[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for spne4:ACF56127.1

[Show Plain Result]


## Summary of Sequence Search
    1::555
    2::552     e-147  49%  552 aa  Y1689_STAHJ RecName: Full=Uncharacterized protein SH1689;
    2::552     e-146  48%  552 aa  Y1546_STAS1 RecName: Full=Uncharacterized protein SSP1546;
    2::552     e-145  48%  552 aa  Y901_STAES RecName: Full=Uncharacterized protein SE_0901;
    2::552     e-145  48%  552 aa  Y792_STAEQ RecName: Full=Uncharacterized protein SERP0792;
    2::548     e-142  47%  548 aa  Y1240_STAAC RecName: Full=Uncharacterized protein SACOL1240;
    2::548     e-142  47%  548 aa  Y1226_STAAM RecName: Full=Uncharacterized protein SAV1226;
    2::548     e-142  47%  548 aa  Y1193_STAA8 RecName: Full=Uncharacterized protein SAOUHSC_01193;
    2::548     e-142  47%  548 aa  Y1160_STAAS RecName: Full=Uncharacterized protein SAS1160;
    2::548     e-142  47%  548 aa  Y1119_STAA3 RecName: Full=Uncharacterized protein SAUSA300_1119;
    2::548     e-142  47%  548 aa  Y1069_STAAN RecName: Full=Uncharacterized protein SA1069;
    2::548     e-142  47%  548 aa  Y1202_STAAR RecName: Full=Uncharacterized protein SAR1202;
    2::548     e-141  47%  548 aa  Y1109_STAAW RecName: Full=Uncharacterized protein MW1109;
    2::548     e-141  47%  548 aa  Y1090_STAAB RecName: Full=Uncharacterized protein SAB1090;
    1::557     7e-68  33%  557 aa  Y369_MYCGE RecName: Full=Uncharacterized protein MG369;
    1::520     7e-62  33%  558 aa  Y547_MYCPN RecName: Full=Uncharacterized protein MG369 homolog;
  413::578     3e-07  32%  580 aa  DAK1_SCHPO RecName: Full=Dihydroxyacetone kinase 1;       
   23::183     3e-04  23% 1135 aa  VINC_CHICK RecName: Full=Vinculin;AltName: Full=Metavinculin;
   17::191     0.001  23%  192 aa  DHAL_LACLA RecName: Full=PTS-dependent dihydroxyacetone kinase,
    1::555

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSKITTSLFQEMVQAASTRLNKQAEYVNSLNVFPVPDGDTGTNMGMTIENGAKEVADKPASTVGEVASIL
Y1689_STAHJ     ISKINGKLFADMIIQGAQNLSNNADLVDSLNVYPVPDGDTGTNMNLTITSGREEVENNLSQSIGELGKTF
Y1546_STAS1     VSKIDGKLFAEMIIQGAQNLSNHADLVDSLNVYPVPDGDTGTNMNLTMTSGREAVENNLSQQIGELGKTF
