[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for spne4:ACF56119.1

[Show Plain Result]


## Summary of Sequence Search
    1::109
    1::109     4e-59 100%  109 aa  CRCB1_STRPN RecName: Full=Protein crcB homolog 1;
    1::109     1e-57  97%  109 aa  CRCB1_STRR6 RecName: Full=Protein crcB homolog 1;
   14::112     3e-17  46%  119 aa  CRCB2_LACJO RecName: Full=Protein crcB homolog 2;
    1::120     4e-17  40%  124 aa  CRCB2_LACAC RecName: Full=Protein crcB homolog 2;
    4::120     1e-15  37%  124 aa  CRCB_FLAPJ RecName: Full=Protein crcB homolog;
   27::142     5e-15  42%  147 aa  CRCB1_STAAW RecName: Full=Protein crcB homolog 1;
   27::142     5e-15  42%  147 aa  CRCB1_STAAS RecName: Full=Protein crcB homolog 1;
   27::142     5e-15  42%  147 aa  CRCB1_STAAR RecName: Full=Protein crcB homolog 1;
   27::142     5e-15  42%  147 aa  CRCB1_STAAN RecName: Full=Protein crcB homolog 1;
   27::142     5e-15  42%  147 aa  CRCB1_STAAM RecName: Full=Protein crcB homolog 1;
   27::142     5e-15  42%  147 aa  CRCB1_STAAC RecName: Full=Protein crcB homolog 1;
    1::116     5e-15  42%  121 aa  CRCB1_STAA8 RecName: Full=Protein crcB homolog 1;
    4::114     7e-15  38%  117 aa  CRCB1_STAHJ RecName: Full=Protein crcB homolog 1;
    1::116     7e-15  42%  121 aa  CRCB1_STAAB RecName: Full=Protein crcB homolog 1;
    6::118     2e-14  44%  126 aa  CRCB_ACIAD RecName: Full=Protein crcB homolog;
    1::116     3e-14  39%  118 aa  CRCB1_LISIN RecName: Full=Protein crcB homolog 1;
    4::117     4e-14  38%  121 aa  CRCB_BACV8 RecName: Full=Protein crcB homolog;
    1::116     4e-14  39%  118 aa  CRCB1_LISMO RecName: Full=Protein crcB homolog 1;
    6::116     4e-14  38%  118 aa  CRCB1_LISMF RecName: Full=Protein crcB homolog 1;
    4::114     7e-14  39%  123 aa  CRCB_IGNH4 RecName: Full=Protein crcB homolog;
   33::123     1e-13  43%  128 aa  CRCB_PROA2 RecName: Full=Protein crcB homolog;
    1::116     2e-13  38%  121 aa  CRCB2_STAS1 RecName: Full=Protein crcB homolog 2;
    5::111     2e-13  38%  116 aa  CRCB1_GEOKA RecName: Full=Protein crcB homolog 1;
    2::114     3e-13  38%  117 aa  CRCB2_STAES RecName: Full=Protein crcB homolog 2;
    2::114     3e-13  38%  117 aa  CRCB2_STAEQ RecName: Full=Protein crcB homolog 2;
    4::96      4e-13  44%  127 aa  CRCB_ENT38 RecName: Full=Protein crcB homolog;
   37::123     5e-13  45%  128 aa  CRCB_CHLPB RecName: Full=Protein crcB homolog;
    1::115     6e-13  38%  118 aa  CRCB2_BACCR RecName: Full=Protein crcB homolog 2;
    6::121     8e-13  43%  129 aa  CRCB_CHLPD RecName: Full=Protein crcB homolog;
   10::120     1e-12  42%  127 aa  CRCB1_YERPS RecName: Full=Protein crcB homolog 1;
   10::120     1e-12  42%  127 aa  CRCB1_YERPE RecName: Full=Protein crcB homolog 1;
    3::122     2e-12  36%  130 aa  CRCB_HELPJ RecName: Full=Protein crcB homolog;
    6::122     2e-12  38%  127 aa  CRCB_HAHCH RecName: Full=Protein crcB homolog;
    3::122     2e-12  37%  127 aa  CRCB_HELAH RecName: Full=Protein crcB homolog;
    1::115     2e-12  39%  118 aa  CRCB2_BACAN RecName: Full=Protein crcB homolog 2;
    4::122     4e-12  36%  130 aa  CRCB_HELPH RecName: Full=Protein crcB homolog;
    4::103     4e-12  42%  127 aa  CRCB_ESCF3 RecName: Full=Protein crcB homolog;
    4::103     4e-12  41%  127 aa  CRCB_ECOLU RecName: Full=Protein crcB homolog;
    1::121     4e-12  40%  124 aa  CRCB_AZOVD RecName: Full=Protein crcB homolog;
    1::115     4e-12  37%  118 aa  CRCB2_BACHK RecName: Full=Protein crcB homolog 2;
    1::115     4e-12  39%  118 aa  CRCB2_BACCZ RecName: Full=Protein crcB homolog 2;
    4::103     7e-12  41%  127 aa  CRCB_SHISS RecName: Full=Protein crcB homolog;
    4::103     7e-12  41%  127 aa  CRCB_SHIFL RecName: Full=Protein crcB homolog;
    4::103     7e-12  41%  127 aa  CRCB_SHIF8 RecName: Full=Protein crcB homolog;
    4::103     7e-12  41%  127 aa  CRCB_SHIDS RecName: Full=Protein crcB homolog;
    4::103     7e-12  41%  127 aa  CRCB_SHIBS RecName: Full=Protein crcB homolog;
    4::103     7e-12  41%  127 aa  CRCB_SHIB3 RecName: Full=Protein crcB homolog;
    4::122     7e-12  36%  130 aa  CRCB_HELPG RecName: Full=Protein crcB homolog;
    4::103     7e-12  41%  127 aa  CRCB_ECOUT RecName: Full=Protein crcB homolog;
    4::103     7e-12  41%  127 aa  CRCB_ECOSM RecName: Full=Protein crcB homolog;
    4::103     7e-12  41%  127 aa  CRCB_ECOSE RecName: Full=Protein crcB homolog;
    4::103     7e-12  41%  127 aa  CRCB_ECOLC RecName: Full=Protein crcB homolog;
    4::103     7e-12  41%  127 aa  CRCB_ECOL6 RecName: Full=Protein crcB homolog;
    4::103     7e-12  41%  127 aa  CRCB_ECOL5 RecName: Full=Protein crcB homolog;
    4::103     7e-12  41%  127 aa  CRCB_ECOHS RecName: Full=Protein crcB homolog;
    4::103     7e-12  41%  127 aa  CRCB_ECO8A RecName: Full=Protein crcB homolog;
    4::103     7e-12  41%  127 aa  CRCB_ECO81 RecName: Full=Protein crcB homolog;
    4::103     7e-12  41%  127 aa  CRCB_ECO7I RecName: Full=Protein crcB homolog;
    4::103     7e-12  41%  127 aa  CRCB_ECO5E RecName: Full=Protein crcB homolog;
    4::103     7e-12  41%  127 aa  CRCB_ECO57 RecName: Full=Protein crcB homolog;
    4::103     7e-12  41%  127 aa  CRCB_ECO55 RecName: Full=Protein crcB homolog;
    4::103     7e-12  41%  127 aa  CRCB_ECO27 RecName: Full=Protein crcB homolog;
    4::103     7e-12  41%  127 aa  CRCB_ECO24 RecName: Full=Protein crcB homolog;
    4::103     9e-12  39%  127 aa  CRCB_SALTY RecName: Full=Protein crcB homolog;
    4::103     9e-12  39%  127 aa  CRCB_SALTI RecName: Full=Protein crcB homolog;
    4::103     9e-12  39%  127 aa  CRCB_SALSV RecName: Full=Protein crcB homolog;
    4::103     9e-12  39%  127 aa  CRCB_SALPK RecName: Full=Protein crcB homolog;
    4::103     9e-12  39%  127 aa  CRCB_SALPC RecName: Full=Protein crcB homolog;
    4::103     9e-12  39%  127 aa  CRCB_SALPB RecName: Full=Protein crcB homolog;
    4::103     9e-12  39%  127 aa  CRCB_SALPA RecName: Full=Protein crcB homolog;
    4::103     9e-12  39%  127 aa  CRCB_SALNS RecName: Full=Protein crcB homolog;
    4::103     9e-12  39%  127 aa  CRCB_SALHS RecName: Full=Protein crcB homolog;
    4::103     9e-12  39%  127 aa  CRCB_SALG2 RecName: Full=Protein crcB homolog;
    4::103     9e-12  39%  127 aa  CRCB_SALEP RecName: Full=Protein crcB homolog;
    4::103     9e-12  39%  127 aa  CRCB_SALDC RecName: Full=Protein crcB homolog;
    4::103     9e-12  39%  127 aa  CRCB_SALCH RecName: Full=Protein crcB homolog;
    4::103     9e-12  39%  127 aa  CRCB_SALAR RecName: Full=Protein crcB homolog;
    4::103     9e-12  39%  127 aa  CRCB_SALA4 RecName: Full=Protein crcB homolog;
   37::122     9e-12  47%  129 aa  CRCB_CHLCH RecName: Full=Protein crcB homolog;
   18::123     1e-11  41%  129 aa  CRCB_PELLD RecName: Full=Protein crcB homolog;
    4::102     2e-11  48%  127 aa  CRCB_BACFR RecName: Full=Protein crcB homolog;
    4::102     2e-11  48%  127 aa  CRCB_BACFN RecName: Full=Protein crcB homolog;
    5::115     2e-11  36%  118 aa  CRCB2_BACC1 RecName: Full=Protein crcB homolog 2;
    5::119     3e-11  34%  127 aa  CRCB_PSEYM RecName: Full=Protein crcB homolog;
    4::122     3e-11  36%  130 aa  CRCB_HELPS RecName: Full=Protein crcB homolog;
    6::117     3e-11  42%  126 aa  CRCB_ACIBY RecName: Full=Protein crcB homolog;
    6::117     3e-11  42%  126 aa  CRCB_ACIBT RecName: Full=Protein crcB homolog;
    6::117     3e-11  42%  126 aa  CRCB_ACIBS RecName: Full=Protein crcB homolog;
    6::117     3e-11  42%  126 aa  CRCB_ACIB5 RecName: Full=Protein crcB homolog;
    6::117     3e-11  42%  126 aa  CRCB_ACIB3 RecName: Full=Protein crcB homolog;
    4::122     3e-11  36%  130 aa  CRCB_HELPY RecName: Full=Protein crcB homolog;
    1::115     3e-11  37%  119 aa  CRCB2_LACDA RecName: Full=Protein crcB homolog 2;
    1::121     4e-11  39%  124 aa  CRCB_PSEF5 RecName: Full=Protein crcB homolog;
    5::117     4e-11  38%  118 aa  CRCB1_STAS1 RecName: Full=Protein crcB homolog 1;
    1::119     6e-11  38%  140 aa  CRCB1_MOOTA RecName: Full=Protein crcB homolog 1;
    4::92      8e-11  41%  124 aa  CRCB_SHESR RecName: Full=Protein crcB homolog;
    4::92      8e-11  41%  124 aa  CRCB_SHESM RecName: Full=Protein crcB homolog;
    4::92      8e-11  41%  124 aa  CRCB_SHESA RecName: Full=Protein crcB homolog;
    6::121     8e-11  37%  125 aa  CRCB_DESAH RecName: Full=Protein crcB homolog;
    5::87      1e-10  46%  128 aa  CRCB_BURTA RecName: Full=Protein crcB homolog;
    4::92      1e-10  40%  124 aa  CRCB_SHESW RecName: Full=Protein crcB homolog;
    4::92      1e-10  40%  124 aa  CRCB_SHEPC RecName: Full=Protein crcB homolog;
    4::92      1e-10  41%  124 aa  CRCB_SHEON RecName: Full=Protein crcB homolog;
    1::114     1e-10  37%  121 aa  CRCB1_STAES RecName: Full=Protein crcB homolog 1;
    1::114     1e-10  37%  121 aa  CRCB1_STAEQ RecName: Full=Protein crcB homolog 1;
    1::121     2e-10  39%  124 aa  CRCB_PSEPF RecName: Full=Protein crcB homolog;
   10::103     2e-10  39%  127 aa  CRCB_KLEP3 RecName: Full=Protein crcB homolog;
    4::122     2e-10  36%  130 aa  CRCB_HELP2 RecName: Full=Protein crcB homolog;
    6::117     2e-10  41%  126 aa  CRCB_ACIBC RecName: Full=Protein crcB homolog;
   34::116     2e-10  40%  116 aa  CRCB1_LACPL RecName: Full=Protein crcB homolog 1;
    4::92      3e-10  39%  124 aa  CRCB_SHEPW RecName: Full=Protein crcB homolog;
    4::92      3e-10  38%  124 aa  CRCB_SHEHH RecName: Full=Protein crcB homolog;
    7::96      3e-10  43%  130 aa  CRCB_RHOFD RecName: Full=Protein crcB homolog;
    1::86      3e-10  45%  126 aa  CRCB_RENSM RecName: Full=Protein crcB homolog;
    5::87      3e-10  46%  128 aa  CRCB_BURP6 RecName: Full=Protein crcB homolog;
    5::87      3e-10  46%  128 aa  CRCB_BURP0 RecName: Full=Protein crcB homolog;
