[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for spne4:ACF56181.1

[Show Plain Result]


## Summary of Sequence Search
    1::358
   17::358     e-150  76%  358 aa  DHAS_STRMU RecName: Full=Aspartate-semialdehyde dehydrogenase;     
   19::346     2e-92  53%  346 aa  DHAS_BACSU RecName: Full=Aspartate-semialdehyde dehydrogenase;     
   19::340     2e-72  49%  340 aa  DHAS_AQUAE RecName: Full=Aspartate-semialdehyde dehydrogenase;     
   21::342     6e-70  46%  347 aa  DHAS_LEGPN RecName: Full=Aspartate-semialdehyde dehydrogenase;     
   20::333     2e-64  46%  338 aa  DHAS_SHEVI RecName: Full=Aspartate-semialdehyde dehydrogenase;     
   20::333     1e-63  45%  338 aa  DHAS_SHESP RecName: Full=Aspartate-semialdehyde dehydrogenase;     
   20::332     1e-61  44%  337 aa  DHAS_VIBCH RecName: Full=Aspartate-semialdehyde dehydrogenase;     
   26::342     4e-61  40%  343 aa  DHAS_PROMA RecName: Full=Aspartate-semialdehyde dehydrogenase;     
    5::278     1e-60  47%  280 aa  DHAS_SYNY3 RecName: Full=Aspartate-semialdehyde dehydrogenase;     
   19::335     1e-57  41%  343 aa  DHAS_CAMJE RecName: Full=Aspartate-semialdehyde dehydrogenase;     
   18::339     3e-57  43%  346 aa  DHAS_HELPJ RecName: Full=Aspartate-semialdehyde dehydrogenase;     
   18::339     8e-57  43%  346 aa  DHAS_HELPY RecName: Full=Aspartate-semialdehyde dehydrogenase;     
   20::316     4e-55  41%  316 aa  DHAS_VIBMI RecName: Full=Aspartate-semialdehyde dehydrogenase;     
   17::342     2e-52  41%  346 aa  DHAS_MYCSM RecName: Full=Aspartate-semialdehyde dehydrogenase;     
   16::330     2e-49  40%  338 aa  DHAS_STRAK RecName: Full=Aspartate-semialdehyde dehydrogenase;     
   17::342     6e-47  37%  344 aa  DHAS_CORFL RecName: Full=Aspartate-semialdehyde dehydrogenase;     
   17::342     3e-46  37%  344 aa  DHAS_CORML RecName: Full=Aspartate-semialdehyde dehydrogenase;     
   17::342     6e-46  37%  344 aa  DHAS_CORGL RecName: Full=Aspartate-semialdehyde dehydrogenase;     
   19::333     7e-45  37%  338 aa  DHAS_RICCN RecName: Full=Aspartate-semialdehyde dehydrogenase;     
   19::333     2e-43  37%  338 aa  DHAS_RICTY RecName: Full=Aspartate-semialdehyde dehydrogenase;     
   19::333     2e-42  35%  338 aa  DHAS_RICFE RecName: Full=Aspartate-semialdehyde dehydrogenase;     
   19::333     9e-42  35%  338 aa  DHAS_RICBR RecName: Full=Aspartate-semialdehyde dehydrogenase;     
   18::341     2e-41  38%  345 aa  DHAS_MYCTU RecName: Full=Aspartate-semialdehyde dehydrogenase;     
   18::341     2e-41  38%  345 aa  DHAS_MYCBO RecName: Full=Aspartate-semialdehyde dehydrogenase;     
   19::333     6e-39  34%  338 aa  DHAS_RICPR RecName: Full=Aspartate-semialdehyde dehydrogenase;     
   41::347     8e-25  34%  354 aa  DHAS_METJA RecName: Full=Aspartate-semialdehyde dehydrogenase;     
   22::335     2e-23  28%  336 aa  USG_AZOVI RecName: Full=USG-1 protein homolog;