Y901_STAES      ISKINGKLFADMIIQGAQNLSNNADLVDSLNVYPVPDGDTGTNMNLTITSGREEVENNLSQNIGELGKTF
Y792_STAEQ      ISKINGKLFADMIIQGAQNLSNNADLVDSLNVYPVPDGDTGTNMNLTITSGREEVENNLSQNIGELGKTF
Y1240_STAAC     ISKINGKLFADMIIQGAQNLSNNADLVDSLNVYPVPDGDTGTNMNLTMTSGREEVENNLSKNIGELGKTF
Y1226_STAAM     ISKINGKLFADMIIQGAQNLSNNADLVDSLNVYPVPDGDTGTNMNLTMTSGREEVENNLSKNIGELGKTF
Y1193_STAA8     ISKINGKLFADMIIQGAQNLSNNADLVDSLNVYPVPDGDTGTNMNLTMTSGREEVENNLSKNIGELGKTF
Y1160_STAAS     ISKINGKLFADMIIQGAQNLSNNADLVDSLNVYPVPDGDTGTNMNLTMTSGREEVENNLSKNIGELGKTF
Y1119_STAA3     ISKINGKLFADMIIQGAQNLSNNADLVDSLNVYPVPDGDTGTNMNLTMTSGREEVENNLSKNIGELGKTF
Y1069_STAAN     ISKINGKLFADMIIQGAQNLSNNADLVDSLNVYPVPDGDTGTNMNLTMTSGREEVENNLSKNIGELGKTF
Y1202_STAAR     ISKINGKLFADMIIQGAQNLSNNADLVDSLNVYPVPDGDTGTNMNLTMTSGREEVENNLSKNIGELGKTF
Y1109_STAAW     ISKINGKLFADMIIQGAQNLSNNADLVDSLNVYPVPDGDTGTNMNLTMTSGREEVENNLSKNIGELGKTF
Y1090_STAAB     ISKINGKLFADMIIQGAQNLSNNADLVDSLNVYPVPDGDTGTNMNLTMTSGREEVENNLSKNIGELGKTF
Y369_MYCGE      MSSVNLSSFIDMLRLGCNNIAKNYEYINQLNVFPVPDGDTGTNMKVTITEAIKKLENEKSKSFSELGKNF
Y547_MYCPN      MSTVNLSNFIDMLRLGCKNIANNFEYINQLNVFPVPDGDTGTNMKVTLSEAFKKLESEISKSFSDLGKSF
DAK1_SCHPO      ------------------------------------DGDCGTTLKRGAEGVLKFVSDDPIRIVRDIADVI
VINC_CHICK      ----------------------------------------------------------------------
DHAL_LACLA      ------------------KIQENKAYLSELDG-PIGDGDHGANMARGMSETMKALEVSNFGNVSEIFKKV


                         .         .         *         .         .         .         .:140
query           AKGLLMGARGNSGVITSQLFRGFSQAIKDKDELTGQDLALAFQSGVEVAYKAVMKPVEGTILTVSRGAAI
Y1689_STAHJ     SKGLLMGARGNSGVILSQLFRGFCKNIETENEINAQQLASSFQAGVDTAYKAVMKPVEGTILTXXXXXXX
Y1546_STAS1     SKGLLMGARGNSGVILSQLFRGFSKSLETYETINAKQFAESFKAGVDTAYKAIMKPVEGTILTVXXXXXX
Y901_STAES      SKGLLMGARGNSGVILSQLFRGFCKNIEEEKEISVQQFAESFQAGVETAYKAVMKPVEGTILTVAKDAAK
Y792_STAEQ      SKGLLMGARGNSGVILSQLFRGFCKNIEGEKEISVQQFAESFQAGVETAYKAVMKPVEGTILTVAKDAAK
Y1240_STAAC     SKGLLMGARGNSGVILSQLFRGFCKNIESESEINSKLLAESFQAGVETAYKAVMKPVEGTILTVXXXXXX
Y1226_STAAM     SKGLLMGARGNSGVILSQLFRGFCKNIESESEINSKLLAESFQAGVETAYKAVMKPVEGTILTVXXXXXX
Y1193_STAA8     SKGLLMGARGNSGVILSQLFRGFCKNIESESEINSKLLAESFQAGVETAYKAVMKPVEGTILTVXXXXXX