   34::115     3e-10  43%  142 aa  CRCB1_NOCFA RecName: Full=Protein crcB homolog 1;
    5::121     4e-10  37%  124 aa  CRCB_PSESM RecName: Full=Protein crcB homolog;
   38::121     5e-10  42%  124 aa  CRCB_PSEFS RecName: Full=Protein crcB homolog;
    7::96      5e-10  41%  125 aa  CRCB_DESMR RecName: Full=Protein crcB homolog;
   31::147     5e-10  38%  178 aa  CRCB2_BIFLO RecName: Full=Protein crcB homolog 2;
    5::121     8e-10  36%  124 aa  CRCB_PSE14 RecName: Full=Protein crcB homolog;
    5::87      8e-10  45%  128 aa  CRCB_BURPS RecName: Full=Protein crcB homolog;
    5::87      8e-10  45%  128 aa  CRCB_BURMS RecName: Full=Protein crcB homolog;
    5::87      8e-10  45%  128 aa  CRCB_BURMA RecName: Full=Protein crcB homolog;
    5::87      8e-10  45%  128 aa  CRCB_BURM9 RecName: Full=Protein crcB homolog;
    5::87      8e-10  45%  128 aa  CRCB_BURM7 RecName: Full=Protein crcB homolog;
    4::116     8e-10  35%  132 aa  CRCB3_METBF RecName: Full=Protein crcB homolog 3;
    4::90      1e-09  39%  124 aa  CRCB_SHEPA RecName: Full=Protein crcB homolog;
    5::118     1e-09  34%  124 aa  CRCB_METJA RecName: Full=Protein crcB homolog;
    5::112     1e-09  35%  126 aa  CRCB_ACIAC RecName: Full=Protein crcB homolog;
   32::120     1e-09  40%  131 aa  CRCB_METKA RecName: Full=Protein crcB homolog;
    5::121     2e-09  36%  124 aa  CRCB_PSEU2 RecName: Full=Protein crcB homolog;
   26::102     2e-09  39%  104 aa  CRCB2_CORDI RecName: Full=Protein crcB homolog 2;
   15::116     2e-09  37%  131 aa  CRCB1_METAC RecName: Full=Protein crcB homolog 1;
   31::118     2e-09  40%  127 aa  CRCB_PSEAB RecName: Full=Protein crcB homolog;
   24::123     2e-09  41%  128 aa  CRCB_PASMU RecName: Full=Protein crcB homolog;
    6::89      2e-09  40%  117 aa  CRCB2_CLOAB RecName: Full=Protein crcB homolog 2;
    1::117     3e-09  40%  125 aa  CRCB_VARPS RecName: Full=Protein crcB homolog;
    4::120     3e-09  37%  126 aa  CRCB_SULNB RecName: Full=Protein crcB homolog;
    7::119     4e-09  34%  125 aa  CRCB_GEOLS RecName: Full=Protein crcB homolog;
    4::90      5e-09  40%  124 aa  CRCB_SHEAM RecName: Full=Protein crcB homolog;
   33::118     5e-09  41%  127 aa  CRCB_NITEU RecName: Full=Protein crcB homolog;
    1::116     5e-09  37%  129 aa  CRCB2_GEOKA RecName: Full=Protein crcB homolog 2;
    6::122     7e-09  38%  127 aa  CRCB_THEP1 RecName: Full=Protein crcB homolog;
   33::118     7e-09  39%  127 aa  CRCB_PSEAE RecName: Full=Protein crcB homolog;
   33::118     7e-09  39%  127 aa  CRCB_PSEA8 RecName: Full=Protein crcB homolog;
    7::119     7e-09  35%  129 aa  CRCB_PELPD RecName: Full=Protein crcB homolog;
   41::108     7e-09  45%  108 aa  CRCB2_CORGL RecName: Full=Protein crcB homolog 2;
    4::121     9e-09  33%  128 aa  CRCB_METFK RecName: Full=Protein crcB homolog;
    6::122     1e-08  38%  127 aa  CRCB_THEMA RecName: Full=Protein crcB homolog;
    5::121     1e-08  32%  124 aa  CRCB_BACTN RecName: Full=Protein crcB homolog;
    6::84      1e-08  41%  126 aa  CRCB_ACIBL RecName: Full=Protein crcB homolog;
    6::120     2e-08  31%  123 aa  CRCB_PYRFU RecName: Full=Protein crcB homolog;
    6::119     2e-08  39%  126 aa  CRCB_MARAV RecName: Full=Protein crcB homolog;
    4::91      2e-08  41%  126 aa  CRCB_DESAD RecName: Full=Protein crcB homolog;
    3::116     2e-08  34%  121 aa  CRCB2_STAHJ RecName: Full=Protein crcB homolog 2;
    1::92      3e-08  40%  124 aa  CRCB_PSEU5 RecName: Full=Protein crcB homolog;
   11::103     3e-08  39%  137 aa  CRCB_ANAVT RecName: Full=Protein crcB homolog;
   34::119     4e-08  36%  124 aa  CRCB_RHILO RecName: Full=Protein crcB homolog;
   23::104     4e-08  38%  124 aa  CRCB_DESDG RecName: Full=Protein crcB homolog;
    1::120     4e-08  30%  124 aa  CRCB_COXBN RecName: Full=Protein crcB homolog;
   33::118     4e-08  39%  126 aa  CRCB_CHRVO RecName: Full=Protein crcB homolog;
   14::120     4e-08  39%  122 aa  CRCB_CAMJR RecName: Full=Protein crcB homolog;
   14::120     4e-08  39%  122 aa  CRCB_CAMJ8 RecName: Full=Protein crcB homolog;
   36::128     4e-08  39%  157 aa  CRCB_ANASP RecName: Full=Protein crcB homolog;
    4::81      4e-08  35%  270 aa  CRCB2_BRUME RecName: Full=Protein crcB homolog 2;
    4::81      4e-08  35%  270 aa  CRCB1_BRUAB RecName: Full=Protein crcB homolog 1;
    7::94      5e-08  41%  129 aa  CRCB_SULDN RecName: Full=Protein crcB homolog;
   34::120     5e-08  36%  130 aa  CRCB_DEHSC RecName: Full=Protein crcB homolog;
   34::120     5e-08  36%  130 aa  CRCB_DEHSB RecName: Full=Protein crcB homolog;
   34::120     5e-08  36%  130 aa  CRCB_DEHE1 RecName: Full=Protein crcB homolog;
    8::97      6e-08  37%  111 aa  CRCB3_METAC RecName: Full=Protein crcB homolog 3;
   32::119     6e-08  37%  139 aa  CRCB1_CLOAB RecName: Full=Protein crcB homolog 1;
    4::103     8e-08  37%  127 aa  CRCB_ECOLI RecName: Full=Protein crcB;
    4::103     8e-08  37%  127 aa  CRCB_ECOBW RecName: Full=Protein crcB homolog;
    4::120     8e-08  32%  125 aa  CRCB_AGRT5 RecName: Full=Protein crcB homolog;
    4::120     8e-08  30%  134 aa  CRCB3_YERPS RecName: Full=Protein crcB homolog 3;
    4::120     8e-08  30%  134 aa  CRCB2_YERPE RecName: Full=Protein crcB homolog 2;
    5::47      8e-08  53%  118 aa  CRCB2_DESHY RecName: Full=Protein crcB homolog 2;
    7::94      1e-07  37%  126 aa  CRCB_NITMS RecName: Full=Protein crcB homolog;
    1::91      1e-07  33%  124 aa  CRCB_COXB1 RecName: Full=Protein crcB homolog;
    4::92      2e-07  37%  124 aa  CRCB_SHEFN RecName: Full=Protein crcB homolog;
   34::120     2e-07  39%  122 aa  CRCB_CAMJJ RecName: Full=Protein crcB homolog;
   34::120     2e-07  39%  122 aa  CRCB_CAMJE RecName: Full=Protein crcB homolog;
    6::124     2e-07  32%  129 aa  CRCB2_BRUAB RecName: Full=Protein crcB homolog 2;
   36::106     2e-07  45%  137 aa  CRCB1_LEIXX RecName: Full=Protein crcB homolog 1;
   40::94      2e-07  48%  133 aa  CRCB_SACD2 RecName: Full=Protein crcB homolog;
    2::111     2e-07  32%  120 aa  CRCB_PSEHT RecName: Full=Protein crcB homolog;
   32::118     2e-07  41%  122 aa  CRCB_HYDS0 RecName: Full=Protein crcB homolog;
   13::105     2e-07  35%  114 aa  CRCB1_PROMT RecName: Full=Protein crcB homolog 1;
  254::362     3e-07  35%  375 aa  YO390_YEAST RecName: Full=UPF0695 membrane protein YOR390W;
   35::114     3e-07  38%  128 aa  CRCB_NAUPA RecName: Full=Protein crcB homolog;
    8::125     4e-07  37%  130 aa  CRCB_SYNJB RecName: Full=Protein crcB homolog;
    4::102     4e-07  32%  124 aa  CRCB_SHEWM RecName: Full=Protein crcB homolog;
    4::92      4e-07  37%  124 aa  CRCB_SHEB9 RecName: Full=Protein crcB homolog;
    4::92      4e-07  37%  124 aa  CRCB_SHEB8 RecName: Full=Protein crcB homolog;
   10::118     4e-07  36%  127 aa  CRCB_HAES2 RecName: Full=Protein crcB homolog;
   10::118     4e-07  36%  127 aa  CRCB_HAES1 RecName: Full=Protein crcB homolog;
  254::362     5e-07  35%  375 aa  YP279_YEAST RecName: Full=UPF0695 membrane protein YPL279C;
    4::90      5e-07  35%  124 aa  CRCB_SHELP RecName: Full=Protein crcB homolog;
    4::92      7e-07  37%  124 aa  CRCB_SHEB5 RecName: Full=Protein crcB homolog;
    4::92      7e-07  37%  124 aa  CRCB_SHEB2 RecName: Full=Protein crcB homolog;
    5::112     7e-07  33%  119 aa  CRCB_NEIG2 RecName: Full=Protein crcB homolog;
    5::112     7e-07  33%  119 aa  CRCB_NEIG1 RecName: Full=Protein crcB homolog;
   30::119     7e-07  38%  125 aa  CRCB_ACIC5 RecName: Full=Protein crcB homolog;
   19::108     7e-07  35%  122 aa  CRCB1_METMA RecName: Full=Protein crcB homolog 1;
    7::108     7e-07  45%  128 aa  CRCB1_LACDA RecName: Full=Protein crcB homolog 1;
    4::120     9e-07  34%  124 aa  CRCB_SULSY RecName: Full=Protein crcB homolog;
    1::85      9e-07  34%  122 aa  CRCB_SOLUE RecName: Full=Protein crcB homolog;
    4::74      9e-07  42%  133 aa  CRCB_SALRD RecName: Full=Protein crcB homolog;
    1::108     9e-07  27%  114 aa  CRCB1_LACS1 RecName: Full=Protein crcB homolog 1;
   67::130     1e-06  41%  167 aa  CRCB_XANOR RecName: Full=Protein crcB homolog;
   35::98      1e-06  41%  135 aa  CRCB_XANOM RecName: Full=Protein crcB homolog;
    4::102     1e-06  33%  124 aa  CRCB_SHEDO RecName: Full=Protein crcB homolog;
    9::118     1e-06  35%  129 aa  CRCB2_LACS1 RecName: Full=Protein crcB homolog 2;
   13::96      1e-06  31%  116 aa  CRCB1_METBF RecName: Full=Protein crcB homolog 1;
    1::118     1e-06  28%  131 aa  CRCB_METSB RecName: Full=Protein crcB homolog;
    4::120     1e-06  36%  126 aa  CRCB_ANASK RecName: Full=Protein crcB homolog;
    5::86      2e-06  34%  126 aa  CRCB_VIBCM RecName: Full=Protein crcB homolog;
    5::86      2e-06  34%  126 aa  CRCB_VIBCH RecName: Full=Protein crcB homolog;
    5::86      2e-06  34%  126 aa  CRCB_VIBC3 RecName: Full=Protein crcB homolog;
   33::118     2e-06  37%  127 aa  CRCB_PSEA7 RecName: Full=Protein crcB homolog;
    7::87      2e-06  38%  143 aa  CRCB_METRJ RecName: Full=Protein crcB homolog;
    7::108     2e-06  39%  125 aa  CRCB_ACIF5 RecName: Full=Protein crcB homolog;
    7::108     2e-06  39%  125 aa  CRCB_ACIF2 RecName: Full=Protein crcB homolog;
   18::65      2e-06  41%  254 aa  CRCB1_BRUSU RecName: Full=Protein crcB homolog 1;
    4::90      3e-06  34%  124 aa  CRCB_SHESH RecName: Full=Protein crcB homolog;
   34::120     3e-06  35%  125 aa  CRCB_RHIME RecName: Full=Protein crcB homolog;
    1::116     3e-06  26%  129 aa  CRCB2_LISMO RecName: Full=Protein crcB homolog 2;
    1::116     3e-06  26%  129 aa  CRCB2_LISMF RecName: Full=Protein crcB homolog 2;
    6::120     3e-06  30%  127 aa  CRCB_SORC5 RecName: Full=Protein crcB homolog;
    7::88      3e-06  36%  127 aa  CRCB_ALTMD RecName: Full=Protein crcB homolog;