   76::343     2e-19  34%  343 aa  DHAS_ARCFU RecName: Full=Aspartate-semialdehyde dehydrogenase;     
   20::331     7e-18  25%  336 aa  USG_PSEAE RecName: Full=USG-1 protein homolog;
   20::331     2e-17  29%  337 aa  USG_ECOLI RecName: Full=USG-1 protein;
   34::345     2e-17  34%  347 aa  DHAS_METTH RecName: Full=Aspartate-semialdehyde dehydrogenase;     
   37::365     4e-16  34%  365 aa  DHAS_YEAST RecName: Full=Aspartate-semialdehyde dehydrogenase;     
   68::358     3e-12  30%  371 aa  DHAS_BUCAI RecName: Full=Aspartate-semialdehyde dehydrogenase;     
   95::357     1e-11  31%  371 aa  DHAS_NEIMA RecName: Full=Aspartate-semialdehyde dehydrogenase;     
   96::359     1e-11  29%  371 aa  DHAS_HAEIN RecName: Full=Aspartate-semialdehyde dehydrogenase;     
   97::358     2e-11  30%  371 aa  DHAS_BUCAP RecName: Full=Aspartate-semialdehyde dehydrogenase;     
   64::267     2e-11  27%  349 aa  DHAS_LEPIN RecName: Full=Aspartate-semialdehyde dehydrogenase;     
   64::267     2e-11  27%  349 aa  DHAS_LEPIC RecName: Full=Aspartate-semialdehyde dehydrogenase;     
   95::356     9e-11  30%  367 aa  DHAS_ECOL6 RecName: Full=Aspartate-semialdehyde dehydrogenase;     
   95::356     1e-10  32%  367 aa  DHAS_SHIFL RecName: Full=Aspartate-semialdehyde dehydrogenase;     
   95::357     1e-10  29%  371 aa  DHAS_NEIMB RecName: Full=Aspartate-semialdehyde dehydrogenase;     
   95::356     1e-10  32%  367 aa  DHAS_ECOLI RecName: Full=Aspartate-semialdehyde dehydrogenase;     
   95::356     1e-10  32%  367 aa  DHAS_ECO57 RecName: Full=Aspartate-semialdehyde dehydrogenase;     
   96::357     2e-10  31%  368 aa  DHAS_SALTY RecName: Full=Aspartate-semialdehyde dehydrogenase;     
   96::357     2e-10  31%  368 aa  DHAS_SALTI RecName: Full=Aspartate-semialdehyde dehydrogenase;     
   97::358     4e-10  28%  369 aa  DHAS_BUCBP RecName: Full=Aspartate-semialdehyde dehydrogenase;     
   18::370     9e-10  25%  370 aa  DHAS_PSEAE RecName: Full=Aspartate-semialdehyde dehydrogenase;     
   96::362     3e-08  28%  376 aa  DHAS_BORPE RecName: Full=Aspartate-semialdehyde dehydrogenase;     
   96::286     2e-07  29%  286 aa  DHAS_ACTPL RecName: Full=Aspartate-semialdehyde dehydrogenase;     
   18::180     2e-06  21%  317 aa  USG_HAEIN RecName: Full=USG-1 protein homolog;
  258::355     3e-04  31%  368 aa  DHAS_AZOVI RecName: Full=Aspartate-semialdehyde dehydrogenase;     
   68::201     6e-04  32%  345 aa  ARGC_BACSU RecName: Full=N-acetyl-gamma-glutamyl-phosphate
  136::228     8e-04  27%  386 aa  G3PA_GUITH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase,
    1::358

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxQMIKMLEESTLPIDKIRYLASARSAGKSLKFKDQDXXXXXXXXXAFEGVDIALF
DHAS_STRMU      ----------------RMIQQLEQSTLPVDKVRLLSSSRSAGKVLQYKDQDVTVELTTKDSFEGVDIALF
DHAS_BACSU      ----------------QMLKTLEDRNFEMDTLTLLSSKRSAGTKVTFKGQELTVQEASPESFEGVNIALF
DHAS_AQUAE      ------------------LKVLEERNFPVDELVLYASERSEGKVLTFKGKEYTVKALNKESFKGIDIALF