Y1160_STAAS     SKGLLMGARGNSGVILSQLFRGFCKNIESESEINSKLLAESFQAGVETAYKAVMKPVEGTILTVXXXXXX
Y1119_STAA3     SKGLLMGARGNSGVILSQLFRGFCKNIESESEINSKLLAESFQAGVETAYKAVMKPVEGTILTVXXXXXX
Y1069_STAAN     SKGLLMGARGNSGVILSQLFRGFCKNIESESEINSKLLAESFQAGVETAYKAVMKPVEGTILTVXXXXXX
Y1202_STAAR     SKGLLMGARGNSGVILSQLFRGFCKNIESESEINSKLLAESFQAGVETAYKAVMKPVEGTILTVXXXXXX
Y1109_STAAW     SKGLLMGARGNSGVILSQLFRGFCKNIESESEINSKLLAESFQAGVETAYKAVMKPVEGTILTVXXXXXX
Y1090_STAAB     SKGLLMGARGNSGVILSQLFRGFCKNIESESEINSKLLAESFQAGVETAYKAVMKPVEGTILTXXXXXXX
Y369_MYCGE      TRDLLLFSRGNSGVIFSQIMKGFFSNISNNSELSIEDVANAFIVAQEVAYKNVSKPVEGTMLTVARLISN
Y547_MYCPN      TRDLLLFSRGNSGVIFSQIMKGFSTKTATETELGIEDFATAFIKAEEVAYKNVSKPVEGTMLTVIRLIST
DAK1_SCHPO      EDNM----DGTSGALYAIFFHGFAKGMKDTLEKSKDISSKTWAAGLKVALDTLFKPGDSTMC----DALV
VINC_CHICK      ----------------------------------------------------------------------
DHAL_LACLA      AMTLMSKVGGASGPLYGSAFLAMS-----KTAIETLDTSELIYAGLEAIQKRGKAQVEKTMVDIWSAFLN


                         +         .         .         .         .         *         .:210
query           GAKKKAEQTDDTVEVMRAALEGAKTALAKTPDMLPVLKEVGVVDSGGQGLVFIYEGFLSALTGEYIASED
Y1689_STAHJ     XXXXXXEETDDCVEVMEYTIAEAEKSLNNTPNLLAVLKEVGVVDSGGKGLLCVYEGFLKGLTGQTIEAK-
Y1546_STAS1     XXIQKAEETDDCIELMAYILEEAEVSLENTPNLLPVLKEVGVVDSGGKGLAIVYAGFLKALKGETISAQ-
Y901_STAES      AAMDYVDQAEDCVDLMAHLIEAASESLDNTPNLLAVLKEVGVVDSGGKGLLCVYEGFLKGLKGEKIEAQ-
Y792_STAEQ      AAMDYVDQAEDCVDLMVHVIEAASESLDNTPNLLAVLKEVGVVDSGGKGLLCVYEGFLKGLKGEKVEAQ-
Y1240_STAAC     XXXXXXNNTEDCIELMEYIIVKANESLENTPNLLAVLKEVGVVDSGGKGLLCVYEGFLKALKGEKVEAK-
Y1226_STAAM     XXXXXXNNTEDCIELMEYIIVKANESLENTPNLLAVLKEVGVVDSGGKGLLCVYEGFLKALKGEKVEAK-
Y1193_STAA8     XXXXXXNNTEDCIELMEYIIVKANESLENTPNLLAVLKEVGVVDSGGKGLLCVYEGFLKALKGEKVEAK-
Y1160_STAAS     XXXXXXNNTEDCIELMEYIIVKANESLENTPNLLAVLKEVGVVDSGGKGLLCVYEGFLKALKGEKVEAK-
Y1119_STAA3     XXXXXXNNTEDCIELMEYIIVKANESLENTPNLLAVLKEVGVVDSGGKGLLCVYEGFLKALKGEKVEAK-
Y1069_STAAN     XXXXXXNNTEDCIELMEYIIVKANESLENTPNLLAVLKEVGVVDSGGKGLLCVYEGFLKALKGEKVEAK-
Y1202_STAAR     XXXXXXNNTEDCIELMEYIIVKANESLENTPNLLAVLKEVGVVDSGGKGLLCVYEGFLKALKGEKVEAK-
Y1109_STAAW     XXXXXXNNTEDCIELMEYIIVKANESLENTPNLLAVLKEVGVVDSGGKGLLCVYEGFLKALKGEKVEAK-