    1::61      4e-06  43%  125 aa  CRCB_THEM4 RecName: Full=Protein crcB homolog;
    4::50      4e-06  48%  124 aa  CRCB_GEOBB RecName: Full=Protein crcB homolog;
   12::122     4e-06  40%  137 aa  CRCB3_BRUME RecName: Full=Protein crcB homolog 3;
    7::109     4e-06  28%  123 aa  CRCB2_PROMP RecName: Full=Protein crcB homolog 2;
    4::115     4e-06  32%  132 aa  CRCB2_BACLD RecName: Full=Protein crcB homolog 2;
   33::115     4e-06  39%  129 aa  CRCB1_LACAC RecName: Full=Protein crcB homolog 1;
   30::116     6e-06  32%  124 aa  CRCB_ROSS1 RecName: Full=Protein crcB homolog;
   31::117     6e-06  31%  123 aa  CRCB_META3 RecName: Full=Protein crcB homolog;
    4::120     6e-06  36%  126 aa  CRCB_ANAD2 RecName: Full=Protein crcB homolog;
    4::114     6e-06  31%  117 aa  CRCB2_STAAC RecName: Full=Protein crcB homolog 2;
    1::50      7e-06  54%  125 aa  CRCB_POLSQ RecName: Full=Protein crcB homolog;
    1::105     7e-06  34%  126 aa  CRCB_CAMHC RecName: Full=Protein crcB homolog;
    5::82      7e-06  33%  125 aa  CRCB_AERS4 RecName: Full=Protein crcB homolog;
   20::99      7e-06  32%  126 aa  CRCB2_MYCTU RecName: Full=Protein crcB homolog 2;
   20::99      7e-06  32%  126 aa  CRCB2_MYCBO RecName: Full=Protein crcB homolog 2;
   12::131     7e-06  35%  141 aa  CRCB1_RHOPB RecName: Full=Protein crcB homolog 1;
   34::120     7e-06  36%  126 aa  CRCB1_NITHX RecName: Full=Protein crcB homolog 1;
    7::120     1e-05  29%  142 aa  CRCB_OCHA4 RecName: Full=Protein crcB homolog;
   33::87      1e-05  50%  132 aa  CRCB_CHRSD RecName: Full=Protein crcB homolog;
   12::122     1e-05  39%  137 aa  CRCB4_BRUSU RecName: Full=Protein crcB homolog 4;
   12::122     1e-05  39%  137 aa  CRCB3_BRUAB RecName: Full=Protein crcB homolog 3;
   20::120     1e-05  31%  123 aa  CRCB_PYRHO RecName: Full=Protein crcB homolog;
   62::118     1e-05  38%  127 aa  CRCB_PSEPW RecName: Full=Protein crcB homolog;
   65::121     1e-05  40%  124 aa  CRCB_PSEPK RecName: Full=Protein crcB homolog;
   65::121     1e-05  40%  124 aa  CRCB_PSEPG RecName: Full=Protein crcB homolog;
   65::121     1e-05  40%  124 aa  CRCB_PSEP1 RecName: Full=Protein crcB homolog;
   34::117     1e-05  35%  126 aa  CRCB_NITWN RecName: Full=Protein crcB homolog;
    4::50      1e-05  48%  124 aa  CRCB_GEOSM RecName: Full=Protein crcB homolog;
    5::50      1e-05  50%  128 aa  CRCB_BURS3 RecName: Full=Protein crcB homolog;
   37::123     1e-05  34%  126 aa  CRCB_ALISL RecName: Full=Protein crcB homolog;
    3::92      1e-05  37%  134 aa  CRCB2_CARHZ RecName: Full=Protein crcB homolog 2;
   30::118     1e-05  35%  123 aa  CRCB1_BRUME RecName: Full=Protein crcB homolog 1;
  198::287     2e-05  30%  311 aa  YI7B_SCHPO RecName: Full=UPF0695 membrane protein
   40::89      2e-05  49%  133 aa  CRCB_XANC5 RecName: Full=Protein crcB homolog;
   40::89      2e-05  49%  133 aa  CRCB_XANAC RecName: Full=Protein crcB homolog;
   10::120     2e-05  33%  127 aa  CRCB_SERP5 RecName: Full=Protein crcB homolog;
    5::50      2e-05  52%  128 aa  CRCB_BURCJ RecName: Full=Protein crcB homolog;
    4::91      2e-05  39%  126 aa  CRCB_ANADE RecName: Full=Protein crcB homolog;
    1::109     2e-05  28%  114 aa  CRCB2_BACSK RecName: Full=Protein crcB homolog 2;
   34::120     2e-05  34%  127 aa  CRCB1_BACSK RecName: Full=Protein crcB homolog 1;
    7::51      2e-05  40%  125 aa  CRCB_RHILW RecName: Full=Protein crcB homolog;
    5::58      2e-05  35%  125 aa  CRCB_RHIL3 RecName: Full=Protein crcB homolog;
    7::58      2e-05  39%  125 aa  CRCB_RHIEC RecName: Full=Protein crcB homolog;
    5::50      2e-05  48%  128 aa  CRCB_BURVG RecName: Full=Protein crcB homolog;
    6::115     2e-05  30%  122 aa  CRCB2_MYCPA RecName: Full=Protein crcB homolog 2;
    1::113     2e-05  26%  129 aa  CRCB2_LISIN RecName: Full=Protein crcB homolog 2;
   13::131     2e-05  29%  137 aa  CRCB2_BRAJA RecName: Full=Protein crcB homolog 2;
   10::99      2e-05  33%  131 aa  CRCB1_BIFLO RecName: Full=Protein crcB homolog 1;
   37::123     3e-05  34%  127 aa  CRCB_VIBPA RecName: Full=Protein crcB homolog;
   34::95      3e-05  45%  125 aa  CRCB_THET8 RecName: Full=Protein crcB homolog;
   36::97      3e-05  45%  127 aa  CRCB_THET2 RecName: Full=Protein crcB homolog;
    2::53      3e-05  51%  134 aa  CRCB_LEGPL RecName: Full=Protein crcB homolog;
    2::53      3e-05  51%  134 aa  CRCB_LEGPH RecName: Full=Protein crcB homolog;
    2::53      3e-05  51%  134 aa  CRCB_LEGPC RecName: Full=Protein crcB homolog;
    2::53      3e-05  51%  134 aa  CRCB_LEGPA RecName: Full=Protein crcB homolog;
   16::99      3e-05  35%  125 aa  CRCB_ELUMP RecName: Full=Protein crcB homolog;
    1::62      3e-05  39%  122 aa  CRCB_CAMLR RecName: Full=Protein crcB homolog;
    6::94      3e-05  32%  126 aa  CRCB2_YERPS RecName: Full=Protein crcB homolog 2;
   68::119     4e-05  48%  124 aa  CRCB_CYTH3 RecName: Full=Protein crcB homolog;
    4::68      4e-05  25%  120 aa  CRCB2_METHJ RecName: Full=Protein crcB homolog 2;
   14::114     4e-05  31%  142 aa  CRCB1_BRAJA RecName: Full=Protein crcB homolog 1;
   35::82      5e-05  48%  124 aa  CRCB_RHOS4 RecName: Full=Protein crcB homolog;
   35::82      5e-05  48%  124 aa  CRCB_RHOS1 RecName: Full=Protein crcB homolog;
    1::95      5e-05  34%  128 aa  CRCB_MAGSA RecName: Full=Protein crcB homolog;
   37::87      6e-05  43%  126 aa  CRCB_VIBVY RecName: Full=Protein crcB homolog;
   37::87      6e-05  43%  126 aa  CRCB_VIBVU RecName: Full=Protein crcB homolog;
   31::74      6e-05  52%  122 aa  CRCB_METMP RecName: Full=Protein crcB homolog;
    6::94      6e-05  32%  126 aa  CRCB3_YERPE RecName: Full=Protein crcB homolog 3;
    1::49      6e-05  41%  123 aa  CRCB2_PROAC RecName: Full=Protein crcB homolog 2;
   43::106     6e-05  41%  140 aa  CRCB2_NOCFA RecName: Full=Protein crcB homolog 2;
    8::88      8e-05  34%  126 aa  CRCB_SILPO RecName: Full=Protein crcB homolog;
    5::50      8e-05  48%  129 aa  CRCB_DESDA RecName: Full=Protein crcB homolog;
    3::58      8e-05  34%  124 aa  CRCB_AQUAE RecName: Full=Protein crcB homolog;
   36::124     8e-05  34%  129 aa  CRCB2_BRUSU RecName: Full=Protein crcB homolog 2;
   37::87      1e-04  41%  127 aa  CRCB_VIBHB RecName: Full=Protein crcB homolog;
    1::86      1e-04  38%  126 aa  CRCB_SILST RecName: Full=Protein crcB homolog;
    7::51      1e-04  38%  125 aa  CRCB_RHIE6 RecName: Full=Protein crcB homolog;
   34::95      1e-04  38%  132 aa  CRCB_OPITP RecName: Full=Protein crcB homolog;
   34::120     1e-04  31%  125 aa  CRCB_MESSB RecName: Full=Protein crcB homolog;
    7::55      1e-04  43%  127 aa  CRCB_LEPIC RecName: Full=Protein crcB homolog;
   59::106     1e-04  45%  148 aa  CRCB2_RUBXD RecName: Full=Protein crcB homolog 2;
    8::123     1e-04  29%  131 aa  CRCB2_RHOPB RecName: Full=Protein crcB homolog 2;
   32::84      1e-04  40%  119 aa  CRCB1_NATPD RecName: Full=Protein crcB homolog 1;
    1::83      2e-04  31%  124 aa  CRCB_RHOPS RecName: Full=Protein crcB homolog;
    4::72      2e-04  40%  122 aa  CRCB_METVS RecName: Full=Protein crcB homolog;
   15::65      2e-04  44%  105 aa  CRCB_JANSC RecName: Full=Protein crcB homolog;
    1::118     2e-04  32%  126 aa  CRCB_BURP8 RecName: Full=Protein crcB homolog;
    1::83      2e-04  29%  124 aa  CRCB_RHOPA RecName: Full=Protein crcB homolog;
   23::55      2e-04  61%  127 aa  CRCB_LEPIN RecName: Full=Protein crcB homolog;
   38::96      2e-04  40%  131 aa  CRCB2_DEIGD RecName: Full=Protein crcB homolog 2;
    1::51      3e-04  40%  123 aa  CRCB_MAGSM RecName: Full=Protein crcB homolog;
    4::49      4e-04  45%  128 aa  CRCB_WOLSU RecName: Full=Protein crcB homolog;
   13::58      4e-04  33%  129 aa  CRCB_OCEIH RecName: Full=Protein crcB homolog;
   33::75      4e-04  48%  128 aa  CRCB_NITSB RecName: Full=Protein crcB homolog;
    5::60      4e-04  44%  119 aa  CRCB_NEIMB RecName: Full=Protein crcB homolog;
   15::88      4e-04  39%  144 aa  CRCB_GLUOX RecName: Full=Protein crcB homolog;
   38::127     4e-04  34%  143 aa  CRCB1_PROAC RecName: Full=Protein crcB homolog 1;
    5::64      5e-04  39%  125 aa  CRCB_NITOC RecName: Full=Protein crcB homolog;
    5::60      5e-04  44%  119 aa  CRCB_NEIMA RecName: Full=Protein crcB homolog;
   63::119     5e-04  35%  127 aa  CRCB_HYPNA RecName: Full=Protein crcB homolog;
   68::109     5e-04  39%  125 aa  CRCB_ERWT9 RecName: Full=Protein crcB homolog;
   36::85      5e-04  34%  124 aa  CRCB2_PROMM RecName: Full=Protein crcB homolog 2;
   33::113     5e-04  33%  118 aa  CRCB1_BACSU RecName: Full=Protein crcB homolog 1;
    2::50      7e-04  41%  124 aa  CRCB_GEOMG RecName: Full=Protein crcB homolog;
   10::49      9e-04  47%  127 aa  CRCB_PECCP RecName: Full=Protein crcB homolog;
   35::94      9e-04  38%  228 aa  CRCB_METCA RecName: Full=Protein crcB homolog;
    5::49      9e-04  54%  128 aa  CRCB_HAEIG RecName: Full=Protein crcB homolog;
    4::50      9e-04  36%  124 aa  CRCB_GEOSF RecName: Full=Protein crcB homolog;
   10::49      9e-04  47%  127 aa  CRCB_ERWCT RecName: Full=Protein crcB homolog;
    1::109

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MVIVYLAIACGLGALVRYFFSRYNQASKLPLGTLIANLLGCFLIGVFYNHVESKEVYAILATGFCGGLTT
CRCB1_STRPN     MVIVYLAIACGLGALVRYFFSRYNQASKLPLGTLIANLLGCFLIGVFYNHVESKEVYAILATGFCGGLTT
CRCB1_STRR6     MVIVYLAIACGFGALVRYFFSRYNQASKLPLGTLIANLLGCFLIGVFYNHVESKEVYAILATGFCGGLTT
CRCB2_LACJO     ------------GAILRYGITNYGKSEKFPYATLLINLTGAFLLGFIFSRKFSPFIYALIGTGVLGGYTT
CRCB2_LACAC     MNFLLAGIGASIGAMLRYAITNYNKFSNLPTPTLFINLTGAFILGFIFGIKTNVFIYAIVGTGVLGGYTT
CRCB_FLAPJ      --IFYIALGGGLGSVLRYLINKYVQTT-FPYATFVTNIAGCLLIGLFFGYLEKQNAVSFLITGLCGGYTT
CRCB1_STAAW     MQYVYIFIGGALGALLRYLISFLNTDGGFPIGTLIANLTGAFVMGLFSNHPTLKKA---ITTGFLGALTT