DHAS_LEGPN      ------------------LTVLEERNFPIKSLYPLASSRSVGKTVTFRDQELDVLDLAEFDFSKVDLALF
DHAS_SHEVI      -----------------MIEILEERNFPVAKLFPLASSRSAGGTVSFNGKQVEILDVDDFDWSQAQIGFF
DHAS_SHESP      -----------------IIEILQERNFPIAKLFPLASSRSAGGTVSFNGKQVEILDVDDFDWSQAQIGFF
DHAS_VIBCH      -----------------MLEVLQEREFPVDELFLLASERSEGKTYRFNGKTVRVQNVEEFDWSQVHIALF
DHAS_PROMA      ----------------EILKILEERSFPIRELRLLASERSAGQVQFFKGEDLVVKKVSPEGFEDVDLVLA
DHAS_SYNY3      ------------------------------------------------------------AFKGCDLVLA
DHAS_CAMJE      ----------------ELLNVLDELDFPVESILPLASAKSVGSEVEFKGKAYKVKELTENVFKEIDIAFF
DHAS_HELPJ      ----------------ELIKGLENSFFPIKKFVPLASARSAGKKIRAFNKDYEILETTHEVFEKIDIAFF
DHAS_HELPY      ----------------ELIKGLENSFFPIKKFVPLASTRSAGKKIKAFNKDYEILETTHEVFERIDIAFF
DHAS_VIBMI      -----------------MLEVLQEREFPVDELFLLASERSEGKTYRFNGKTVRVQNVEEFDWSQVHIALF
DHAS_MYCSM      -----------------MRNLLEQRNFPATSVRFFASPRSEGKKLTFRGQEIEVENAETADPSGLDIALF
DHAS_STRAK      -----------------MRRILTERNFPVTELRLFASARSAGTEL-----DGVTVEDAATAYTGLDIVLF
DHAS_CORFL      -----------------MRTLLEERNFPADTVRFFASPRSAGRKIEFRGTEIEVEDITQATEEGIDVALF
DHAS_CORML      -----------------MRTLLEERNFPADTVRFFASPRSAGRKIEFRGTEIEVEDITQATEESIDVALF
DHAS_CORGL      -----------------MRTLLEERNFPADTVRFFASPRSAGRKIEFRGTEIEVEDITQATEESIDVALF
DHAS_RICCN      ----------------ETLNILAERNFPINKVYAIASDSSLGREVSFGEKILQINSLKSLHFDDIDIAFF
DHAS_RICTY      ----------------ETLNILAERHFPINKIYAIASNNSLGREVRFGAKILHINSLTIFNFYDIDIAFF
DHAS_RICFE      ----------------ETLNILAERNFPVNKIYAIASDNSIGREISYGEKILKISSLTNLNFDDIDIAFF
DHAS_RICBR      ----------------ETLNILAERNFPINKIYAVASNNSIGKKVSFGEQVLQISSLDDLDFEEIDIAFF
DHAS_MYCTU      -----------------MRTLLDERDFPXXXXXXXXXXXXQGRKLAFRGQEIEVEDAETADPSGLDIALF
DHAS_MYCBO      -----------------MRTLLDERDFPXXXXXXXXXXXXQGRKLAFRGQEIEVEDAETADPSGLDIALF
DHAS_RICPR      ----------------ETLNILAERHFPINKIYAIASDNSLGREVRFGEKILHINSIKIFNFHDIEIAFF
DHAS_METJA      -----------------------------------ASERSAGKKYKFQDRDIPENIKDMVVFEDVDIVFS
USG_AZOVI       -------------------EILEERDFPVGQLHLLASPASAGKSVSFKGRNLRVKSIEAFDFAQVRLVFF
DHAS_ARCFU      -----------------------------------------------------------------DIVFS
USG_PSEAE       -----------------LVGLLDERDFPLHRLHLLASAESAGQRMGFAESSLRVGDVDSFDFSSVGLXXX
USG_ECOLI       -----------------LLETLAERQFPVGEIYALARNESAGEQLRFGGKTITVQDAAEFDWTQAQLAFF
DHAS_METTH      -----------------------------------ASSRSAGKEMPESVRDMEVVETDPSAVGDVDI-LF
DHAS_YEAST      -----------------------------------ASSRSAGKKLPESATDIIVSECKSEFFKECDIVFS
DHAS_BUCAI      ----------------------------------------------------------------MDIIIT
DHAS_NEIMA      ----------------------------------------------------------------------
DHAS_HAEIN      ----------------------------------------------------------------------
DHAS_BUCAP      ----------------------------------------------------------------------
DHAS_LEPIN      ------------------------------------------KNLVITTPDPAKTKDVVLAFSGLD----