Y1090_STAAB     XXXXXXNNTEDCIELMEYIIVKANESLENTPNLLAVLKEVGVVDSGGKGLLCVYEGFLKALKGEKVEAK-
Y369_MYCGE      EFKSQKNRPKTLEKLFEQAVKVAWQAVKKTPQMLPVLKASGVVDSGAYGFACFLEGMLSYYGGESNLDDN
Y547_MYCPN      DFKNQKNRAKTVQKLFEQVIKTAWQTVKKTPQMLPVLKASGVVDSGAYGFACFLEGMLS-FYGEKATLND
DAK1_SCHPO      PFVETFVKTND----LNAAVEEARKGADATADMQAKLDDVKVPDAGALGVVAIVEGF-------------
VINC_CHICK      ----------------------------------------------------------------------
DHAL_LACLA      DLQTDSASKDNLEKVVKAS-----AGLLATKGRASYLGEIGHIDPGTQSSAYLFETLLEVV---------


                         .         .         .         +         .         .         .:280
query           FVATPANMSEMINVEHHKSVAGHVATEDITFGYCTEIMVALKQGPTYAKDFDYDEFRNYLDELGDSLLVV
Y1689_STAHJ     --KEKLNTEELVHEEH--DFHGVINTEDIKYGYCTEMMVRFGKD---KRAFDEQTFRTDMSQFGDSLLVI
Y1546_STAS1     --SPKLNKESLVNEEH--DFHGVINTEDIVYGYCTEMMVRFGKN---KKTFDEQNFREDMSQFGDSLLVI
Y901_STAES      --APKLDTESFVNDDH--DFHGVINTEDIVYGYCTEMMVRFGKN---KKAFDEQEFRNDMSEFGDSLLVI
Y792_STAEQ      --APKLDTESFVNDDH--DFHGVINTEDIVYGYCTEMMVRFGKN---KKAFDEQEFRNDMSEFGDSLLVI
Y1240_STAAC     --VAKIDKDEFVHDEH--DFHGVINTEDIIYGYCTEMMVRFGKNK---KAFDEQEFRQDMSQFGDSLLVI
Y1226_STAAM     --VAKIDKDEFVHDEH--DFHGVINTEDIIYGYCTEMMVRFGKNK---KAFDEQEFRQDMSQFGDSLLVI
Y1193_STAA8     --VAKIDKDEFVHDEH--DFHGVINTEDIIYGYCTEMMVRFGKNK---KAFDEQEFRQDMSQFGDSLLVI
Y1160_STAAS     --VAKIDKDEFVHDEH--DFHGVINTEDIIYGYCTEMMVRFGKNK---KAFDEQEFRQDMSQFGDSLLVI
Y1119_STAA3     --VAKIDKDEFVHDEH--DFHGVINTEDIIYGYCTEMMVRFGKNK---KAFDEQEFRQDMSQFGDSLLVI
Y1069_STAAN     --VAKIDKDEFVHDEH--DFHGVINTEDIIYGYCTEMMVRFGKNK---KAFDEQEFRQDMSQFGDSLLVI
Y1202_STAAR     --VAKLDKDEFVHDEH--DFHGVINTEDIIYGYCTEMMVRFGKNK---KAFDEQEFRQDMSQFGDSLLVI
Y1109_STAAW     --VAKIDKDEFVHDEH--DFHGVINTEDIIYGYCTEMMVRFGKNK---KAFDEQEFRQDMSQFGDSLLVI
Y1090_STAAB     --VAKLDKDEFVHDEH--DFHGVINTEDIIYGYCTEMMVRFGKNK---KAFDEQEFRQDMSQFGDSLLVI
Y369_MYCGE      TLST-------IEIKFNKFKEQH-ANED-EFGYCTELRLGLKINQTVEKQFHQKKFESKVNRIANSVVIA
Y547_MYCPN      GKLTSAELSQM-------TISGEKHVTEEEFGYCTEYV--LKLGMSVSQEFNQKKFESKVSKIATSVVVA
DAK1_SCHPO      ----------------------------------------------------------------------
VINC_CHICK      ----------------------------------------------------------------------