CRCB1_STAAS     MQYVYIFIGGALGALLRYLISFLNTDGGFPIGTLIANLTGAFVMGLFSNHPTLKKA---ITTGFLGALTT
CRCB1_STAAR     MQYVYIFIGGALGALLRYLISFLNTDGGFPIGTLIANLTGAFVMGLFSNHPTLKKA---ITTGFLGALTT
CRCB1_STAAN     MQYVYIFIGGALGALLRYLISFLNTDGGFPIGTLIANLTGAFVMGLFSNHPTLKKA---ITTGFLGALTT
CRCB1_STAAM     MQYVYIFIGGALGALLRYLISFLNTDGGFPIGTLIANLTGAFVMGLFSNHPTLKKA---ITTGFLGALTT
CRCB1_STAAC     MQYVYIFIGGALGALLRYLISFLNTDGGFPIGTLIANLTGAFVMGLFSNHPTLKKA---ITTGFLGALTT
CRCB1_STAA8     MQYVYIFIGGALGALLRYLISFLNTDGGFPIGTLIANLTGAFVMGLFSNHPTLKKA---ITTGFLGALTT
CRCB1_STAHJ     --ILFIMVGGGIGAVIRAWLTKSKITSPIPIATLIVNLVGSFLIGFVYGIAQDYQLFSLFITGVLGGLTT
CRCB1_STAAB     MQYVYIFIGGALGALLRYLISFLNTDGGFPIGTLVANLTGAFIMGLFSNHPTLKKA---ITTGFLGALTT
CRCB_ACIAD      -----LSIACGLGAWLRWFVGKFNSTQNFPLGTILVNLVGGFIIGLFANMQLSSNYKLFVITGFCGALTT
CRCB1_LISIN     MLINFLLVGFGLGAMLRYIFVKSKWKTDFPYATFFINITGSFLLGFLVSTALGPMWQLFLGTGFMGGYTT
CRCB_BACV8      --LLLIFLGGGTGSVLRYLLSIYRQGTNFPWGTFAVNILGCILIGVFYTHI-NNDIRLMLTIGLCGGFTT
CRCB1_LISMO     MLVNFLLVGFGLGAMLRYGISKSKWKTNFPSATFFINITGSFLLGFLVSSALGPVWQLFLGTGFMGGYTT
CRCB1_LISMF     ---VLVGFGAALGAMLRYGISKSKWKTNFPFATFFINITGSFLLGFLVSSALGPVWQLFLGTGFMGGYTT
CRCB_IGNH4      --LVWVAVGGALGAIVRYFFYKFPQVYDFPLATFLVNVVASFLLGFIIGAFEAKQLKLALATGFCGALST
CRCB_PROA2      -------------------------ATGFPMATMLVNVLGCFLIGMIXXXXXXXXXXXXXATGFCGGFTT
CRCB2_STAS1     MQYLFIFLGGAVGALLRYLLSFINTSFEMPIGTFIANLCGAFLMGFYFNN--SPMLKKGITTGFIGSLTT
CRCB1_GEOKA     ---LFVAIGGFFGAMARYLVSRWRRSPRFPLGTLIVNLLGSFLLGWLAGSGAADAAKLLVGTGFMGAFTT
CRCB2_STAES     ITILLVMLGGGIGAVLRALITNICQRSKIPIATSIVNITGSLIIGFMMGHLDSHHMFPFFVTGVLGGLTT
CRCB2_STAEQ     ITILLVMLGGGIGAVLRALITNICQRSKIPIATSIVNITGSLIIGFMMGHLDSHHMFPFFVTGVLGGLTT
CRCB_ENT38      -LLLAVFIGGGTGSVARWFLSRFNPMHQIPLGTLTANLIGAFIIGVWFNRMTHIDPMLLITTGFCGGLTT
CRCB_CHLPB      -----------------------------PFGTLAVNLAGCFLIGFIXXXXXXXXXXXXXATGFCGGFTT
CRCB2_BACCR     -MIEALLVATGFGAITRFAISNWRNKTQFPLATFLINITGAFLLGYIIGNGVTTGWQLLLGTGFMGAFTT
CRCB_CHLPD      -VSAFLLVGIGLGSAARYGASLLLSAGGLPLATFSVNIIGCFFIGALSTTLVSPESRLFLVTGFCGGFTT
CRCB1_YERPS     -------IGGGVGSMARWLVSKLNSASALPVGTLIVNLVGAFIIGLFSRMTHIDPVWKLLTTGFCGGLTT
CRCB1_YERPE     -------IGGGVGSMARWLVSKLNSASALPVGTLIVNLVGAFIIGLFSRMTHIDPVWKLLTTGFCGGLTT
CRCB_HELPJ      LVFLWAALGGAIGSSLRYFVSKFLMFESFPLGTFSVNLIGCFIIG-FMGHLAAKKVFGFFVTGVLGGFTT
CRCB_HAHCH      --LVYVALGGALGAVSRYLIVAWVSGAKFPWGTLAVNLLGSFLLGTAFVYVVEKELRSLIMVGFLGALTT
CRCB_HELAH      LVFLWAALGGALGSSLRYFVSKFLMFESFPLGTFSVNLIGCFVIGLM-GHLAAKKVFGFFVTGVLGGFTT
CRCB2_BACAN     -MIEALLVATGFGAITRFWFKKRNKTS-FPIATFLINITGAFLLGYIIGNGVTTGWQLLLGTGFMGAFTT
CRCB_HELPH      -VFLWAALGGAIGSSLRYFVSKFLMFESFPLGTFSVNLIGCFVIG-FMGHLAAKKVFGFFVTGVLGGFTT
CRCB_ESCF3      -LLLAVFIGGGTGSVARWMLSRFNPLHQIPLGTLAANLLGAFIIGMFSRMTNIDPVWKVLTTGFCGGLTT
CRCB_ECOLU      -LLLAVFIGGGTGSVARWLLSRFNPLHQIPLGTLAANLIGAFIIGMFSRMTNIDPVWKVLTTGFCGGLTT
CRCB_AZOVD      MIGVTLAVAVGLGCLLRFATSNWISAQHFYAATLAVNIAGCLLIGYLYGQFLLRPLRAGLIAGFLGGLTT
CRCB2_BACHK     -MIEALLVATGFGAITRFAISNWRNKTQFPIATFLINITGAFLLGYIIGSGVTTGWQLLLGTGFMGAFTT
CRCB2_BACCZ     -MIEALLVATGFGAITRFWFKKRNKTS-FPIATFLINITGAFLLGYIIGSGVTTGWQLLLGTGFMGAFTT
CRCB_SHISS      -LLLAVFIGGGTGSVARWLLSRFNPLHQIPLGTLAANLIGAFIIGMFSRMTNIDPVWKVLTTGFCGGLTT
CRCB_SHIFL      -LLLAVFIGGGTGSVARWLLSRFNPLHQIPLGTLAANLIGAFIIGMFSRMTNIDPVWKVLTTGFCGGLTT
CRCB_SHIF8      -LLLAVFIGGGTGSVARWLLSRFNPLHQIPLGTLAANLIGAFIIGMFSRMTNIDPVWKVLTTGFCGGLTT
CRCB_SHIDS      -LLLAVFIGGGTGSVARWLLSRFNPLHQIPLGTLAANLIGAFIIGMFSRMTNIDPVWKVLTTGFCGGLTT
CRCB_SHIBS      -LLLAVFIGGGTGSVARWLLSRFNPLHQIPLGTLTANLIGAFIIGMFSRMTNIDPVWKVLTTGFCGGLTT
CRCB_SHIB3      -LLLAVFIGGGTGSVARWLLSRFNPLHQIPLGTLTANLIGAFIIGMFSRMTNIDPVWKVLTTGFCGGLTT
CRCB_HELPG      -VFLWAALGGAIGSSLRYFVSKFLMFESFPLGTFSVNIIGCFVIG-FMGHLATKKVFGFFVTGVLGGFTT
CRCB_ECOUT      -LLLAVFIGGGTGSVARWLLSRFNPLHQIPLGTLAANLIGAFIIGMFSRMTNIDPVWKVLTTGFCGGLTT
CRCB_ECOSM      -LLLAVFIGGGTGSVARWLLSRFNPLHQIPLGTLAANLIGAFIIGMFSRMTNIDPVWKVLTTGFCGGLTT
CRCB_ECOSE      -LLLAVFIGGGTGSVARWLLSRFNPLHQIPLGTLAANLIGAFIIGMFSRMTNIDPVWKVLTTGFCGGLTT
CRCB_ECOLC      -LLLAVFIGGGTGSVARWLLSRFNPLHQIPLGTLTANLIGAFIIGMFSRMTNIDPVWKVLTTGFCGGLTT
CRCB_ECOL6      -LLLAVFIGGGTGSVARWLLSRFNPLHQIPLGTLAANLIGAFIIGMFSRMTNIDPVWKVLTTGFCGGLTT
CRCB_ECOL5      -LLLAVFIGGGTGSVARWLLSRFNPLHQIPLGTLAANLIGAFIIGMFSRMTNIDPVWKVLTTGFCGGLTT
CRCB_ECOHS      -LLLAVFIGGGTGSVARWLLSRFNPLHQIPLGTLAANLIGAFIIGMFSRMTNIDPVWKVLTTGFCGGLTT
CRCB_ECO8A      -LLLAVFIGGGTGSVARWLLSRFNPLHQIPLGTLAANLIGAFIIGMFSRMTNIDPVWKVLTTGFCGGLTT
CRCB_ECO81      -LLLAVFIGGGTGSVARWLLSRFNPLHQIPLGTLAANLIGAFIIGMFSRMTNIDPVWKVLTTGFCGGLTT
CRCB_ECO7I      -LLLAVFIGGGTGSVARWLLSRFNPLHQIPLGTLTANLIGAFIIGMFSRMTNIDPVWKVLTTGFCGGLTT
CRCB_ECO5E      -LLLAVFIGGGTGSVARWLLSRFNPLHQIPLGTLAANLIGAFIIGMFSRMTNIDPVWKVLTTGFCGGLTT
CRCB_ECO57      -LLLAVFIGGGTGSVARWLLSRFNPLHQIPLGTLAANLIGAFIIGMFSRMTNIDPVWKVLTTGFCGGLTT
CRCB_ECO55      -LLLAVFIGGGTGSVARWLLSRFNPLHQIPLGTLAANLIGAFIIGMFSRMTNIDPVWKVLTTGFCGGLTT
CRCB_ECO27      -LLLAVFIGGGTGSVARWLLSRFNPLHQIPLGTLAANLIGAFIIGMFSRMTNIDPVWKVLTTGFCGGLTT
CRCB_ECO24      -LLLAVFIGGGTGSVARWLLSRFNPLHQIPLGTLAANLIGAFIIGMFSRMTNIDPVWKVLTTGFCGGLTT
CRCB_SALTY      -LLLAVFIGGGTGSVARWMLSRFNPLHQIPIGTLTANLLGAFIIGMWFNRMTHIDPMVLITTGFCGGLTT
CRCB_SALTI      -LLLAVFIGGGTGSVARWMLSRFNPLHQIPIGTLTANLLGAFIIGMWFNRMTHIDPMVLITTGFCGGLTT
CRCB_SALSV      -LLLAVFIGGGTGSVARWMLSRFNPLHQIPIGTLTANLLGAFIIGMWFNRMTHIDPMVLITTGFCGGLTT
CRCB_SALPK      -LLLAVFIGGGTGSVARWMLSRFNPLHQIPIGTLTANLLGAFIIGMWFNRMTHIDPMVLITTGFCGGLTT
CRCB_SALPC      -LLLAVFIGGGTGSVARWMLSRFNPLHQIPIGTLTANLLGAFIIGMWFNRMTHIDPMVLITTGFCGGLTT
CRCB_SALPB      -LLLAVFIGGGTGSVARWMLSRFNPLHQIPIGTLTANLLGAFIIGMWFNRMTHIDPMVLITTGFCGGLTT
CRCB_SALPA      -LLLAVFIGGGTGSVARWMLSRFNPLHQIPIGTLTANLLGAFIIGMWFNRMTHIDPMVLITTGFCGGLTT
CRCB_SALNS      -LLLAVFIGGGTGSVARWMLSRFNPLHQIPIGTLTANLLGAFIIGMWFNRMTHIDPMVLITTGFCGGLTT
CRCB_SALHS      -LLLAVFIGGGTGSVARWMLSRFNPLHQIPIGTLTANLLGAFIIGMWFNRMTHIDPMVLITTGFCGGLTT
CRCB_SALG2      -LLLAVFIGGGTGSVARWMLSRFNPLHQIPIGTLTANLLGAFIIGMWFNRMTHIDPMVLITTGFCGGLTT
CRCB_SALEP      -LLLAVFIGGGTGSVARWMLSRFNPLHQIPIGTLTANLLGAFIIGMWFNRMTHIDPMVLITTGFCGGLTT
CRCB_SALDC      -LLLAVFIGGGTGSVARWMLSRFNPLHQIPIGTLTANLLGAFIIGMWFNRMTHIDPMVLITTGFCGGLTT
CRCB_SALCH      -LLLAVFIGGGTGSVARWMLSRFNPLHQIPIGTLTANLLGAFIIGMWFNRMTHIDPMVLITTGFCGGLTT
CRCB_SALAR      -LLLAVFIGGGTGSVARWMLSRFNPLHQIPIGTLTANLLGAFIIGMWFNRMTHIDPMVLITTGFCGGLTT
CRCB_SALA4      -LLLAVFIGGGTGSVARWMLSRFNPLHQIPIGTLTANLLGAFIIGMWFNRMTHIDPMVLITTGFCGGLTT
CRCB_CHLCH      -----------------------------PFATLTVNLLGSFLIGFISELALSTSLISFLVTGFCGGFTT
CRCB_PELLD      -----------LGTVARYLVAAFSPASPFPFATFSVNIAGSFLIGFLSETIVSPEARLFLVTGFCGGFTT
CRCB_BACFR      --IIYIFIGGGMGSVTRYLTQRLSPALPFPWGTFAVNIIGSLLIGFFYSFSESFELRLFLTVGFCGGFTT
CRCB_BACFN      --IIYIFIGGGMGSVTRYLTQRLSPALPFPWGTFAVNIIGSLLIGFFYSFSESFELRLFLTVGFCGGFTT
CRCB2_BACC1     -----LLVATGFGAITRFAISNWRTKTSFPIATFLINITGAFLLGYIIGNGVTTGWQLLLGTGFMGAFTT
CRCB_PSEYM      --LLVIAIGASLGAWLRWLLGMKLNAPTIPPGTVVANMVGGYIIGLAIAFLASPEWRLLIITGFCGGLTT
CRCB_HELPS      -IFLWAALGGAIGSSLRYFVSKFLMFESFPLGTFSVNVIGCFVIG-FMGHLAVKKVFGFFVTGVLGGFTT
CRCB_ACIBY      -----LSIALGLGAWLRWFLGKLNPIPQIPLGTVTVNLVGGFIIGAYFAHSDLNPNYKLFVTGFCGALTT
CRCB_ACIBT      -----LSIALGLGAWLRWFLGKLNPIPQIPLGTVTVNLVGGFIIGAYFAHSDLSPNYKLFVTGFCGALTT
CRCB_ACIBS      -----LSIALGLGAWLRWFLGKLNPIPQIPLGTVTVNLVGGFIIGAYFAHSDLSPNYKLFVTGFCGALTT
CRCB_ACIB5      -----LSIALGLGAWLRWFLGKLNPIPQIPLGTVTVNLVGGFIIGAYFAHSDLNPNYKLFVTGFCGALTT
CRCB_ACIB3      -----LSIALGLGAWLRWFLGKLNPIPQIPLGTVTVNLVGGFIIGAYFAHSDLNPNYKLFVTGFCGALTT
CRCB_HELPY      -VFLWAALGGAIGSSLRYFVSKFLMFESFPLGTFSVNIIGCFVIG-FMGHLAVKKVFGFFVTGVLGGFTT
CRCB2_LACDA     -MIFAVGFGASLGAVARYALTSYGQGTACPRPTLLINLTXXXXXXXXXXXRLPASVYAFLGTGVLGGYTT
CRCB_PSEF5      MIPLILAVSAGAGTLLRFATGNWINANHFYTATLAVNIVGCLLIGVLYGLFLVREVRAGLIVGFLGGLTT
CRCB1_STAS1     ---ILVMLGGGIGAVIRGFVTDFNQKTSLPIPTLLINVVGSFCIGLLMGMLNINWINPFIIVGILGGLTT
CRCB1_MOOTA     MLYLYLAVGGFCGAVGRYFLASFINRGSFPLATWIINLGGCLAMGFILTYVMGPELRLGLTTGMLGAFTT
CRCB_SHESR      --LLLVALGGSIGAVFRYLISIFMIGSSFPFGTLLVNVLGSFLMGVIYSHI-SPELKALIGVGLLGALTT
CRCB_SHESM      --LLLVALGGSIGAVFRYLISIFMIGSSFPFGTLLVNVLGSFLMGVIYSHI-SPELKALIGVGLLGALTT
CRCB_SHESA      --LLLVALGGSIGAVFRYLISIFMIGSSFPFGTLLVNVLGSFLMGVIYSHI-SPELKALIGVGLLGALTT
CRCB_DESAH      ---VFIALAGALGTLARYSLAGFVQSSFFPFGTLVVNITGCFAAGFLWTLFESREVRTFVLVGFMGAFTT
CRCB_BURTA      --IVAIFVGAGLGALLRWFLSIGLNAPEVPLGTLVSNLIGGYLIGIAVVAFATREWRLFVITGFMGGLTT
CRCB_SHESW      --VLLVALGGSIGAVFRYLISIFMIGSSFPFGTLVVNVIGSFFMGVIYSHI-SPELKALIGVGLLGALTT
CRCB_SHEPC      --VLLVALGGSIGAVFRYLISIFMIGSSFPFGTLVVNVIGSFFMGVIYSHI-SPELKALIGVGLLGALTT
CRCB_SHEON      --LLLVALGGSIGAVFRYLISIFMIGSSFPFGTLLVNVLGSFLMGVIYSHI-SPEFKALIGVGLLGALTT
CRCB1_STAES     MQYLYIFVGGALGALIRFCLSMLNEGSTIPLGTFVANLLGAFLMGLFKTHPNIKK---XXXXXXXXXXXX
CRCB1_STAEQ     MQYLYIFVGGALGALIRFCLSMLNEGSTIPLGTFVANLLGAFLMGLFKTHPNIKK---XXXXXXXXXXXX
CRCB_PSEPF      MVPLIVAVSVGAGTLLRFATGNWVNANHFYTATLAVNIVGCLLIGVLYGLFLIREVRAGLMVGFLGGLTT
CRCB_KLEP3      -------IGGGTGSVLRWWLGKLNPVHHIPIGTLTANLVGAFVIGAWFNRLTDIDPMLLITTGFCGGLTT
CRCB_HELP2      -VFLWAALGGAIGSSLRYFVSKFLMFESFPLGTFSVNIIGCFVIG-FMGHLAVKKVXXXXXTGVLGGFTT
CRCB_ACIBC      -----LSIALGLGAWLRWLLGKLNPIPQIPLGTVTVNLAGGFIIGAYFAHSDLSPNYKLFVTGFCGALTT
CRCB1_LACPL     ----------------------------LPIATLFINLTGALLLGWILTSSLPPNWQIFLGTGIMGGYTT
CRCB_SHEPW      --VLFVALGGSIGAVLRYLISILMLGSGFPFGTLMVNILGSFLMGVVYALGQSPEIKAFIGVGMLGALTT
CRCB_SHEHH      --VLFVALGGSIGAVLRYLISLLMLGSGFPFGTLVVNILGSFLMGVIFALGQSPEIKAFIGVGMLGALTT
CRCB_RHOFD      --VLAICIGASLGALARWRLGLWNPGAVLPLGTLAANLIGGYLIGVFQALPNLDPVWRLLITGFLGGLTT
CRCB_RENSM      MIVIFVGLAGVLGALMRFFFAQHGQAHHFPLATLSVNVLGSFIIGLFASHAESPDWHSAISIGIAGGLTT
CRCB_BURP6      --IVAIFVGAGLGALLRWFLSIGLNAPEVPLGTLASNLIGGYLIGIAVVAFATREWRLFVITGFMGGLTT
CRCB_BURP0      --IVAIFVGAGLGALLRWFLSIGLNAPEVPLGTLASNLIGGYLIGIAVVAFATREWRLFVITGFMGGLTT
CRCB1_NOCFA     -----------LGAPVRYLIDRAVTASPLPLGTLTVNIVGSAVLGGLIGASANGWLLTAAGTGFCGALTT