DHAS_LEPIC      ------------------------------------------KNLVITTPDPAKTKDVVLAFSGLD----
DHAS_ECOL6      ----------------------------------------------------------------------
DHAS_SHIFL      ----------------------------------------------------------------------
DHAS_NEIMB      ----------------------------------------------------------------------
DHAS_ECOLI      ----------------------------------------------------------------------
DHAS_ECO57      ----------------------------------------------------------------------
DHAS_SALTY      ----------------------------------------------------------------------
DHAS_SALTI      ----------------------------------------------------------------------
DHAS_BUCBP      ----------------------------------------------------------------------
DHAS_PSEAE      -----------------MQRMLEERDFDLIEPVFFTTSNVGGQGPEVKDIAPLKDAYSIDELKTLDVILT
DHAS_BORPE      ----------------------------------------------------------------------
DHAS_ACTPL      ----------------------------------------------------------------------
USG_HAEIN       ----------------KIVERLEQSALEISKVSIVEIIPEEEQNIRFRNKGVEQLSPNEVEWADFNYVFF
DHAS_AZOVI      ----------------------------------------------------------------------
ARGC_BACSU      ----------------------------------------------------------------IDIMFL
G3PA_GUITH      ---------------------------------------------------------------GVEYLCE


                         .         .         *         .         .         .         .:140
query           SAGSSTSAXYAPYAVKAGVVVVDNTSYFRQNPDVPLVVPEVNAHALDAHNGIIACPNCSTIQMMVALEPV
DHAS_STRMU      SAGGSVSAKFAPYAVKAGAVVVDNTSHFRQNPDVPLVVPEVNAYAMDAHNGIIACPNCSTIQMMVALEPI
DHAS_BACSU      SAGGSVSQALAPEAVKRGAIVIDNTSAFRMDENTPLVVPEVNEADLHEHNGIIANPNCSTIQMVAALEPI
DHAS_AQUAE      SAGGSTSKEWAPKFAKDGVVVIDNSSAWRMDPDVPLVVPEVNPEDVKKKKGIIANPNCSTIQMVVALKPI
DHAS_LEGPN      SAGGAVSKEYAPKAVAAGCVVVDNTSCFRYEDDIPLVVPESSSNRDYTKRGIIANPNCSTIQMVVALKPI
DHAS_SHEVI      SAGGDVSEKWAPIAAENGCVVIDNTSQFRYDNDVPLVIPEVNPEAIDFRNNIIANPNCSTIQMLVALKPI
DHAS_SHESP      SAGGDVSEKWAPIAAESGCVVIDNTSHFRYDNDVPLVIPEVNPEAIDFRNNIIANPNCSTIQMLVALKPI
DHAS_VIBCH      SAGGELSAKWAPIAAEAGVVVIDNTSHFRYDYDIPLVVPEVNPEAIARNRNIIANPNCSTIQMLVALKPI
DHAS_PROMA      SAGGSISRKWRKVINSAGAVIVDNSNAYRMEPDVPLVVPEVNPSQVFTHKGLIANPNCTTILLALVLAPL
DHAS_SYNY3      SAGGSTSKRWAEEITKAGAVMVDNSSAFRMVPEVPLVVPEINPEAAQNHQGIIANPNCTTILMGVAIYPL
DHAS_CAMJE      SAGGSVSEKYAKFAVESGAVVIDNTSHFRMEKDVPLVVPECNPEDIKKKTGIIANPNCSTIQMVQVLKPL
DHAS_HELPJ      SAGGSVSEEFAISASKTALVI-DNTSFFRLNKDVPLVVPEINAQEINAPLNIIANPNCSTIQMTQILNPL
DHAS_HELPY      SAGGSVSEEFATSASKTALVV-DNTSFFRLNKDVPLVVPEINAKEINAPLNIIANPNCSTIQMTQILNPL
DHAS_VIBMI      SAGGELSAHWAPIRAEAGVVVIDNTSHFRYDYDIPLVIPEVNPEAIARNRNIIANPNCSTIQMLVALKPI
DHAS_MYCSM      SAGATMSRVQAPRFAEAGVIVVDNSSAFRKDPDVPLVVSEVNVRGKKLAKGIIANPNCTTMAAMPVLKPL
DHAS_STRAK      SAGGATSKALAEKVASQGAVVIDNSSAWRKHPEVPLVVSEVNPHAIDRPKGIIANPNCTTMAAMPVLRPL
DHAS_CORFL      SAGGTASKQYAPLFAAAGATVVDNSSAWRKDDEVPLIVSEVNPSDKDSVKGIIANPNCTTMAAMPVLKPL