DHAL_LACLA      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           NDDEIVKVHVHTEDPGLVMQEGLKYGSLVKVKVDNMRNQHEAQVEKEATQVIKSAEEKEYALIAVVAGKG
Y1689_STAHJ     NDDEIVKVHVHTETPGEVFNYGQEYGELIKLKVENMREQHREVIRKEKLNHHSDEQEEETAIIAISMGDG
Y1546_STAS1     NDEEIVKVHVHTEKPGDVFNYGQQYGELIKLKVENMREQHREVVKKEGGKAISTEETQDTAVIAISMGEG
Y901_STAES      NDDEIVKVHVHTEHPGDVFNYGQKYGELIKLKVENMREQHREVIRKEQDGLNKEANESETAIVTISVGDG
Y792_STAEQ      NDDEIVKVHVHTEHPGDVFNYGQKYGELIKLKVENMREQHREVIRKEQDGIQNKATNEETAIVTISVGDG
Y1240_STAAC     NDEEIVKVHVHTEYPGKVFNYGQQYGELIKLKVENMREQHREVIRKEQHTAKPKMETVETAIITISMGEG
Y1226_STAAM     NDEEIVKVHVHTEYPGKVFNYGQQYGELIKLKVENMREQHREVIRKEQHTAKPKMETVETAIITISMGEG
Y1193_STAA8     NDEEIVKVHVHTEYPGKVFNYGQQYGELIKLKVENMREQHREVIRKEQHTAKPKMETVETAIITISMGEG
Y1160_STAAS     NDEEIVKVHVHTEYPGKVFNYGQQYGELIKLKVENMREQHREVIRKEQHTAKPKMETVETAIITISMGEG
Y1119_STAA3     NDEEIVKVHVHTEYPGKVFNYGQQYGELIKLKVENMREQHREVIRKEQHTAKPKMETVETAIITISMGEG
Y1069_STAAN     NDEEIVKVHVHTEYPGKVFNYGQQYGELIKLKVENMREQHREVIRKEQHTAKPKMETVETAIITISMGEG
Y1202_STAAR     NDEEIVKVHVHTEYPGKVFNYGQQYGELIKLKVENMREQHREVIRKEQHTAKPKMETVETAIITISMGEG
Y1109_STAAW     NDEEIVKVHVHTEYPGKVFNYGQQYGELIKLKVENMREQHREVIRKEQHTAKPKMETVETAIITISMGEG
Y1090_STAAB     NDEEIVKVHVHTEYPGKVFNYGQQYGELIKLKVENMREQHREVIRKEQHTAKPKMETVETAIITISMGEG
Y369_MYCGE      SDKDFVKVHAHTLKPHLLLEMGLNYGEFEFVKIDNMNLQVNNKNNSPTKRVLKP------AIVATVPTEA
Y547_MYCPN      SDKDFVKVHAHTEKPXXXXXXXXXXXXXXXVKIENMNLQVAKQKPAPVKRNIKP------AIVVTVPTEA
DAK1_SCHPO      ----------------------------------------------------------------------
VINC_CHICK      ----LVIMHEEGEVDGKAIPDLTAPVSAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKL
DHAL_LACLA      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           LADIFCSQGVDYVIEGGQTMNPSTEDFIKAVEQVNARNIIFLPNNKNXFMAAQSAAEVLEQPAVVVEART
Y1689_STAHJ     ISELFTSMGATHIISGGQTMNPSTEDIVKVIEQSQCKRAIILPNNKNIRMSSDQAATLVEADTVVIPTTS
Y1546_STAS1     ISEIFKSMGATHMISGGQTMNPSTEDIVKIIEQSQCKRAIILPNNKNILMASEQAAEIVEADTIVIPTKS
Y901_STAES      IAELFKSMGATHIISGGQTMNPSTEDIVKVIEQSQCKRAIILPNNKNIMMASEQAASIVEAETVVIPTKS
Y792_STAEQ      IAELFKSMGATHIISGGQTMNPSTEDIVKVIEQSKCKRAIILPNNKNIMMASEQAASIVEAETVVIPTKS