CRCB_PSESM      --ILAVSIAGIAGTLLRFAAGTWVSANYFYAATLAVNIVGCLIIGVLYGLFLSREIRAGLIVGFVGGLTT
CRCB_PSEFS      --------------------------------TLAVNLVGCLIIGLLYGWFLLREIRAGLIVGFVGGLTT
CRCB_DESMR      ----FIALAGAAGTLARYWLSGYDVLGRFPWGTAVVNILGCFLFGLVWEAGAEREARAVLLTGFMGAFTT
CRCB2_BIFLO     ---IVLVVFCGIGTAIRYAFAQIPAAGSFHTGTFVANMLACFLAGASRFGARSKELASRLGMGVCGGLST
CRCB_PSE14      --ILAVSIAGIAGTLLRFAAGTWVSANHFYAATLAVNIVGCLIIGVLYGLFLLREIRAGLIVGFVGGLTT
CRCB_BURPS      --IVAIFVGAGFGALLRWFLSIGLNAPEVPLGTLASNLIGGYLIGIAVVAFATREWRLFVITGFMGGLTT
CRCB_BURMS      --IVAIFVGAGFGALLRWFLSIGLNAPEVPLGTLASNLIGGYLIGIAVVAFATREWRLFVITGFMGGLTT
CRCB_BURMA      --IVAIFVGAGFGALLRWFLSIGLNAPEVPLGTLASNLIGGYLIGIAVVAFATREWRLFVITGFMGGLTT
CRCB_BURM9      --IVAIFVGAGFGALLRWFLSIGLNAPEVPLGTLASNLIGGYLIGIAVVAFATREWRLFVITGFMGGLTT
CRCB_BURM7      --IVAIFVGAGFGALLRWFLSIGLNAPEVPLGTLASNLIGGYLIGIAVVAFATREWRLFVITGFMGGLTT
CRCB3_METBF     --ILLVGIGGFIGATLRYVFGGWIQNSNFPVGTLTINTIGSFFLGLIYQGLFSDQTRIFLTIGILGAFTT
CRCB_SHEPA      --VLFVALGGSIGAVLRYLISLLMLGSGFPFGTLVVNILGSFLMGVIFALGQSPEFKAFIGVGMLGALTT
CRCB_METJA      --LLLIGVGGFFGAIFRYLISGIVPVKGLPTGTLAVNLIGSFILGLLYCSLFAPEYKLFIGTGFCGALTT
CRCB_ACIAC      --IAVICLAACVGALMRWGFALWNPGGLIPWGTLAVNLIGGYCIGVFTSRPDIDPAWRLLVTGFLGTLTT
CRCB_METKA      ------------------------QVRGFPMGTVLVNVLGSFVLGFLTWSTMSPEVRALATVGFCGGLTT
CRCB_PSEU2      --ILAVSIAGIAGTLLRFATGTWVSANYFYAATLAVNIVGCLIIGVLYGLFLLREIRAGLIVGFVGGLTT
CRCB2_CORDI     ------------------------------VGTFIANMAACVVLAAVRD--ASPLVMAAVGTGFAGALST
CRCB1_METAC     -------------AVLRYSLSGWVQNSNFPLGTLVVNIVGSFFLGLVYQGLFSEETRILLTIGLLGAFTT
CRCB_PSEAB      --------------------------SSIPPGTLLANLVGGYVIGAAIAYFAAPEWRLLIITGFCGGLTT
CRCB_PASMU      ----------GLGLLLNPLFSAFS------LGTLVANYLGCLIIGVFWQYPQSAEWRLFFVTGFLGSLTT
CRCB2_CLOAB     -----IGIGGACGSIVRYKIGDIRTKSKFPWGTFIINITGAFLLGIITKSGAGKNLSMILADGFLGAYTT
CRCB_VARPS      MLLPILAICMGVGALARWGLALWFGAGGMPWGTLAANLVGGYLVGVFHLLPDLDPAWRLLVTGFLGGLTT
CRCB_SULNB      ----YLLLAVGVGAILRFLISGWVQRTLFPVGTLSVNVLGSFIIGLYFESVVAPHQKALVITGMLGALTT
CRCB_GEOLS      -----IALFCAGGGLTRYYLSGWIYGRAFPYGTLVVNIIGAYCIGLIMSTMLSDTLRIGLTVGFMGGLTT
CRCB_SHEAM      --VLYIAAGGAIGAVLRYSISILALGTGFPFGTLIVNVAGSFLMGCIYALAEGPEWKALIGVGLLGALTT
CRCB_NITEU      ----------------------------VPPGTLVANLIAGYVVGVFFAHMPSPEWRLLVITGFCGGLST
CRCB2_GEOKA     MVYLAVGIAGMIGALVRYGLGLVVPAAAVPLGTLFINWTGSFLLSWFTVMFTRRPAWTAVTTGFVGSYTT
CRCB_THEP1      ----YLTIAFGIGAVLRYLVSRTINSSYIPLGTIIVNSVGSFFLSLMFAAIESKEAILFFGTGLLGAFTT
CRCB_PSEAE      ----------------------------IPPGTLLANLVGGYVIGAAIAYFAAPEWRLLIITGFCGGLTT
CRCB_PSEA8      ----------------------------IPPGTLLANLVGGYVIGAAIAYFAAPEWRLLIITGFCGGLTT
CRCB_PELPD      -----IALFCAGGGLARYYLSGWVYGRAFPFGTLAVNLIGAYCIGLIMESLRSTLIPATLTVGFMGGLTT
CRCB2_CORGL     --------------------------------------------GGFFVSLDLPHLYTVLLAGFCGALST
CRCB_METFK      --VMLVALGGAIGSAARFTLSRYSLDWRFPLPTFTVNIIGCLVIGMLAGLASSPDMRVLLFTGLVGGFTT
CRCB_THEMA      ----YLTIAFGIGAVLRYLVSRTINSSYIPLGTIIVNSVGSFFLSLMFAAIESKEAILFFGTGLLGAFTT
CRCB_BACTN      --LLFIGMGSFTGGVLRYLISRYVQTPSFPLGTLLVNVLGCFAIGLFYGLFERGNLMXXXXXXXXXXXXX
CRCB_ACIBL      ----YLWVSLGVGACARYFLSRFTAGTSFPWGTLLINITGSFVLGLFLVYTTERKWRLLIAIGFCGAYTT
CRCB_PYRFU      --VALVLIGGGTGAVARYYLSGVLPVYRFPVGTLLVNSLASFLLGYLYGLIVSRESRLFLGTGFCGGLXX
CRCB_MARAV      -----LAVSVGIGANLRWGLGLWLNASAVPWGTLVANLSGGWLIGVLMSSVLSPEWRLFAVTGLCGALTT
CRCB_DESAD      ----YLYIAAGAGSLCRYLVSGVTQATSFPIGTFSVNMIGCLFFGLVTGLFEEREMRLLILTGFMGAFTT
CRCB2_STAHJ     ----YLFVFIGFGALLRYVLSTLNVDSGLPLGTLIANIVGAFLMGYIHFFKNNPLIKKXXXXXXXXXXXX
CRCB_PSEU5      MIRMAFAVACGIGTLLRFALATWVSAQHFYLATVAVNLLGCLLIGYLYATFLARELRGALIIGFLGALTT
CRCB_ANAVT      -----IAVSLGAGALSRYYLSLWRFGITFPYGTLFINITGCLAMGFFYASLISPEIRLLIAVGFLGAYTT
CRCB_RHILO      -----------------------------PWGTMAINIVGSFAMGLFIAILASNEVRLFVATGIFGGFTT
CRCB_DESDG      ------------GAVQRLF------GASFPAGTFVVNITGCFLFGLVWGFLEDRAARMIALTGFMGAFTT
CRCB_COXBN      MNVLLIFLGCGAGGVARYGVSNLMMGKQFPIGTLIVNITGSLLMGILFIFILERQLWSLLLIGFLGGYTT
CRCB_CHRVO      ----------------------------LPPGTLAANLVGGYIIGVAVALFADMPMLSLIITGFCGGLTT
CRCB_CAMJR      -----------IGAILRMF--SINLVNKISLGTLFVNVLGSFIIGLLFSYAQNKGLSPLLSTGFLGAFTT
CRCB_CAMJ8      -----------IGAILRMF--SINLVNKISLGTLFVNVLGSFIIGLLFSYAQNKGLSPLLSTGFLGAFTT
CRCB_ANASP      -----IAVSLGAGALSRYYLSLWRFGITFPYGTLFINITGCLAMGFFYASLISPEIRLLVAVGFLGAYTT
CRCB2_BRUME     -IIILVVIGGAFGAMTREFIMLMVPTDGFPLDILVANVVACFLLGLYARKIHSRDVHTIIGTGMMGGVST
CRCB1_BRUAB     -IIILVVIGGAFGAMTREFIMLMVPTDGFPLDILVANVVACFLLGLYARKIHSRDVHTIIGTGMMGGVST
CRCB_SULDN      -----LAIGSGIGAVLRAYFNSHKMPHDIPFGTLGVNLVGSFIMGILYSTIFSLHVKSFLSTGVLGALTT
CRCB_DEHSC      -----------------------------PYGTLIVNCLGCFVLGFFSSDSHNTHLKLMLTAGFLGAFTT
CRCB_DEHSB      -----------------------------PYGTLIVNCLGCFVLGFFSSDSHNTHLKLMLTAGFLGAFTT
CRCB_DEHE1      -----------------------------PYGTLIVNCLGCFVLGFFSSDSHNTHLKLMLTAGFLGAFTT
CRCB3_METAC     -----------IGASLRYTISRVPKIQNIPAGTLTVNLLGSIVLALLTFSSEPESVVYLVNIGMLGSFTT
CRCB1_CLOAB     ---------------------------EFPISTLMINLSGAFILAVILNEIWSEEIRLGIATGFVGAYTT
CRCB_ECOLI      -LLLAVFIGGGTGSVARWLLSRFNPLHQIPLGTLTANLXXXXXXXXFSRMTNIDPVWKVLTTGFCGGLTT
CRCB_ECOBW      -LLLAVFIGGGTGSVARWLLSRFNPLHQIPLGTLTANLXXXXXXXXFSRMTNIDPVWKVLTTGFCGGLTT
CRCB_AGRT5      --IALVATGGAIGSVFRYLVGVWSMGPNFPWGTLAVNIVGSFLIGLLVELVASIEMRLFLVTGVLGGFTT
CRCB3_YERPS     -LIILVFVGGAFGAMCREFISVPRLADGFPMDIFVANIIAAFLLGLFKKDKINQYVHLMVGTGIMGGLST
CRCB2_YERPE     -LIILVFVGGAFGAMCREFISVPRLADGFPMDIFVANIIAAFLLGLFKKDKINQYVHLMVGTGIMGGLST
CRCB2_DESHY     --ILLVGIGGFCGAIVRYFFSRKLNSGKLPVGTLTVNLSGAFLLG-------------------------
CRCB_NITMS      ---VFLAAGSVLGAFLRYKITESPLINTLPLNVLIVNVIGAFILGVFIVLSQQWNLYSLFAAGFCGSLTT
CRCB_COXB1      MNVLLIFLGCGAGGVARYGVSNLMMGKQFPIGTLIVNITGSLLMGILFIFILERQLWSLLLIGFLGGYTT
CRCB_SHEFN      --VLLVALGGSIGAVLRYLLSIFMIGSSFPFGTLLVNLLGSFLMGAVYSHI-SPEIKXXXXXXXXXXXTT
CRCB_CAMJJ      ----------------------------ISFGTLFVNVLGSFIIGLLFSYAQNKGLSPLLSTGFLGAFTT
CRCB_CAMJE      ----------------------------ISFGTLFVNVLGSFIIGLLFSYAQNKGLSPLLSTGFLGAFTT
CRCB2_BRUAB     --VMWVCLGGGVGSLGRWWIGRYHHGA-FPLGTFLINISGAFVIGVDWHDRYGTMLNAGVLTGILGGYTT
CRCB1_LEIXX     -----------------------------PLGTTAINVTGSFVLGLVLGHGLPPEWRAILGTGFIGGYTT
CRCB_SACD2      ---------------------------KFPVATLTVNVLGSFLMGVFYVVIVEKAMLAVIMIGFLGAFTT
CRCB_PSEHT      -----IALGGASGACLRFFISESMLGRGFPFGTLAVNILGSLLMGILYDIIAESPAKALIGVGFLGALTT
CRCB_HYDS0      -----------------------------PLGTMVINTTGAFLIGFLSIYLTEPNIRLLLITGFLGGYTT
CRCB1_PROMT     -----ISLGAFLGALFRWQIDEI----------FIVNLIGCFLLGFFNSLNILKRYKLTLCVGLCGSMTT
YO390_YEAST     ---------------LRYWLAEFNKTNKFPLGTFLANVFATLLIGIFVNSLNSCHIVSALISGFCGTLST
CRCB_NAUPA      ----------------------------IPFGTLSVNLIGSLLLGMFYGGIQNPYIKSMLTTGMMGAFTT
CRCB_SYNJB      ---VPFAVALGAGSLSRYYLSLWRFGPSFPYGTLIINLSGCVVMGWFMTVAMSPEIRLLFGVGFLGSYTT
CRCB_SHEWM      --ILFVALGGSIGAVFRYLISIFMVGSAFPFGTLLVNIIGSFLMGVIYALGQSPEIKXXXXXXXXXXXTT
CRCB_SHEB9      --LLLVALGGSIGAVFRYLISIFMIGSSFPFGTLLVNVLGSFLMGVIYSHI-SPELKXXXXXXXXXXXTT
CRCB_SHEB8      --LLLVALGGSIGAVFRYLISIFMIGSSFPFGTLLVNVLGSFLMGVIYSHI-SPELKXXXXXXXXXXXTT
CRCB_HAES2      -------ISCGLGAMSRHXXXXXXXXXXXSFGTLIANYIGCLIMGIWHSSAFSTEYRLFFVTGFLGSLTT
CRCB_HAES1      -------ISCGLGAMSRHXXXXXXXXXXXSFGTLIANYIGCLIMGIWHSSAFSTEYRLFFVTGFLGSLTT
YP279_YEAST     ---------------LRYWLAEFNKTNKFPLGTFLANVFATLLIGIFVNSLNSCHIVSALISGFCGTLST
CRCB_SHELP      --LIFVALGGSIGAVFRYLISIFMIGSSFPFGTLMVNVIGSFLMGVIYALGESPEIKXXXXXXXXXXXTT
CRCB_SHEB5      --LLLVALGGSIGAVFRYLISIFMIGSSFPFGTLLVNVLGSFLMGVIYSHI-SPEFKXXXXXXXXXXXTT
CRCB_SHEB2      --LLLVALGGSIGAVFRYLISIFMIGSSFPFGTLLVNVLGSFLMGVIYSHI-SPEFKXXXXXXXXXXXTT
CRCB_NEIG2      --ILPLSIGAIFGTTARWLLNLAVPASLSPAGNLFANWTGALLIGIFAETVSHPQWKLLLITGFFGSLTT
CRCB_NEIG1      --ILPLSIGAIFGTTARWLLNLAVPASLSPAGNLFANWTGALLIGIFAETVSHPQWKLLLITGFFGSLTT
CRCB_ACIC5      --------------------------TRFPYGTFAINVTGCFLIGVLDAHMDLSPAWRLIPTGFIGAYTT
CRCB1_METMA     -----------IGASLRYTISRMPKIRSIPAGTLTVNFLGSIVLSLLTFSSEPESVVYLVNIGILGSFTT
CRCB1_LACDA     ----YLSVAAFWGGLARYAFSFY--------GTVIANLLGCFLLAYFFLRKSNSRAWLTLGTGFVGAFTT
CRCB_SULSY      ----YLVIAVGIGAILRYLTGVYSAGTWLPYGTLIVNVVGXXXXXXXXXXXXEKLSLLFVAVGFCGSYTT
CRCB_SOLUE      MKYLLIALGGGTGSLARYLLGTARVGARFPIGTMVVNVSGCFAIGLLTERLQPHPYWRLLVVGFLGGYTT
CRCB_SALRD      --LLWIALGGSLGALCRYGLSRWGLPPTVPWGTLAANLVGCFLIGGLWQYSFSEELRVFIFTGGIG----
CRCB1_LACS1     --MIEVALGAGLGASVRYLITQVSKTRVFPWATFIINITGALLLGFLHSKITSSHIXXXXXXXXXXXXXX
CRCB_XANOR      ----------------------------LPIGTLAANLIAAYVVGVTIAYVGTVPGLSFMITGLAGGLST
CRCB_XANOM      ----------------------------LPIGTLAANLIAAYVVGVTIAYVGTVPGLSFMITGLAGGLST
CRCB_SHEDO      --LLFVALGGSIGAVLRYLMSIIMIGSSFPFGTLLVNVLGSFFMGIVYSHV-SPELKXXXXXXXXXXXTT
CRCB2_LACS1     -----------LGTLISVFFFRYLLSLKLATGTILVNLIGSFCLAFLYYVIERQKLPAWLSTGLVGAFTT
CRCB1_METBF     -----------IGACLRYTVSQVPRIKNIPAGTLTVNLLGTIVLAFLTFSSEPQSMVYLVNIGILGSFTT
CRCB_METSB      MDYLWIMIGSALGGAARFWVTGFQTGGIFPWGTVLINVSGSFLIGFFGSFVVGESARLFVMIGLCGGFTT
CRCB_ANASK      LLLVCLGGALGSGA--RYLTSAWALRADFPRGTLLVNVSGSFLLGIMTASLQSEAVRLFLAAGVMGGFTT
CRCB_VIBCM      -ILGFIALGGAVGACARFLVSEICVTRGFPIGTLTVNVVGSFIMGVLIACVENEWLKQVIGLGFLGALTT
CRCB_VIBCH      -ILGFIALGGAVGACARFLVSEICVTRGFPIGTLTVNVVGSFIMGVLIACVENEWLKQVIGLGFLGALTT
CRCB_VIBC3      -ILGFIALGGAVGACARFLVSEICVTRGFPIGTLTVNVVGSFIMGVLIACVENEWLKQVIGLGFLGALTT
CRCB_PSEA7      ----------------------------IPPGTLLANLVXXXXXXXXXXXXXXXEWRLLIITGFCGGLTT
CRCB_METRJ      ---ILVMIGGALGTLARYVVSVLSLSRDLPWGTILINVTGSFIIGLFGRFPVSENVRLFVMIGLCGGYTT
CRCB_ACIF5      ----FIALFAVLGAWARYGQTLLVQAAGFPWATLSINVLGCFLMGLFFETLESPELRTGMLTGGLGAYTT
CRCB_ACIF2      ----FIALFAVLGAWARYGQTLLVQAAGFPWATLSINVLGCFLMGLFFETLESPELRTGMLTGGLGAYTT
CRCB1_BRUSU     -----------------------------PLDILVANVVACFLLGLYARKIHSRDVHTIIGMGMMGGVST
CRCB_SHESH      --ILFVALGGSIGAVFRYLLSIFMLGSAFPFGTLLVNVIGSFLMGTIYALGQSPEIKXXXXXXXXXXXTT
CRCB_RHIME      -----------------------------PWGTLFVNVTGSFLIGIMHKMGASPEMRVFLITGVLGGYTT