DHAS_CORML      SAGGTASKQYAPLFAAAGATVVDNSSAWRKDDEVPLIVSEVNPSDKDSVKGIIANPNCTTMAAMPVLKPL
DHAS_CORGL      SAGGTASKQYAPLFAAAGATVVDNSSAWRKDDEVPLIVSEVNPSDKDSVKGIIANPNCTTMAAMPVLKPL
DHAS_RICCN      CAGSEVSKEFIPKATASNCVVIDKSSLFRVDNQVPLIVPEVNLSTLKEFNNIIANPNCIVIPLAVALKPL
DHAS_RICTY      CAGSNVSKEFIPKATADNCIVIDKTSLFRTDNQVPLIVPEANLSTLKEFNNIIANPNCIVIPLVVALKPL
DHAS_RICFE      CAGSEVSKEFVPKATASSCVVIDKSSLFRVDNQVPLIVPEVNLSTLTEFNNIIANPNCIVIPLAVALKPL
DHAS_RICBR      SAGSEVSKKFIPIAIVKNCMVIDKSSFFRLSEDIPLIVPEANLSTLKAIKNIISNPNCIAIPLAVVLKPL
DHAS_MYCTU      SAGSAMSKVQAPRFAAAGVTVIDNSSAWRKDPDVPLVVSEVNFER-DAHKGIIANPNCTTMAAMPVLKVL
DHAS_MYCBO      SAGSAMSKVQAPRFAAAGVTVIDNSSAWRKDPDVPLVVSEVNFER-DAHKGIIANPNCTTMAAMPVLKVL
DHAS_RICPR      CAGSNVSKEFIPKATSCNCIVIDKTSLFRADNQVPLIVPEVNLSTLKEFNNIIANPNCXXXXXXXXXXXX
DHAS_METJA      ALPSDLAKKFEPEFAKEGKLIFSNASAYRMEEDVPLVIPEVNADHLELDGAIITNPNCSTICAVITLKPI
USG_AZOVI       AAGQAVTRQYASQARAAGCMLVDLSGALPLQ-QAPRVVAEVNPQVLEKLEAQVTSPASQXXXXXXXXXXX
DHAS_ARCFU      ALPSDIAREVEPKFAEAGFVVASNASAYRMAEDVPLVIPEVNPEHLGLDGFIVTNPNCTTIVLVLSLKPL
USG_PSEAE       XXXXXXXXXXXXXXXXXGCSVIDLSGALEPSVAPPVMV-SVNAERLASQAALLSSPCAVAAELCEVLAPL
USG_ECOLI       VAGKEATAAWVEEATNSGCLVIDSSGLFAXXXXXXXXXXXXXXFVLTDYRNVIAVPDSLTSQLLAALKPL
DHAS_METTH      SALPADVARKVEPKFAEKYIVASNASAMRMEPDVPLVIPEVNPEFLDLDGFIVTNPNCSTIALTLTLKPI
DHAS_YEAST      GLDADYAGAIEKEFMEAGIAIVSNAKNYRREQDVPLIVPVVNPEHLDPRPGFIICSNCSTAGLVAPLKPL
DHAS_BUCAI      CQGGSYTKEIYPTLRKNGWYWIDAASNLRMKNDSVIILDPVNYNVIEINKGIFVGGNCTISLMLMSLGGL
DHAS_NEIMA      ---------------------VDAASSLRMKDDAIIVLDPVNRNVIDLKNGVYIGGNCTVSLMLMALGGL
DHAS_HAEIN      ---------------------VDAASALRMKDDAIIVLDPVNQHVISEKKGIFVGGNCTVSLMLMAIGGL
DHAS_BUCAP      ---------------------IDAASTLRMEKDATIILDPVNLNALDKGIKTFVGGNCTVSLMLMALGGL
DHAS_LEPIN      ---SNVAGEVEKNYANAGIHIISNSKNHRMDPTVPILSAEVNSSHLEVLTSIITNSNCTIMGVTISLKPL
DHAS_LEPIC      ---SNVAGEVEKNYANAGIHIISNSKNHRMDPTVPILSAEVNSSHLEVLTSIITNSNCTIMGVTISLKPL
DHAS_ECOL6      ---------------------IDAASSLRMKDDAIIILDPVNQDVITLNNGIFVGGNCTVSLMLMSLGGL
DHAS_SHIFL      ---------------------IDAASSLRMKDDAIIILDPVNQDVITLNNGIFVGGNCTVSLMLMSLGGL
DHAS_NEIMB      ---------------------IDAASSLRMKDDAIIVLDPVNRDVLDLKNGVYIGGNCTVSLMLMALGGL
DHAS_ECOLI      ---------------------IDAASSLRMKDDAIIILDPVNQDVITLNNGIFVGGNCTVSLMLMSLGGL
DHAS_ECO57      ---------------------IDAASSLRMKDDAIIILDPVNQDVITLNNGIFVGGNCTVSLMLMSLGGL
DHAS_SALTY      ---------------------IDAASTLRMKDDAIIILDPVNQDVITLNNGVFVGGNCTVSLMLMSLGGL
DHAS_SALTI      ---------------------IDAASTLRMKDDAIIILDPVNQDVITLNNGVFVGGNCTVSLMLMSLGGL
DHAS_BUCBP      ---------------------IDAASVLRMNQDTVIILDPVNSNSIDSGFKTFVGGNCTVXXXXXXXXXX
DHAS_PSEAE      CQGGDYTSEVFPKLREAGWYWIDAASSLRMEDDAVIVLDPVNRQALDAGTRNYIGGNCTVSLMLMALGGL
DHAS_BORPE      ---------------------IDAASTLRMADDAIIVLDPVNRPVIDAKRGVFVGGNCTVSCMLMGLAGL
DHAS_ACTPL      ---------------------IDAASALRMEKDAIIVLDPVNQHVISEKNGIFVGGNCTVSLMLMAIGGL
USG_HAEIN       -AGKLEQVSHIAQAAEQGCIVIDMLGVCSALSDVPVVVPTVNESQLLRQRNIVSLPDPQVSQLALTLAPI