Y1240_STAAC     ISEIFKSMGATHIISGGQTMNPSTEDIVKVIEQSKCKRAIILPNNKNILMASEQAASIVDAEAVVIPTKS
Y1226_STAAM     ISEIFKSMGATHIISGGQTMNPSTEDIVKVIEQSKCKRAIILPNNKNILMASEQAASIVDAEAVVIPTKS
Y1193_STAA8     ISEIFKSMGATHIISGGQTMNPSTEDIVKVIEQSKCKRAIILPNNKNILMASEQAASIVDAEAVVIPTKS
Y1160_STAAS     ISEIFKSMGATHIISGGQTMNPSTEDIVKVIEQSKCKRAIILPNNKNILMASEQAASIVDAEAVVIPTKS
Y1119_STAA3     ISEIFKSMGATHIISGGQTMNPSTEDIVKVIEQSKCKRAIILPNNKNILMASEQAASIVDAEAVVIPTKS
Y1069_STAAN     ISEIFKSMGATHIISGGQTMNPSTEDIVKVIEQSKCKRAIILPNNKNILMASEQAASIVDAEAVVIPTKS
Y1202_STAAR     ISEIFKSMGATHIISGGQTMNPSTEDIVKVIEQSKCKRAIILPNNKNILMASEQAASIVDAEAVVIPTKS
Y1109_STAAW     ISEIFKSMGATHIISGGQTMNPSTEDIVKVIEQSKCKRAIILPNNKNILMASEQAASIVDAEAVVIPTKS
Y1090_STAAB     ISEIFKSMGATHIISGGQTMNPSTEDIVKVIEQSKCKRAIILPNNKNILMASEQAASIVDAEAVVIPTKS
Y369_MYCGE      FAEIREDHDINAILCTDDTGAPSVFSLLEAVKLTNSSNVIFLLHDKNYFLSANETIKQLKHQKIVITANP
Y547_MYCPN      FADIREDYDIQAILCTDDTGAPSVFSLLEAVKLTHSSNIIFLLHDKNYFLSANEALKQLKHQKISADCTT
DAK1_SCHPO      ----------------------------------------------------------------------
VINC_CHICK      VADPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMED--LVTYTKN
DHAL_LACLA      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           LPQGMTSLLAFDPSKSIEENQERMTAALSDVVSGSVTTAVRDTTIDGLEIHENDNLGMVDGKILVSNPDM
Y1689_STAHJ     IPKGIAALFQYDPSSSLEDNHSHMTTALESVKSGSVTFAVRDTKIDGVEIKKGEFMGLSESKIVTSNDDE
Y1546_STAS1     IPQGIAALFNYDETDSLESNKSRMVESLEAVRSGSVTYAVRDTKIDGVEIKKDAFMGLIEDKIVTSHADQ
Y901_STAES      IPQGISALFQYDLESSLEDNKRHMSDALETVQSGSITFAVRDTKIDGIEIKKDEFMGLAEDKIVTSDVNQ
Y792_STAEQ      IPQGISALFQYDQESNLEDNKSHMNDALETVQSGSITFAVRDTKIDGIEIKKDEFMGLAEDKIVISDFNQ
Y1240_STAAC     IPQGISALFQYDVDATLEENKAQMADSVNNVKSGSLTYAVRDTKIDGVEIKKDAFMGLIEDKIVSSQSDQ
Y1226_STAAM     IPQGISALFQYDVDATLEENKAQMADSVNNVKSGSLTYAVRDTKIDGVEIKKDAFMGLIEDKIVSSQSDQ
Y1193_STAA8     IPQGISALFQYDVDATLEENKAQMADSVNNVKSGSLTYAVRDTKIDGVEIKKDAFMGLIEDKIVSSQSDQ
Y1160_STAAS     IPQGISALFQYDVDATLEENKAQMADSVNNVKSGSLTYAVRDTKIDGVEIKKDAFMGLIEDKIVSSQSDQ
Y1119_STAA3     IPQGISALFQYDVDATLEENKAQMADSVNNVKSGSLTYAVRDTKIDGVEIKKDAFMGLIEDKIVSSQSDQ
Y1069_STAAN     IPQGISALFQYDVDATLEENKAQMADSVNNVKSGSLTYAVRDTKIDGVEIKKDAFMGLIEDKIVSSQSDQ
Y1202_STAAR     IPQGISALFQYDVDATLEENKAQMADSVNNVKSGSLTYAVRDTKIDGVEIKKDAFMGLIEDKIVSSQSDQ