CRCB2_LISMO     MYFLYVGVFGALGGMCRYAMNLWLGGGDFPSATLAVNLIGCFLLAFLMRFLAEKSRVSLVLLNXXXXXXX
CRCB2_LISMF     MYFLYVGVFGALGGMCRYAMNLWLGGGDFPSATLAVNLIGCFLLAFLMQFLAEKSRISLVILNXXXXXXX
CRCB_SORC5      ----WIGLGGAAGTLARYGLSTWCQGAEFPYGTLAVNVIGSFLLGAIXXXXXXXXXXXXXXXGVMGGFTT
CRCB_ALTMD      ---LYCFIAAGTGACLRYFVTTSVDSKHMPFGTLTVNVVGSFALALLYGVIERYDLRALIGVGLLGAFTT
CRCB_THEM4      MKFILIAIGGAFGALFRYFFNTHFPFNYIPLGTVIVNVLGAFLLSVLFSSIERFEV--------------
CRCB_GEOBB      --LVYIALLGALGCLCRYFLSGFVYGTSFPYGTLAVNLIGAFLIGL------------------------
CRCB3_BRUME     ---LYIAVGCGIGALLR-FLSGWVIVAILPLGTSFVNIVGSFIIMFFATWLVSPALRQFVMGGLCGGLTT
CRCB2_PROMP     ---IYILVGSTFGLIVRMFIKYISGKKKIFYSNLIVNVLASLFLGIFEGNITNKNLILFIFVGFLGCFST
CRCB2_BACLD     ----YVAVFIGIGSLLRYAVNLLGGTAVFPWPTFIENXXXXXXXXXFAARAKKPLVQLCLGTGFCGGYTT
CRCB1_LACAC     -------------------------------GTFWGNIIGCFLLAFFYLFMEFKDVRQWLTTGFVGAFTT
CRCB_ROSS1      --------------------------ASFPYGTLIVNVIGSFAIGFVLVLATTRTARLLIVTGLLGGFTT
CRCB_META3      ----------------------------IPTGTFIVNLIGSFIVGVMYSSTVSPEYRLLIITGFCGALXX
CRCB_ANAD2      LLLVCLGGALGSGA--RYLTSAWALRADFPRGTLLVNVSGSFLLGIMTASLQSEAVRLFLAAGVMGGFTT
CRCB2_STAAC     --IILVMIGGGFGAIARSAITDYFNTSKLPIATLIVNLVGSFLIGLTIGSISTSWFPAXXXXXXXXXXXX
CRCB_POLSQ      MWLSILAIFCGLGALLRTGFNLLSVASVIPLGTLISNMVGGYLIGI------------------------
CRCB_CAMHC      MFYTILCVGTGVGAILRFLFAQFFSQKYIFIATICVNIIGSFIIGFVLNIATT---YAILVTGLLGALTT
CRCB_AERS4      ---LFVAAGGAIGACLRFGISELMAGRHFPYGTLVVNVVGSFIMGIAFGHVVEHPMKPLLMVGILGALTT
CRCB2_MYCTU     ----------GIGSVLRFLVDRSRLARTFPYGTLTVNITXXXXXXXXXXXXXPKDAALLAGTGFVGAYTT
CRCB2_MYCBO     ----------GIGSVLRFLVDRSRLARTFPYGTLTVNITXXXXXXXXXXXXXPKDAALLAGTGFVGAYTT
CRCB1_RHOPB     ---LYALIAAGIGGCARYLVGVAQLSTDFPWATLFVNVTGSFVIG-FYAAIASSRQRQFVMTGICGGYTT
CRCB1_NITHX     ---------------------------KFPWGTLFINITGSLLIGLFWNLPQAVRIFLIV--GICGGYTT
CRCB_OCHA4      -----VALGGAIGSVARYWLALLMLSRELPWGTIVINIAGSFAISFFQGRFPIPEIWRLFMVGVCGGFTT
CRCB_CHRSD      ----------------------------LPPGTLAANWLGAWLIGIAIALFASPEWRLFVVTGFLGALTT
CRCB4_BRUSU     ---LYIAVGCGIGALLR-FLSGWVIVAILPLGTSFVNIVGSFIIMFFATLTGPEGRWLVVMGGLCGGLTT
CRCB3_BRUAB     ---LYIAVGCGIGALLR-FLSGWVIVAILPLGTSFVNIVGSFIIMFFATLTGPEGRWLVVMGGLCGGLTT
CRCB_PYRHO      ----------------RYYISGVLPVYKFPIGTLIVNSLASFLLGYIYGLLISPEWRIFLGTGFCGGXXX
CRCB_PSEPW      ----------------------------------------------------SPEWRLLLITGFCGGLTT
CRCB_PSEPK      ------------------------------------------------------ELRAGLIVGFLGGLTT
CRCB_PSEPG      ------------------------------------------------------ELRAGLIVGFLGGLTT
CRCB_PSEP1      ------------------------------------------------------ELRAGLIVGFLGGLTT
CRCB_NITWN      ---------------------------KFPWGTLFINVTGSLLIGIFWSLPQAARIF--LVVGICGGYTT
CRCB_GEOSM      --LVYIALLGALGCLCRYFLSGLVYGTSFPYGTLAVNLIGAFLIGL------------------------
CRCB_BURS3      --IVAIFVGAGLGALLRWFLSALNEFPAVPLGTLAANLIGGYVIGI------------------------
CRCB_ALISL      -----------------------------PYGTLTVNIVGSLIMGVLMSSIEAAPCRPIIGLGFLGALTT
CRCB2_CARHZ     ----YFAVALGFGAIAREITGRALGTSIFPVGTLAINLSGSXXXXXXXXXXXSDPVRLGLTSGFLGAYTT
CRCB1_BRUME     -----------------------------PLGTFLINISGAFVIGVDWHDRYGTMLNAGVLTGILGGYTT
YI7B_SCHPO      -------------ALTRLYLARFLNSPQIPYGTLCANVFATLLLSIMYMIPQSRSVMYGIQNGFCAVLST
CRCB_XANC5      -----------------------------PWGTLTVNLLGSFVAGVLLVWLDARPLRALLIVGVIGGLTT
CRCB_XANAC      -----------------------------PWGTLTVNLLGSFVAGVLLVWLDARPLRALLIVGVIGGLTT
CRCB_SERP5      -------IGGGMGSVLRWAISMKMNPAHIPLGTLAVNXXXXXXXXXXXTHLDPTWKL-LITTGFCGGLTT
CRCB_BURCJ      --IVAIFVGAGLGALLRWCLSLTLNAPAVPLGTLAANLLGGYVIGV------------------------
CRCB_ANADE      LLLVCLGGALGSGA--RYLTSAWALRADFPRGTLLVNVSGSFLLGIMTASLQSEDLRLFLAAGVMGGFTT
CRCB2_BACSK     --MMYVIIGGAVGACLRFAVSKFGKNAQLMTAVFVINISGCAMLG-WILAKPLPEGIELLFISMLGGFTT
CRCB1_BACSK     -----------------------------PWGIFTANLGGCFLLGFLTPILQLKKSIPLITVGLIGGFTT
CRCB_RHILW      -----VAVGGAIGSLLRYYVGQWTMGPAFPWGTLAVNVVGCFVIGVF-----------------------
CRCB_RHIL3      ---ILVAFGGAIGSVLRYYVGQWAMGSAFPWGTLAVNVVGCFVIGVFAELIARK----------------
CRCB_RHIEC      -----VAVGGAIGSVLRYFVGQWAMGPAFPWGTLAVNVVGCFVIGVFAELVTRK----------------
CRCB_BURVG      --IVAIFVGAGLGAVLRWFLGLALNAPAMPLGTLAANLLGGYAIGI------------------------
CRCB2_MYCPA     -VWVGVALIGGVGSVLRFVVDGARRASRFPLGTLVVNXXXXXXXXXXXXXXXXREAALLAGTAFVGAYTT
CRCB2_LISIN     MYFLYVGIFGALGGMCRYAMNLWLGGGDFPSATLAVNLIGCFLLAFIMPFLAEKSRISLVLLNXXXXXXX
CRCB2_BRAJA     --VIAIVVGSVLGGCARYFISARRLGETFPWGTMTINVTGAFLIGIFGSMFASPNPWLFAVTGFLGCYTT
CRCB1_BIFLO     ----------GLGAMARYVWNRENRRTNFPLSTLVINGVASLCAGIYYSQSVDMDTVMMFVVGFLGGFST
CRCB_VIBPA      -----------------------------PYGTLTVNVVGSFIMGLFENEILATEPWRVIGLGFLGALTT
CRCB_THET8      -----------------------------PWSTLFVNALGSFLIGLTLRGALSGEARLFLAVGVLGGFTT
CRCB_THET2      -----------------------------PWSTLFVNALGSFLIGLTLRGALSGEARLFLAVGVLGGFTT
CRCB_LEGPL      VVAPYLAVAIGLGAMSRYLVTIMAQNAKFPYGTLLVNTLGSFLAGFF-----------------------
CRCB_LEGPH      VVAPYLAVAIGLGAMSRYLVTIMAQNAKFPYGTLLVNTLGSFLAGFF-----------------------
CRCB_LEGPC      VVAPYLAVAIGLGAMSRYLVTIMAQNAKFPYGTLLVNTLGSFLAGFF-----------------------
CRCB_LEGPA      VVAPYLAVAIGLGAMSRYLVTIMAQNAKFPYGTLLVNTLGSFLAGFF-----------------------
CRCB_ELUMP      -----------VGSVMRYLMAVVLASASLPYATLAVNVLGSFMIG-FLSQPFSANPYGRLMVGVLGGFTT
CRCB_CAMLR      MIGTILAVGFGLGAISRMLTSSFFNKHDFPYGTLLVNIIGSFLMGLFFSYASSKGVH-------------
CRCB2_YERPS     --VMWVGLGGGIGSLLRWWIGLSIYKGNFPLGTFLINISGAFVIGYILFSVDWRDRYAAVLTGILGGYTT
CRCB_CYTH3      -----------------------------------------------------------LATGLCGGFTT
CRCB2_METHJ     --LILVGIGGAVGAMLRFELSKLRPVRSIPLGTALVNIIGSSLFGCVVFSRSPGDIFYLVDVGILGG---
CRCB1_BRAJA     MLYAWVSAGSVVGGLTRYLVGALDTGPGFPFATLFINATGSLIIGFYATMLARPEHRQFVMTGFCGGYTT
CRCB_RHOS4      -----------------------------PVGTMIVNVVGSFLMGVLVVVLAHKNRYAFLMTGMLGGFTT
CRCB_RHOS1      -----------------------------PVGTMIVNVVGSFLMGVLVVVLAHKNRYAFLMTGMLGGFTT
CRCB_MAGSA      -MLTYALVALGIGGTLRYWLSMVASAGTFPWATLVINVAGSAAIGLFLTSVDGREWRTFFMVGICGGFTT
CRCB_VIBVY      -----------------------------PYGTLTVNVVGSFIMGLLIAAFESELLATIIGLGFLGALTT
CRCB_VIBVU      -----------------------------PYGTLTVNVVGSFIMGLLIAAFESELLATIIGLGFLGALTT
CRCB_METMP      ----------------------------IPTGTLIVNLLGSFIIGLIYSSLLSTEYRLFIITGFCGAL--
CRCB3_YERPE     --VMWVGLGGGIGSLLRWWIGLSIYKGNFPLGTFLINISGAFVIGYILFSVDWRDRYGDLLTGILGGYTT
CRCB2_PROAC     MTMLWVCLAGGLGAVARFLLSRINSSVPVPLGTLVINVMGSLLLGL------------------------
CRCB2_NOCFA     ----------------------------VPWATFVVNVTGCFAIGVLMVLVEAWVTHRLLGVGLLGGFTT
CRCB_SILPO      ----YLAVFAGIGSVLRELLGFQLPGLSFLTATFGINIAACFLLGWLYAIXXXXXXXXXXAVGFCGGLST
CRCB_DESDA      --LALISIGASCGAILRWFLGLMLNAIFLPLGTLAANLLGGYLIGV------------------------
CRCB_AQUAE      -VVFAVALGGAIGSALRFLLSKVVQEHSFPVGTLFVNLVGAFFIGFFFAYLVDK----------------
CRCB2_BRUSU     -----------------------------PLGTFLINISGAFVIGVDWHDRYGTMLNAGVLTGILGGYTT
CRCB_VIBHB      -----------------------------PYGTLTVNVVGSFIMGLLIAAFETELMVTIIGLGFLGALTT
CRCB_SILST      MLITVLNVALGIGASCRYLIGRALGPTGFPVGVLGVNILGSALMGAFVAHKGLTHLSPFVMTGVLGGFTT
CRCB_RHIE6      -----VALGGAIGSVLRYYVGQWAMGPAFPWGTLAVNVVGCFVIGVF-----------------------
CRCB_OPITP      -----------------------------PWGTLVVNVVGSFIIGFFATLTAPEGRMLVVMTGVLGGFTT
CRCB_MESSB      -----------------------------PWGTLAVNVAGSFAMGLLVEALARKEIRLLLAPGMLGGFTT
CRCB_LEPIC      --LLLIAFGGAIGSIFRYLLQYWFGGYSLPWGTLTANLLGSFLIGVVY----------------------
CRCB2_RUBXD     -----------------------------PWGTLAANAAGSFLIAIFFERFVGERARAFWVLGFLGSLTT
CRCB2_RHOPB     --LLFVALGSVFGGMARFWLSGMRIGETFPWGTLTVNVSGAFAIGVFHGVFSTPGPWLFAVTGFLGCYTT
CRCB1_NATPD     -----------------------------PWGTLVVNVAGAFLLGAIVYGTEPESTRLVVATGFLSSFTT
CRCB_RHOPS      MTYLLVFLGGGLGAMFRHFINTVSGGTAFPYHTFFINVSGSLVMGLIAGYFSSQHVRLFLMTGILGGYTT
CRCB_METVS      ----YFLIGIGTGAVLRYVISGIIPVKGIPTGTLMVNLIGSFIVGLMYSSLISYEYRLFIITGFCG----
CRCB_JANSC      -----------------------------PLPILTVNVLGSFLMGVFVAHRGLTHLSPLVMTGLLGGFTT
CRCB_BURP8      MYLSILAVGIGLGSLFRWFLGLRLNAPALPLGTLASNXXXXXXXXXXXNPQIAPEWRLFIITGLMGGLST
CRCB_RHOPA      MAYLLVFVGGGLGAMFRHFINTLSGGTAFPYHTFFINVTGSIVMGLIAGYLSSQHFRLFLMTGILGGYTT
CRCB_LEPIN      --------------LLQYWFGNVLGYS-LPWGTLTANLLGSFLIGVVY----------------------
CRCB2_DEIGD     -----------------------------PLATLLVNVLGSFLLAFILRGLVSPAWRLAVGTGFIGALTT
CRCB_MAGSM      MQIAWVALGGAIGAVARYVLSNAVYARAFPWGTLSVNLLGSFIMGLLF----------------------
CRCB_WOLSU      --LLAIFVGAGFGALLRWFLGKLNALAPLPLGTLGANWLGGYLIGL------------------------
CRCB_OCEIH      -----------IGANLRYWLGEWSSSSGFPTGTFVINAIGCFLLGWLLTYSEKNRL--------------
CRCB_NITSB      --------------------------SLFPVGTLTVNVLGSFIIGFLYMYFEQNPIYAMFITGFLG----
CRCB_NEIMB      --IIPLSIGAALGATARWLLNLAVPASIPPAGNLFANWIGAFLIGIFVNHPQWK----------------
CRCB_GLUOX      -----------LGTLARYLVSVAAMPISIPWGTILPNALGSFVIGFFGTYPVSENMRLFVMIGLCGGYTT
CRCB1_PROAC     -----------------------SRADGVPWGTLAINLVGAFVLATLLDRGVRRAVRLCIGTGLLGGFTT
CRCB_NITOC      --LAWIALAGAGGTLSRYALSGLVQGASFPWGTWVVNGLGCFLFGMIWALAEER----LLITG-------
CRCB_NEIMA      --IIPLSIGAALGATARWLLNLAVPASLSPAGNLFANWTGAFLIGIFVNHPQWK----------------
CRCB_HYPNA      ----------------------------------------------------SQEARLFLATGVLGGFTT
CRCB_ERWT9      ----------------------------------------------------------LITTGLCGGMTT
CRCB2_PROMM     ---------------------------------LLVNVIGAAILGLVVGLPFRPSRQLLLGVGFCGSLTT
CRCB1_BACSU     ----------------------------LPIGILTVNILGALGLGIFTGHVANASVSLIIXXXXXXXXXX
CRCB_GEOMG      LTIVAIALFGALGCLARYLLAGWVYARGFPYGTLTVNVVGAFLIGL------------------------
CRCB_PECCP      -------IGGGVGSVARWQLGKFNNLPTLPLGTLLANLIGAFVIG-------------------------
CRCB_METCA      -----------------------------PHGTLFINVSGSFLMGMIQRFALAAEYRAAVLVGFLGAYTT
CRCB_HAEIG      -----LFISCGLGASLRWAIGLFNPLSSFAFGTLIANLFGCLIIGV------------------------
CRCB_GEOSF      --VIFIGIFGALGCLCRYYLSGWVYGRAFPYGTFAVNIIGAFLIGL------------------------