DHAS_AZOVI      ----------------------------------------------------------------------
ARGC_BACSU      AAPPGVSSELTPKLADAGITVIDLSGDLRKRTAAPKAVIQEAVYGLAELNQLIANPGCFPTAVLLGLAPL
G3PA_GUITH      STGVFLTAEKAQPHIDAGVKKVIFSAPAKD--DSLTVVMGVNAEDYKGQTDFISCASCTTNGLAPLVKCI


                         +         .         .         .         .         *         .:210
query           RQKWGLDRIIVSTYQAVSGAGMGAILETQRELREVLNDGVKPRDLHAEILPSGGDKKHYPIAFNALPQID
DHAS_STRMU      RQKWGLSRVIVSTYQAVSGAGQSAINETVREIKEVVNDGVDPKAVHADILPSGGDKKHYPIAFNALAQID
DHAS_BACSU      RKAYGLNKVIVSTYQAVSGAGNEAVKELYSQTQAILN----KEEIEPEIMPVKGDKKHYQIAFNAIPQID
DHAS_AQUAE      YDKAGIKRVVVSTYQAVSGAGAKAIEDLKNQTKAWCEGKEMPK----------AQKFPHQIAFNALPHID
DHAS_LEGPN      YDAVGISRINVATYQSVSGTGKKAISELVAQVGDLLNG----RPANVQVYPQ-------QIAFNALPHID
DHAS_SHEVI      YDAFGISRINVATYQSVSGSGKEAITELAGQCSKLLHG-----------LPA--ESKVYPIAFNVLPQID
DHAS_SHESP      YDAFGISRINVATYQSVSGSGKEAIAELAGQCSKLLQG-----------LPIEPKVYSKQIAFNVLPQID
DHAS_VIBCH      YDAVGIERINVTTYQSVSGAGKAGIDELAGQTAKLLNG-----------YPAETNTFSQQIAFNCIPQID
DHAS_PROMA      SAQLPIKRVVVSTYQSASGAGARAMNELKQLSQDVLNGNIP----KSEILP-------YSLAFNLFLHNS
DHAS_SYNY3      HQLQPIKRIVVATYQSASGAGAMAMEEVKHQSRDIL-EGKIPQ---AEILP-------YPLAFNLFPHNS
DHAS_CAMJE      NDAFNLKRVDVSTYQAASGAGK----EGMQELVEAMQSAFKLDEFEPQTFP-------YTLALNLIPQID
DHAS_HELPJ      HLHFKIKSVIVSTYQAVSGAGNKGIESLKNELKTALEHLEKDPAIDLQVLQAGAFA--YPIAFNAIAHID
DHAS_HELPY      HLHFKIKSVIVSTYQAVSGAGNKGIESLKNELKTALECLEKDPTIDLQVLQAGAFA--YPIAFNAIAHID
DHAS_VIBMI      YDAVGIERINVTTYQSVSGAGKAGIDELAGQTAKLLNG-----------YPAETNTFSQQIAFNCIPQID
DHAS_MYCSM      HEEAGLQRLIVSSYQAVSGSGIAGVEELAGQARPVI-DGVEQLVHDGSALQYPAPNKYVPIAFNIVPLAG
DHAS_STRAK      HDEAGLEALVVATYQAVSGSGLAGVAELHGQTQKVVADAEKTHDGEAVDFPEPGVYKR-PIAFNVLPLAG
DHAS_CORFL      HDAAGLVKLHVSSYQAVSGSGLAGVETLAKQVAAVGDHNVE--FVHDGQAADAGDVGPYPIAYNVLPFAG
DHAS_CORML      HDAAGLVKLHVSSYQAVSGSGLAGVETLAKQVAAVGDHNVE--FVHDGQAADAGDVGPYPIAYNVLPFAG
DHAS_CORGL      HDAAGLVKLHVSSYQAVSGSGLAGVETLAKQVAAVGDHNVE--FVHDGQAADAGDVGPYPIAYNVLPFAG
DHAS_RICCN      DNEIKIKRVVISTYQSVSGAGKAGMDE--------LYDQTKSKYVFGE-----NDPKKFPIAFNIFPHIG
DHAS_RICTY      DNEIKIKRVVISTYQSVSGAGKAGMDE--------LYDQTKSKYVFRENNPQKFPKQ---IAFNLFPHIG
DHAS_RICFE      DNEIKIKRVVISTYQSVSGAGKAGMDE--------LYDQTKSKYVFGE-----NDPKKFPITFNLFPHIG
DHAS_RICBR      DNEISIKRVVISTYQSVSGAGKAGMDE--------LYDQTKSKYIFEEKSPNIFPKQ---IAFNLFPHIG
DHAS_MYCTU      HDEARLVRLVVSSYQAVSGSGLAGVAELAEQARAVIGG--------AEQLVYDGGALEFPIAFNVVPLAG
DHAS_MYCBO      HDEARLVRLVVSSYQAVSGSGLAGVAELAEQARAVIGG--------AEQLVYDGGALEFPIAFNVVPLAG
DHAS_RICPR      DNEIKIKRVVISTYQSVSGAGKAGMDE--------LYNQTKSKYVFRENNPKKFPKQ---IAFNLFPYIG
DHAS_METJA      MDKFGLEAVFIATMQAVSGAGY---------------NGVPSMAILDNLIPFIKNEEE-KMQTESLKLLG
USG_AZOVI       XXXXXWRHLGVTACLPVSSLGREGVAELARQTTELLN-GRPPK-------PRFFDRQ---IAFNLLGRVG
DHAS_ARCFU      -MDLGLRTVRVASMQALSGAGYPGV-------------------------PS------LAITDNVIPFIK
