNS3      ------------
RSGA2_VIBVU     STFAEQRNRI--
RSGA_BORRA      --YKSYAREI--
RSGA_BORDL      --YKSYAREI--
RSGA_VARPS      ------------
RSGA_METMA      ------------
RSGA2_VIBVY     STF---------
RSGA_XYLFM      ------------
RSGA_LEPIC      ------------
RSGA_THEEB      ------------
RSGA_LEPIN      ------------
RSGA_STRAW      ------------
RSGA_PROMT      LPYQ--------
RSGA_STRCO      ------------
RSGA_PROM1      LPYQ--------
RSGA_XYLFA      ------------
RSGA_OPITP      ------------
RSGA_XYLFT      ------------
RSGA_XYLF2      ------------
RSGA_SYNPX      ------------
RSGA_RHOBA      ------------
RSGA1_LISIN     ------------
RSGA2_LISMF     ------------
RSGA2_ANASP     ERWKKIHK----
RSGA_MYCGE      ------------
RSGA1_BACTN     ------------
RSGA_XANCP      E-----------
RSGA_XANCB      E-----------
RSGA_XANC8      E-----------
RSGA_XANAC      E-----------
RSGA_NEIG2      ------------
RSGA_NEIG1      ------------
RSGA_XANC5      E-----------
RSGA_RHILO      ------------
RSGA_XANOR      E-----------
RSGA_XANOM      E-----------
RSGA_NEIMF      ------------
RSGA_XANOP      E-----------
RSGA_NEIMA      ------------
RSGA_NEIM0      ------------
RSGA_PROMM      ------------
RSGA_NEIMB      ------------
RSGA_PROM3      ------------
RSGA_MYCPN      ------------
YRH1_AZOVI      ------------
RBSA_VIBF1      ------------
RBSA_HAEIN      ------------
RBSA_HAEI8      ------------
MNME_ACHLI      ------------
ENGB_PELTS      ------------
RBSA_PHOPR      ------------
MSBA_HAEIN      ------------
MSBA_COXBU      ------------
ENGB_RICRS      ------------
ENGB_RICPU      ------------
ENGB_MYCGA      ------------
HMUV_SHEDO      ------------
ENGB_RICAE      ------------
ENGB_RICFE      ------------
ENGB_RICCN      ------------
ENGB_MYCPE      ------------
MSBA_THICR      ------------
MNME_NEIMF      ------------
MNME_NEIMB      ------------
MNME_NEIMA      ------------
MNME_NEIM0      ------------
MNME_NEIG2      ------------
MNME_NEIG1      ------------
MSBA_SODGM      ------------
ENGB_RICAH      ------------
ENGB_UREPA      ------------
ENGB_UREP2      ------------
ENGB_MARMM      ------------
SPR3_YEAST      ------------
ENGB_MYCAP      ------------
ENGB_DESRM      ------------
CBIO1_STAES     ------------
CBIO1_STAEQ     ------------
ASND1_YEAST     ------------
PDR12_YEAST     ------------
MALK_MANSM      ------------
HMUV_BURCH      ------------
HMUV_BURCA      ------------
THIQ_VIBF1      ------------
PEO1_HUMAN      ------------
MSBA_YERPS      ------------
MSBA_YERPN      ------------
MSBA_YERPE      ------------
MSBA_YERPA      ------------
MSBA_ERWCT      ------------
ENGB_RICPR      ------------
ENGB_EDWI9      ------------
ENGB_ACIC5      ------------
BFR1_SCHPO      ------------
YCLP_BACSU      ------------
Y1087_HAEIN     ------------
ERA_FUSNN       ------------
ENGB_UREU1      ------------
ENGB_FINM2      ------------
ENGB_DESHY      ------------
ENGB_DESHD      ------------
ENGB_CLOB8      ------------
CDC10_YEAST     ------------