CRCB_ERWCT      -------IGGGVGSVARWQLGKFNSLPTLPLGTLLANLIGAFVIG-------------------------


                         .         .         *         .         .         .         .:140
query           FSTLNDELQRLLSDKKVFYSYLTLTYIGGLVAIFLGILL
CRCB1_STRPN     FSTLNDELQRLLSDKKVFYSYLTLTYIGGLVAIFLGILL
CRCB1_STRR6     FSTLNDELQRLLSDKKVFYSYLILTYLGGLVAIFLGILL
CRCB2_LACJO     FSTLNVELLSHWRDRSVFTLYALLSYGGGLILVFLG---
CRCB2_LACAC     FSTMNTELVELYKSKRGFIFYALSSYLGGLILVFVGYYL
CRCB_FLAPJ      FSAFSNENIQLLQSNQILFLYISLSVFLGLMATWTGLII
CRCB1_STAAW     FSTFQLELIHMFDHQQTLLLYAVTSYVFGILLCYVGIKL
CRCB1_STAAS     FSTFQLELIHMFDHQQTLLLYAVTSYVFGILLCYVGIKL
CRCB1_STAAR     FSTFQLELIHMFDHQQTLLLYAVTSYVFGILLCYVGIKL
CRCB1_STAAN     FSTFQLELIHMFDHQQTLLLYAVTSYVFGILLCYVGIKL
CRCB1_STAAM     FSTFQLELIHMFDHQQTLLLYAVTSYVFGILLCYVGIKL
CRCB1_STAAC     FSTFQLELIHMFDHQQTLLLYAVTSYVFGILLCYVGIKL
CRCB1_STAA8     FSTFQLELIHMFDHQQTLLLYAVTSYVFGILLCYVGIKL
CRCB1_STAHJ     FSTLSYEIVQFISPKPVFFSYSILQFVIGFISCFIG---
CRCB1_STAAB     FSTFQLELIHMFDHQQTLLLYAITSYVFGILLCYVGIKL
CRCB_ACIAD      FSTFSAEVIDLLQQQKYGFALITIHLMGSLLCTVLGLL-
CRCB1_LISIN     FSTFKVESMELKANFQVLFSYVGLTYLCGLIAAFIGIML
CRCB_BACV8      FSTFSNESLQLLKSYPSFFTYIIGSVVLGILGVMLGI--
CRCB1_LISMO     FSTFKVESMELKTNYRVLFSYLGFTYVFGLIAAFLGMML
CRCB1_LISMF     FSTFKVESMELKTNYRVLFSYLGCTYVFGLIAAFLGLML
CRCB_IGNH4      FSTFAADNYILLRSSKYITAFVTAVSVGGIVSVALG---
CRCB_PROA2      FSSYMYEISALLKDGELFYAYLIGSLVGGMVFLYLGMAL
CRCB2_STAS1     FSTFQFELVQFFESGSLLIVYALTSYIFGILLCFLGVRL
CRCB1_GEOKA     FSTLKWESVQMMQQRQKVVVYLAATYLCGVWLAWLG---
CRCB2_STAES     FSTLSSELVNMLSPQFKFVVYSLLQFILGFIACFYG---
CRCB2_STAEQ     FSTLSSELVNMLSPQFKFVVYSLLQFILGFIACFYG---
CRCB_ENT38      FSTFSAEVVFLLQDGRI----------------------
CRCB_CHLPB      FSSYMYEIMSLLRDGEIFYSYLLGSIVGGILCLYFGMQL
CRCB2_BACCR     FSTFKLEAVQLLNRKNIFLLYLSATYIIGILFAFLGMKL
CRCB_CHLPD      FSSYIFENASLLKDGQMLYAYLAGSVIGGFVALYSG---
CRCB1_YERPS     FSTFSVEVVYLIQEGKLTWATILLNVAGSLAMTMLAFIL
CRCB1_YERPE     FSTFSVEVVYLIQEGKLAWATILLNVAGSLAMTMLAFIL
CRCB_HELPJ      FSSYGLDTLKLLQKSQYLISYVLGTNLLGLIGVAIGWFL
CRCB_HAHCH      FSTFSLEAWSLMQSDQLLLAYILMSVILCLFAVSAGIAL
CRCB_HELAH      FSSYGLDTLKLLQKSQYIISYVLGTNILGLIGVAIGWFL
CRCB2_BACAN     FSTFKLESVQLLNRKSTFLLYLSATYIVGILFAFLGMKL
CRCB_HELPH      FSSYGLDTLKLLQKSQYLVSYVLGTNLLGLIGVAIGWFL
CRCB_ESCF3      FSTFSAEVVFLLQEGRFGWAMLNV---------------
CRCB_ECOLU      FSTFSAEVVFLLQEGRLGWALLNV---------------
CRCB_AZOVD      FSSFSLDTLRLLESGQLAFSYLAFSVLGGLLATWAGLIL
CRCB2_BACHK     FSTFKLESVQLLNRKSTFLLYLSATYIVGILFAFLGMKL
CRCB2_BACCZ     FSTFKLESVQLLNRKSTFLLYLSATYIVGILFAFLGMQL
CRCB_SHISS      FSTFSAEVVFLLQEGRFGWALLNV---------------
CRCB_SHIFL      FSTFSAEVVFLLQEGRFGWALLNV---------------
CRCB_SHIF8      FSTFSAEVVFLLQEGRFGWALLNV---------------
CRCB_SHIDS      FSTFSAEVVFLLQEGRFGWALLNV---------------
CRCB_SHIBS      FSTFSAEVVFLLQEGRFGWALLNV---------------
CRCB_SHIB3      FSTFSAEVVFLLQEGRFGWALLNV---------------
CRCB_HELPG      FSSYGLDTLKLLQKSQYIISYVLGTNLLGLIGVAIGWFL
CRCB_ECOUT      FSTFSAEVVFLLQEGRFGWALLNV---------------
CRCB_ECOSM      FSTFSAEVVFLLQEGRFGWALLNV---------------
CRCB_ECOSE      FSTFSAEVVFLLQEGRFGWALLNV---------------
CRCB_ECOLC      FSTFSAEVVFLLQEGRFGWALLNV---------------
CRCB_ECOL6      FSTFSAEVVFLLQEGRFGWALLNV---------------
CRCB_ECOL5      FSTFSAEVVFLLQEGRFGWALLNV---------------
CRCB_ECOHS      FSTFSAEVVFLLQEGRFGWALLNV---------------
CRCB_ECO8A      FSTFSAEVVFLLQEGRFGWALLNV---------------
CRCB_ECO81      FSTFSAEVVFLLQEGRFGWALLNV---------------
CRCB_ECO7I      FSTFSAEVVFLLQEGRFGWTLLNV---------------
CRCB_ECO5E      FSTFSAEVVFLLQEGRFGWALLNV---------------
CRCB_ECO57      FSTFSAEVVFLLQEGRFGWALLNV---------------
CRCB_ECO55      FSTFSAEVVFLLQEGRFGWALLNV---------------
CRCB_ECO27      FSTFSAEVVFLLQEGRFGWALLNV---------------
CRCB_ECO24      FSTFSAEVVFLLQEGRFGWALLNV---------------
CRCB_SALTY      FSTFSAEVVFLLQEGRFGWALLNV---------------
CRCB_SALTI      FSTFSAEVVFLLQEGRFGWALLNV---------------
CRCB_SALSV      FSTFSAEVVFLLQEGRFGWALLNV---------------
CRCB_SALPK      FSTFSAEVVFLLQEGRFGWALLNV---------------
CRCB_SALPC      FSTFSAEVVFLLQEGRFGWALLNV---------------
CRCB_SALPB      FSTFSAEVVFLLQEGRFGWALLNV---------------
CRCB_SALPA      FSTFSAEVVFLLQEGRFGWALLNV---------------
CRCB_SALNS      FSTFSAEVVFLLQEGRFGWALLNV---------------
CRCB_SALHS      FSTFSAEVVFLLQEGRFGWALLNV---------------
CRCB_SALG2      FSTFSAEVVFLLQEGRFGWALLNV---------------
CRCB_SALEP      FSTFSAEVVFLLQEGRFGWALLNV---------------
CRCB_SALDC      FSTFSAEVVFLLQEGRFGWALLNV---------------
CRCB_SALCH      FSTFSAEVVFLLQEGRFGWALLNV---------------
CRCB_SALAR      FSTFSAEVVFLLQEGRFGWALLNV---------------
CRCB_SALA4      FSTFSAEVVFLLQEGRFGWALLNV---------------
CRCB_CHLCH      FSSYMIEHSALLRDGEHLYAYLFGSLIGGFIALYLGII-
CRCB_PELLD      FSSYMFEGATLARDGELFYLYLAGSIVGGFVALYTGII-
CRCB_BACFR      FSTLNDSLSLL---KGGFYGIFT----------------
CRCB_BACFN      FSTLNDSLSLL---KGGFYGIFT----------------
CRCB2_BACC1     FSTFKLESIQLFNRKSILFLYLSATYIIGILFAFLGMQL
CRCB_PSEYM      FSTFSAETVALIQEGRLLWALISLHVVGSLAMTAAGLL-
CRCB_HELPS      FSSYGLDTLKLLQKSQYIVSYALGTNILGLIGVAIGWFL
CRCB_ACIBY      FSTFSIEIVTLLQSGKWGMAMLAISLIGSLIFTCLGL--
CRCB_ACIBT      FSTFSIEIVTLLQSGKWGMAMLAISLIGSLIFTCLGL--
CRCB_ACIBS      FSTFSIEIVTLLQSGKWGMAMLAISLIGSLIFTCLGL--
CRCB_ACIB5      FSTFSIEIVTLLQSGKWGMAMLAISLIGSLIFTCLGL--
CRCB_ACIB3      FSTFSIEIVTLLQSGKWGMAMLAISLIGSLIFTCLGL--
CRCB_HELPY      FSSYGLDTLKLLQKSQYIVSYALGTNILGLTGVAIGWFL
CRCB2_LACDA     FSTLNTEMVSLAENKHVLKHYLLASYLGGAVLLTCGYYL
CRCB_PSEF5      FSSFSLDTVRLLESGQVALAYAALSVFGGLLATWAGLSL
CRCB1_STAS1     FSTLSSELVKLLTTPKLFILYSILQYGVSFVACLLGYYL
CRCB1_MOOTA     FSTFSVETLHLLQGEKIPLAYLFASLAGGLICMQTGIFL
CRCB_SHESR      FSTFSNETLLLMQE-------------------------
CRCB_SHESM      FSTFSNETLLLMQE-------------------------
CRCB_SHESA      FSTFSNETLLLMQE-------------------------
CRCB_DESAH      FSAFILETGMLVRSTEWIYGIVNLLLQNGFGALMAGIVL
CRCB_BURTA      FSTYSVEV-------------------------------
CRCB_SHESW      FSTFSNETLLLLQE-------------------------
CRCB_SHEPC      FSTFSNETLLLLQE-------------------------
CRCB_SHEON      FSTFSNETLLLMQE-------------------------
CRCB1_STAES     FSTFQFELVTLFNQHHLFTIYGVTSYILGILSCYLGV--
CRCB1_STAEQ     FSTFQFELVTLFNQHHLFTIYGVTSYILGILSCYLGV--
CRCB_PSEPF      FSSFSLDTVRLLESGQVALGYAAISVFGGLLATWAGLSL
CRCB_KLEP3      FSTFSAEVVFLLQQGRVSWALLNV---------------
CRCB_HELP2      FSSYGLDTLKLLQKSQYIISYVLGTNILGFIGVAIGWFL
CRCB_ACIBC      FSTFSIEIVTLLQSGKWGMAMLAISLIGSLIFTCLGL--
CRCB1_LACPL     FSTMINELVLLGRNQRVAWEYFGLSLVGGLVMVYLGTLI
CRCB_SHEPW      FSTFSNESLLLMQE-------------------------
CRCB_SHEHH      FSTFSNESLLLMQE-------------------------
CRCB_RHOFD      FSSFSAEVVGMLGQQR-----------------------
CRCB_RENSM      FSS------------------------------------
CRCB_BURP6      FSTYSVEV-------------------------------
CRCB_BURP0      FSTYSVEV-------------------------------
CRCB1_NOCFA     FSTFGYETIRLVTDGAYGYA-------------------
CRCB_PSESM      FSSFSLDTLRLLESGQVALGYAGISVFGGLLATWAGLSL
CRCB_PSEFS      FSSFSLDTLRLLESGQIAFGYLGISVFGGLLATWAGLSL
CRCB_DESMR      FSTFIFESGGLLEDHR-----------------------
CRCB2_BIFLO     MSTLALEGFTAIRDGQVAIAYLLVTFALGLVCASAGV--
CRCB_PSE14      FSSFSLDTLRLLESGQVALGYAGISVFGGLLATWVGLSL
CRCB_BURPS      FSTYSVEV-------------------------------
CRCB_BURMS      FSTYSVEV-------------------------------
CRCB_BURMA      FSTYSVEV-------------------------------
CRCB_BURM9      FSTYSVEV-------------------------------
CRCB_BURM7      FSTYSVEV-------------------------------
CRCB3_METBF     LSTFGYESFRLLDDSKLMLMSINVTVLFSMMAVYLG---
CRCB_SHEPA      FSTFSNETLLLM---------------------------
CRCB_METJA      FSTFSYETFVLVDEGLLFKALLNINVVGCLIMVYFGRVL
CRCB_ACIAC      FSSFSGEVVTMLMQQRFGLAFGTIAHLGGSLAL------
CRCB_METKA      LSTMAYETVELLKASPVLILYLTANVVLGIAAVLGGM--
CRCB_PSEU2      FSSFSLDTLRLLESGQVALGYAGISVFGGLLATWAGLSL
CRCB2_CORDI     WSTLAKELGTLIRQRRMLLGYTTATILGGMVAVWCGL--
CRCB1_METAC     LSTFSYESFRLLESSKLMQLTMNITVLFSIFAVYLG---
CRCB_PSEAB      FSTFSAEVVSLLQEGRLGWAAGAITHVGSLLMTLLGL--
CRCB_PASMU      FSTFSAEVIENLIQQKWLAGLMLASLLGCLLFTALGVFI
CRCB2_CLOAB     FSTFMYEGFNLFENKK-----------------------
CRCB_VARPS      FSSFSAEVVTMLLEGRPGVALLTAAHLGGLFLTWLGI--
CRCB_SULNB      FSTFSLETVTMLQGGGRVVTNITLNVFLCVVATMLGMML
CRCB_GEOLS      FSTFSYETFKLLEDGQFVMAFTNVSVAVCLLCTWLGII-
CRCB_SHEAM      FSTFSNETLLLL---------------------------
CRCB_NITEU      FSTFSAEIVSLLQRGLYAWSAIAVHVAGSLIMTLAGI--
CRCB2_GEOKA     FSTLSVECVELMEQGRFGMAYIAASLFGGLLASWAG---
CRCB_THEP1      FSTFTYETLSLIEERGVAYALVNLLF--AFTCAYFGMIL
CRCB_PSEAE      FSTFSAEVVSLLQEGRLGWAAGAITHVGSLLMTLLGL--
CRCB_PSEA8      FSTFSAEVVSLLQEGRLGWAAGAITHVGSLLMTLLGL--
CRCB_PELPD      FSTFSYETFKLLEDGQYLVAMVNASVVMCLLCTWLGVI-
CRCB2_CORGL     WSTLAKELGQLLNEKKPMLGYLSLTFTLGYSAVFLGMRL
CRCB_METFK      FSAFGLETLVLLREGLVAAAYIVSSIVVGLVLMWLGFEL
CRCB_THEMA      FSTFTYETLSLIEERGVAYALANLLF--AFTCAYFGMIL
CRCB_BACTN      XXXMNENFQ-LIKDDNFFYLYVGLSLFVGFIMLYLGYSL
CRCB_ACIBL      FSS------------------------------------
CRCB_PYRFU      XXXXXXXXXXLIREGEYLTALLNINVLATIFLVFLGFVL
CRCB_MARAV      FSTFSLEMFAALQEGKWGMALVGILVVGSILMTALGFL-
CRCB_DESAD      FSTYMFESTNLI---------------------------
CRCB2_STAHJ     FSTFQFELVTMSQNNSILFIYGLTSYIGGILFCWFGVKL
CRCB_PSEU5      FSSFSLDALRLL---------------------------
CRCB_ANAVT      FSTYALDTFTLLGDRNL----------------------
CRCB_RHILO      FSAFSLDFATLWERGATLFGYALASVIGAIIALFLGLWL
CRCB_DESDG      FSTFIFESVALLNSSQWLFAALNIT--------------
CRCB_COXBN      FSSFSIETFNLIEAGHYFGAALNLSVALCIAGAWLGVLI
CRCB_CHRVO      FSTFSAEVVDLLRQGQLAFAAIAVHVSGSLLMTMAGI--
CRCB_CAMJR      FSTFS--YQNLLLLQSGNYLHFALNIILNLFAAWLGFII
CRCB_CAMJ8      FSTFS--YQNLLLLQSGNYLHFALNIILNLFAAWLGFII
CRCB_ANASP      FSTYALDTFTLLGDRNL----------------------
CRCB2_BRUME     FSS------------------------------------
CRCB1_BRUAB     FSS------------------------------------
CRCB_SULDN      YSTFAIESFLLLN--------------------------