USG_PSEAE       LATLDCRQLNLTACLSVSSLGREGVKELARQTAELLN----ARPLEPRLF----DRQ---IAFNLLAQVG
USG_ECOLI       IDQGGLSRISVTSLISASAQGKKAVDALAGQSAKLLN-GI-PIDEE--------DFFGRQLAFNMLPLLP
DHAS_METTH      YDAYTIKRVYVSTMQAVSGAGYNGV-------------------------PS------MAILDNLVPFXX
DHAS_YEAST      IEKFGIDALTTTTLQAISGAG--------------FSPGVPGIDILDNIIPYIGDKMEWETKKILAPLAE
DHAS_BUCAI      FQTELVEWIAVSTYQAASGAGA-------RHMIELLNQGILYKSVETDLLKGSHDKKNFPLAASLIPWID
DHAS_NEIMA      FQNDLVEWATSMTYQAASGAGMGAIAKVADELADILDIDRKVSDLRSEDYPKANFG--VPLAGSLIPWID
DHAS_HAEIN      FEKDLVEWISVATYQAASGAGMRELLSQMGLLEQAVSSELKDRKVTAKMRADNFPTDNFGAALGGIPWID
DHAS_BUCAP      FVNNLIDWVFVSTYQAASGAGSRYVIELLKQMKDLLDKSYSVLDIEKKVTQESRSKNSVPLATSLIPWID
DHAS_LEPIN      LDRFGIESVMLFSMQAISGAGY---------------PGVPTMDILGNVIPHGGEEEKAEIPLKCLGKVE
DHAS_LEPIC      LDRFGIESVMLFSMQAISGAGY---------------PGVPTMDILGNVIPHGGEEEKAEIPLKCLGKVE
DHAS_ECOL6      FANDLVDWVSVATYQAASGGGARHMRELLTQMGELANPSSAILDIERKVLTRSGDNFGVPLAGSLIPWID
DHAS_SHIFL      FANDLVDWVSVATYQAASGGGMGAILDIERKVTTLTRSGELPVDNFG-----------VPLAGSLIPWID
DHAS_NEIMB      FQNDLVEWATSMTYQAASGAGAGSILDIDRKVSDFLRSEDYPKANFG-----------VPLAGSLIPWID
DHAS_ECOLI      FANDLVDWVSVATYQAASGGGMGAILDIERKVTTLTRSGELPVDNFG-----------VPLAGSLIPWID
DHAS_ECO57      FANDLVDWVSVATYQAASGGGMGAILDIERKVTTLTRSGELPVDNFG-----------VPLAGSLIPWID
DHAS_SALTY      FAHNLVDWVSVATYQAASGGGMGAILDIERKVTALTRSGELPVDNFG-----------VPLAGSLIPWID
DHAS_SALTI      FAHNLVDWVSVATYQAASGGGMGAILDIERKVTALTRSGELPVDNFG-----------VPLAGSLIPWID
DHAS_BUCBP      FSEKLIEWITVSTYQAASGSGAKYIEELLMQMHSILNIEKKVRNLSCS---DKFPKKNFPLAGSLIPWID
DHAS_PSEAE      FDAGLVEWMSAMTYQAASGAGAQNMRELLKQMASVADDLANPETLRSEAFPT----EHFPLGGSLIPWID
DHAS_BORPE      FNNDLVEWMSSMTYQAASGGGAQHMRELLTQFG-LLNQAVKXRGVLARQQDPSLPQEHFPLGGNLIPWID
DHAS_ACTPL      FEKDLVEWVSVATYQAASGAGMRELLSQMGELEELANPASSILEIERKVTAKPTDNFGAPLAGSLIPWID
USG_HAEIN       LQETNLNQVFVTSLLPASYTDAETVTKLAGQTARLLN---------------------------------
DHAS_AZOVI      ----------------------------------------------------------------------
ARGC_BACSU      AQKKLLDEVIVDAKTGVSGAGRKASMGTH---FSELNDNFK-----------------------------
G3PA_GUITH      NDKWGIEEGLMTTIHAMT----------------------------------------------------


                         .         .         .         +         .         .         .:280
query           VFTDNDXXXXXXXXXXXXXXXXXDDSIAVSATCVRIPVLSAHSESVYIETKEVAPIEEVKAAIAAFPGAV
DHAS_STRMU      VFTDNDYTYEEMKMTNETKKIMEEPELPVSATCVRVPILFSHSEAVYIETKDVAPIEEVKAAIAAFPGAV
DHAS_BACSU      KFQDNGYTFEEMKMINETKKIMHMPDLQVAATCVRLPIQTGHSESVYIEDRDDATVEDIKNLLKEAPGVT
DHAS_AQUAE      VFFEDGYTKEENKMLYETRKIMHDENIKVSATCVRIPVFYGHSESISMETKEISP-EEAREVLKNAPGVI
DHAS_LEGPN      QFEDNGYTREEMKMVWETRKIMEDDSIMVNPTAVRVPVIYGHSEAVHLELKKPLTADDARALLAKAPGVT
DHAS_SHEVI      KFMENGYTKEEMKMVWETQKIFGDDNIVVNPTAVRVPVFYGHSEAIHLETIQPAEAEDVKAVLREAPGIE
DHAS_SHESP      TFMENGYTKEEMKMVWETQKIFGDDNIVVNPTAVRVPVFFGHSEAIHLETIQPAEAEDVKAVLRDAPGIE
DHAS_VIBCH      QFMDNGYTKEEMKMVWETQKIFNDPSIMVNPTCVRVPVFYGHAEAVHVETRAPIDAEQVMDMLEQTDGIE