Y1109_STAAW     IPQGISALFQCDVDATLEENKAQMADSVNNVKSGSLTYAVRDTKIDGVEIKKDAFMGLIEDKIVSSQSDQ
Y1090_STAAB     IPQGISALFQYDVDATLEENKAQMADSVNNVKSGSLTYAVRDTKIDGVEIKKDAFMGLIEDKIVSSKSDQ
Y369_MYCGE      V-ESIAALTVFNSDLSIHTNVKAMKRFIKEFASATITQASKSYKENKVMVNKNDFIAVTNKSIIASESQL
Y547_MYCPN      NPESLAALTVFNSDLNIHTNVKTMRRFVKGFASATITQASKKYKENRIEVNKGDFIAVANNSICVSEKEL
DAK1_SCHPO      ----------------------------------------------------------------------
VINC_CHICK      LGPGMTKM-----AKMIDERQQELT---------------------------------------------
DHAL_LACLA      ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           HQTLTETLKHMLDEDSEIVTFYVGEDGSEELANEIAQXXXXXXXXXXXXXHQGQQPVYPYLFSVE
Y1689_STAHJ     FVTVTGLLKSMLNEDSEILTIIAGEDANDDISDKLVEWVESEYPDVEVEEHNGGQPIYQYLFSVE
Y1546_STAS1     FETVKGLMAEMINEDSEIITMIVGMDADKTVTSDIEDWMEATYPDVELEQHDGQQPVYQYLFSVE
Y901_STAES      FHAVKGLLSKLLNEDSEILTMISGEDADNSITNQIINWIESEYPDVEVEQHEGGQPIYQYFFAVE
Y792_STAEQ      FHAVKGLLSKLLNEDSEILTMISGEDADNSITNQIIDWIESEYPDVEVEQHEGGQPIYQYFFAVE
Y1240_STAAC     LTTVTELLNEMLAEDSEILTVIIGQDAEQAVTDNMINWIEEQYPDVEVEVHEGGQPIYQYFFSVE
Y1226_STAAM     LTTVTELLNEMLAEDSEILTVIIGQDAEQAVTDNMINWIEEQYPDVEVEVHEGGQPIYQYFFSVE
Y1193_STAA8     LTTVTELLNEMLAEDSEILTVIIGQDAEQAVTDNMINWIEEQYPDVEVEVHEGGQPIYQYFFSVE
Y1160_STAAS     LTTVTELLNEMLAEDSEILTVIIGQDAEQAVTDNMINWIEEQYPDVEVEVHEGGQPIYQYFFSVE
Y1119_STAA3     LTTVTELLNEMLAEDSEILTVIIGQDAEQAVTDNMINWIEEQYPDVEVEVHEGGQPIYQYFFSVE
Y1069_STAAN     LTTVTELLNEMLAEDSEILTVIIGQDAEQAVTDNMINWIEEQYPDVEVEVHEGGQPIYQYFFSVE
Y1202_STAAR     LTTVTELLNEMLADDSEILTVIIGQDAEQAVTDNMINWIEEQYPDVEVEVHEGGQPIYQYFFSVE
Y1109_STAAW     LTTVTELLNEMLAEDSEILTVIIGQDAEQAVTDNMINWIEEQYPDVEVEVHEGGQPIYQYFFSVE
Y1090_STAAB     LTTVTELLNEMLAEDSEILTVIIGQDAEQAVTDNMINWIEEQNPDVEVEVHEGGQPIYQYFFSVE
Y369_MYCGE      TDCFFKTIDILSKKKPEFLLAYYGKDITEQDAKKM-QALVEKKYKLFCEFSPGEQKVFSYIIGIQ
Y547_MYCPN      VQCVFNTIDHLLKKKPEFLLAYYGKD---------------------------------------
DAK1_SCHPO      -----------------------------------------------------------------
VINC_CHICK      -----------------------------------------------------------------
DHAL_LACLA      -----------------------------------------------------------------