CRCB_DEHSC      FSTFSYETLDCFKNGDYFFSNILANVLLGLLMVFIGAYL
CRCB_DEHSB      FSTFSYETLDCFKNGDYFFSNILANVLLGLLMVFIGAYL
CRCB_DEHE1      FSTFSYETLDCFKNGDYFFSNILANVLLGLLMVFIGAYL
CRCB3_METAC     FSTFAYETFRLLEDGQNISFFLN---------IFLNVML
CRCB1_CLOAB     FSTMCKETIILMNKNLYFFCYVTVSVVFGLLFAYFGAL-
CRCB_ECOLI      FSTFSAEVVFLLQEGRFGWALLNV---------------
CRCB_ECOBW      FSTFSAEVVFLLQEGRFGWALLNV---------------
CRCB_AGRT5      FSSFSLDAVSLFERGALGLSYILASLVVSIAAVFAGLAL
CRCB3_YERPS     FSSFAVEMMKNPTEVLVSICYLVASLIVGFIAVELGLMI
CRCB2_YERPE     FSSFAVEMMKNPTEVLVSICYLVASLIVGFIAVELGLMI
CRCB2_DESHY     ---------------------------------------
CRCB_NITMS      MSSFALDSSNLLENNQ-----------------------
CRCB_COXB1      FSSFSIETFNLI---------------------------
CRCB_SHEFN      FSTFSNETLLLLQE-------------------------
CRCB_CAMJJ      FSTFS--YQNLLLLQSGNYLHFALNIILNLFAAWLGFLI
CRCB_CAMJE      FSTFS--YQNLLLLQSGNYLHFALNIILNLFAAWLGFLI
CRCB2_BRUAB     FSSMQLDAVKLSHKGQLAVFYLVASVLSGLFAAWLGAML
CRCB1_LEIXX     FSTASYEAVRLAQQRQ--YRAALLTGVG-----------
CRCB_SACD2      FSTFSIE--------------------------------
CRCB_PSEHT      FSTFSMDSLLLLQQGHFIKMALNI-ILNVMVCIFMAWL-
CRCB_HYDS0      FSTFTLEGIGLINNLKAFY-YIVGTNVIGFLFVALGRFL
CRCB1_PROMT     FSSWMSHLYKLLNQYKLFLLNSLSIVLMGVLSIALG---
YO390_YEAST     ISTFINEGYKLSFINMLIYYTVSIAISYCLLVITLG---
CRCB_NAUPA      FSTF--AVESFFLFKNALYSYILLNVIGCII--------
CRCB_SYNJB      FSTYELDTFSLWQQHRFATGYWLGSCLFGALAMELGILL
CRCB_SHEWM      FSTFSNETLLLIQSGAWLKAFLNI---------------
CRCB_SHEB9      FSTFSNETLLLLQE-------------------------
CRCB_SHEB8      FSTFSNETLLLLQE-------------------------
CRCB_HAES2      FSAFSAEIENLLQHK--WLEGITITSLHILGCLFFTTL-
CRCB_HAES1      FSAFSAEIENLLQHK--WLEGITITSLHILGCLFFTTL-
YP279_YEAST     ISTFINEGYKLSFINMLIYYTVSIGISYCLLVITLG---
CRCB_SHELP      FSTFSNETLLLM---------------------------
CRCB_SHEB5      FSTFSNETLLLLQE-------------------------
CRCB_SHEB2      FSTFSNETLLLLQE-------------------------
CRCB_NEIG2      LSGFSLETVTLLQSNRSALANIFLHTAGSLLLTWLGL--
CRCB_NEIG1      LSGFSLETVTLLQSNRSALANIFLHTAGSLLLTWLGL--
CRCB_ACIC5      FSTFEYETLRAAQHGQMGTAVL---YFGGILAVWLGMVV
CRCB1_METMA     FSTFAYETFKLLEDGQNVSFFLN---------IFLNVIL
CRCB1_LACDA     FSSFNLDAFKLLLGGQNFGALLYFT--GTIAAGFL----
CRCB_SULSY      LSSITYETLSIVMDGDYVRALLNIALNFGLLSAFAGIVL
CRCB_SOLUE      FSSFEWE--------------------------------
CRCB_SALRD      ---------------------------------------
CRCB1_LACS1     XXXXQVELVTLVNNRKMMIIYLLLTVICGILAAYCG---
CRCB_XANOR      FSTFTAELFSLLREGRL----------------------
CRCB_XANOM      FSTFTAELFSLLREGRL----------------------
CRCB_SHEDO      FSTFSNETLLLMQQGYWFKSLINV---------------
CRCB2_LACS1     FSTFTVDILGLSTFTDATF-YLLISVVGGFLLAYTGMIL
CRCB1_METBF     FSTFAYETFKLLEEGQNFSFFLNI---------------
CRCB_METSB      FSSFSLQTLNLMRQGEMIRANIALSVVFCLLAVWLG---
CRCB_ANASK      YSSFNYETLALVEQGRXXXXXXXXTVVGCLVAAFAATLL
CRCB_VIBCM      FSTFS----------------------------------
CRCB_VIBCH      FSTFS----------------------------------
CRCB_VIBC3      FSTFS----------------------------------
CRCB_PSEA7      FSTFSAEVVTLLQEGRLGWAAGAITHVGGLLMTLLGL--
CRCB_METRJ      FSSFS----------------------------------
CRCB_ACIF5      FSTFSLETLVLFENKGLLYMFTSL---------------
CRCB_ACIF2      FSTFSLETLVLFENKGLLYMFTSL---------------
CRCB1_BRUSU     FSS------------------------------------
CRCB_SHESH      FSTFSNETLLLI---------------------------
CRCB_RHIME      FSAFSLDAIALLEHGQTMLAYIVASVGLSMLAVFAGLAL
CRCB2_LISMO     XXXXXDTIQLVQSGAWLFVSYVLASFIGGLIMVKFGRML
CRCB2_LISMF     XXXXXDTIQLVQSGAWLFVSYVLASFIGGLIMVKFGRML
CRCB_SORC5      YSSFNNETIRLIEYKSAGLANIAITLVVCLLAGVLGMVV
CRCB_ALTMD      FSTFS----------------------------------
CRCB_THEM4      ---------------------------------------
CRCB_GEOBB      ---------------------------------------
CRCB3_BRUME     FSSMSDTFLLVLHGNAAF----ALAYLCGLVFLSL----
CRCB2_PROMP     FSSFIYQLFNLIREKK--YLILLIYYAEVILLSFL----
CRCB2_BACLD     MSAFSKETVLLLSAAHIGVLYLMASLACGVCFAFLGIVI
CRCB1_LACAC     FSTFNDVLKNIQANVPIALIYFLSSIIFGFCFAYLGM--
CRCB_ROSS1      FSSLSFETYTLVTSGSWMAAYVLSSFGLGIAGVFLG---
CRCB_META3      XXXXXXXXXXLIENNEKFLTNIFINVMGCLIMIYVGRIM
CRCB_ANAD2      YSSFNYETLALVEQGRXXXXXXXXTVLGCLAAAFAATLL
CRCB2_STAAC     XXXXAKELTLMMTPKNLFLNYSLLQFIIGFIACYIG---
CRCB_POLSQ      ---------------------------------------
CRCB_CAMHC      FSTFTYENAVFLNHGEISKFFLNIT--------------
CRCB_AERS4      FSS------------------------------------
CRCB2_MYCTU     FSTWMLETQRLGEDRQM----------------------
CRCB2_MYCBO     FSTWMLETQRLGEDRQM----------------------
CRCB1_RHOPB     FSGFSLETFQLLRTGHALAALINLSPMSWLVAVWLGHLV
CRCB1_NITHX     FSTFSLDSFYLIERGEVAAAYMIASVVLSVGALIAGI--
CRCB_OCHA4      FSSFSLQTMDLLQPGKALFN-IGFSVVLCLIAVWLGLL-
CRCB_CHRSD      FSTFSAEM-------------------------------
CRCB4_BRUSU     FSSMSDTFLLVLHGNAAF----ALAYLCGLVFLSL----
CRCB3_BRUAB     FSSMSDTFLLVLHGNAAF----ALAYLCGLVFLSL----
CRCB_PYRHO      XXXXXXXXXXXXREGEIWLAFITTNILVTIFLVFLGFIL
CRCB_PSEPW      FSTFSAEVVSLIQEGRILWALIALHVSGSLLMTAAGL--
CRCB_PSEPK      FSSFSLDTVRLMESGQVALGYTSISVVGGLLATWAGLSL
CRCB_PSEPG      FSSFSLDTVRLMESGQVALGYTSISVVGGLLATWAGLSL
CRCB_PSEP1      FSSFSLDTVRLMESGQVALGYTSISVVGGLLATWAGLSL
CRCB_NITWN      FSTFSLDTFYLIERGEMASA---AAYMIGSVVLSVGALI
CRCB_GEOSM      ---------------------------------------
CRCB_BURS3      ---------------------------------------
CRCB_ALISL      FSTFSMDNVILMQQGEVIKAGLNLNVTLSITACFIGFQL
CRCB2_CARHZ     FSTMTKEIYLLLFQSKL----------------------
CRCB1_BRUME     FSSMQLDAVKLSHKGQLAVFYLVASVLSGLFAAWLGAML
YI7B_SCHPO      LSTFSNELHTMPIKRAYIYCIISV---------------
CRCB_XANC5      FSSL-----------------------------------
CRCB_XANAC      FSSL-----------------------------------
CRCB_SERP5      FSTFSLEVVYLLQDGRFMWXXXXXXXXGSLVMTLLAFML
CRCB_BURCJ      ---------------------------------------
CRCB_ANADE      YSSFNYETLALL---------------------------
CRCB2_BACSK     FSTFCMEALELLKKRKQAMIYLVISIVGSLFGFLFG---
CRCB1_BACSK     MSTFAADTIAMLQNGHLLGGYLLATVTGGMGFVALGFVL
CRCB_RHILW      ---------------------------------------
CRCB_RHIL3      ---------------------------------------
CRCB_RHIEC      ---------------------------------------
CRCB_BURVG      ---------------------------------------
CRCB2_MYCPA     FSTWMLETQRLGEERRAALANIVVSVVLGGAAAFIG---
CRCB2_LISIN     XXXXXDTIELLQQGEVVLISYILVSLIGGLVMVKFG---
CRCB2_BRAJA     VSSFSLQTLTLARNGEPMHALGNVAFSVGLAAVSCGFLL
CRCB1_BIFLO     FSTALNEVVSLIRQRR-----------------------
CRCB_VIBPA      FSTFSMD-NVLLMQQGAFFKMILLNVVLSISAAWIGFQL
CRCB_THET8      FSSLSYETLALLQGGEV----------------------
CRCB_THET2      FSSLSYETLALLQGGEV----------------------
CRCB_LEGPL      ---------------------------------------
CRCB_LEGPH      ---------------------------------------
CRCB_LEGPC      ---------------------------------------
CRCB_LEGPA      ---------------------------------------
CRCB_ELUMP      FSTFSNETLLLYNNGQFIFA-------------------
CRCB_CAMLR      ---------------------------------------
CRCB2_YERPS     FSSMQLDAAKL----------------------------
CRCB_CYTH3      FSAFAYENILLLQNGN--YTAFTVNTLGGFTAVFLGVML
CRCB2_METHJ     ---------------------------------------
CRCB1_BRAJA     FSAFSLETFRLFHGG---MKYIALAY-------------
CRCB_RHOS4      FSAFS----------------------------------
CRCB_RHOS1      FSAFS----------------------------------
CRCB_MAGSA      FSSFSLQTLALAQD-------------------------
CRCB_VIBVY      FSTFS----------------------------------
CRCB_VIBVU      FSTFS----------------------------------
CRCB_METMP      ---------------------------------------
CRCB3_YERPE     FSSMQLDAAKL----------------------------
CRCB2_PROAC     ---------------------------------------
CRCB2_NOCFA     FSTYGLEIRTLLESGAV----------------------
CRCB_SILPO      FSSFVLELDQL----------------------------
CRCB_DESDA      ---------------------------------------
CRCB_AQUAE      ---------------------------------------
CRCB2_BRUSU     FSSMQLDAVKLSHKGQLAVFYLVASVLSGLFAAWLDAML
CRCB_VIBHB      FSTFS----------------------------------
CRCB_SILST      FSAFSLE--------------------------------
CRCB_RHIE6      ---------------------------------------
CRCB_OPITP      FSSFSLQTLNLLRD-------------------------
CRCB_MESSB      FSAFSLDVAVLRGXXXXXXXXXXXXXXGSILALFVGLWL
CRCB_LEPIC      ---------------------------------------
CRCB2_RUBXD     FSS------------------------------------
CRCB2_RHOPB     VSSFALQTLALARDGESLISNVTFSLVFCLIAVALG---
CRCB1_NATPD     YSTFAGE--------------------------------
CRCB_RHOPS      FSAFS----------------------------------
CRCB_METVS      ---------------------------------------
CRCB_JANSC      FSAFSLE--------------------------------
CRCB_BURP8      FSTFSAEVVQHLQQGRLNWAEIAIHVTASVIATVLGI--
CRCB_RHOPA      FSAFS----------------------------------
CRCB_LEPIN      ---------------------------------------
CRCB2_DEIGD     FSTFAWESDLMVRD-------------------------
CRCB_MAGSM      ---------------------------------------
CRCB_WOLSU      ---------------------------------------
CRCB_OCEIH      ---------------------------------------
CRCB_NITSB      ---------------------------------------
CRCB_NEIMB      ---------------------------------------
CRCB_GLUOX      FSSFS----------------------------------
CRCB1_PROAC     YSALTVEAQRVMSGQWLWGIAYLLTSVGALLA-------
CRCB_NITOC      ---------------------------------------
CRCB_NEIMA      ---------------------------------------
CRCB_HYPNA      FSAFSLEVATMLRSGETLKAYAGVSVLLGVSALFIGL--
CRCB_ERWT9      FSTFSLEVVTLLQAGNYLWAVISLTHVTG----------
CRCB2_PROMM     FSSWMVECSTLIS--------------------------
CRCB1_BACSU     XXXXXVETIQLLMAKRVKESYIVLTLCGSLFAFWCG---
CRCB_GEOMG      ---------------------------------------
CRCB_PECCP      ---------------------------------------
CRCB_METCA      FSTFSLETLALFEE-------------------------
CRCB_HAEIG      ---------------------------------------
CRCB_GEOSF      ---------------------------------------
CRCB_ERWCT      ---------------------------------------