DHAS_PROMA      PLQSNNYCEEEMKMINETRKILNQSELAITATCVRVPVLRAHSESINIEFAEPFPVEEARKILSNASGIK
DHAS_SYNY3      PITANHYCEEEMKMVQETRKIFAAEDIRITATCVRVPVLRAHSEAVNLEFATPFPVELAKTAIAKAPGVK
DHAS_CAMJE      VFMDNDYTKEELKMVNETQKILHKN-LEVSATCVRVPVLRSHSEAITMHFEKEIDVKKAKEILKKAPSVI
DHAS_HELPJ      TFKENGYTKEELKMVHETHKIMGVD-FPISATCVRVPVLRSHSESLSIAFEKEFDLKEVYEVLKNAPSVV
DHAS_HELPY      TFKENGYTKEELKMLHETHKIMGVD-FPISATCVRVPVLRSHSESLSIAFEKEFDLKEVYEVLKNAPSVA
DHAS_VIBMI      QFMDNGYTKEEMKMVWETQKIFNDPSIMVNPTCVRVPVFYGHAEAVHVETRAPIDAEQVMDMLDQTDGIE
DHAS_MYCSM      NYVDSGETDEDQKLRNESRKILGIPELLVSGTCVRVPVFSGHSLSINAEFSQPISVERTKELLSAAAGVK
DHAS_STRAK      SIVDDNETDEEQKLRNESRKILEIPGLKVSGTCVRVPVFSGHSLQINARFARPISADGATELLKDAPGVE
DHAS_CORFL      NLVDDGETDEEQKLRNESRKILGLPDLKVSGTCVRVPVFTGHTLTIHAEFDKAITVEQAQEILGAASGVE
DHAS_CORML      NLVDDGETDEEQKLRNESRKILGLPDLKVSGTCVRVPVFTGHTLTIHAEFDKAITVEQAQEILGAASGVK
DHAS_CORGL      NLVDDGETDEEQKLRNESRKILGLPDLKVSGTCVRVPVFTGHTLTIHAEFDKAITVDQAQEILGAASGVK
DHAS_RICCN      DL-NKDGYTSEEAKIASELNKIIGNHFKASVTSVRVPVFIGHSISVNIEFNDKIDAKEVEEILQDADGIV
DHAS_RICTY      DF-NKDGYTTEETKIAFELSKIMGTHFKTSVTSVRVPVFIGHAISVNIEFSNKIYAKDVEEILQDADGIV
DHAS_RICFE      DL-NKDGYTSEEAKIAFELNKIMGNHFKASVTSVRVPVFIGHSISVNIEFNDKMDANIAEEILQDADGIV
DHAS_RICBR      DL-NKDGYTSEESKIALELQKIIGDHLKXXXXXXXXXXXXGHSISVNIEFSSKVDAKEVEEILEDADGVV
DHAS_MYCTU      SLVDSGETDEDQKLRFESRKILGIPDLLVSGTCVRVPVFTGHSLSINAEFAQPLSPERARELLDGATGVQ
DHAS_MYCBO      SLVDSGETDEDQKLRFESRKILGIPDLLVSGTCVRVPVFTGHSLSINAEFAQPLSPERARELLDGATGVQ
DHAS_RICPR      DL-NKDGYTSEETKIAFELNKIMGNHFKTSVTSVRVPVFIGHAISVNIEFSDKIYAKDVEEILQDADGIV
DHAS_METJA      TLKDGKVELA---------------NFKISASCNRVAVIDGHTESIFVKTKEGAEPEEIKEVMDKFKPIV
USG_AZOVI       DSDTAGHTGLERRLVEESRQVLDAPELKISVTCLMAPVFFGDSLSLAVQASQAIDPSAVRAALERAPGEL
DHAS_ARCFU      GEEDKVEEEPLKLLGKFNGRKIEFADIKVSASCHRVPVIDGHTEAVWVEFDREVSVEEAKAAFESLKPLD
USG_PSEAE       AVDAEGHSAIERRIFAEVQALLGERIGPLNVTCIQAPVFFGDSLSVTLQCAEPVDLAAVTRVLDATKGI-
USG_ECOLI       --DSEGSXXXXXXXXXXXXKILQDEGLMISASVVQAPVFYGHAQMVNFXXXXXXXXXXXXXXFVQGEDIV
DHAS_METTH      XXXXXXXXXXLHLLGELDEGVVKPASFGVSASCHRVPVVDGHTEAXXXXXXXXXXXXXXREAMDKFRGPV
DHAS_YEAST      DKT--------------HVKLLTPEEIKVSAQCNRVAVSDGHTESLRFKNRPAPSVEQVKTCLKEYVCDA
DHAS_BUCAI      TEMSNQSREEWKGQAETNKILGTKDTILIDGTCVRIGSLRCHSQSFVIKLKKDVSLEDIEEIIRVIPNSI
DHAS_NEIMA      VDLGNSKEEWKGGVETNKILGRSDNPTVIDGLCVRIGSMRCHSQALTLKLKKDLPVSEIEAILAGANDWV
DHAS_HAEIN      KLTGQTKEEWKGYAETNKILGLSDNPIPVDGLCVRIGALRCHSQAFTIKLKKDLPLEEIEQIIASHNEKV
DHAS_BUCAP      VEMKNQSREEWKGQAETXXXXXXXXXXXXDGTCVRISSIRCHSQSFLIKLNKDISLENIKKIIVNHNQWV
DHAS_LEPIN      ------------------NGKILHADFSISAHCNRVPVFDGHTVCVSVKFKKKPSREEIISSWKDFSG--
DHAS_LEPIC      ------------------NGKILHADFSISAHCNRVPVFDGHTVCVSVKFKKKPSREEIISSWKDFSG--
DHAS_ECOL6      KQLDNGQSREEWKGQAETNKILNTSSIPVDGLCVRVGALRCHSQAFTIKLKKDVSIPTVEELLAAHPWAV
DHAS_SHIFL      KQLDNGQSREEWKGQAETNKILNTSSIPVDGLCVRVGALRCHSQAFTIKLKKDVSIPTVEELLAAHPWAV
DHAS_NEIMB      VDLGNSKEEWKGGVETNKILGRSDNPTVIDGLCVRVGAMRCHSQAITLKLKKDLPVSEIETILAGANDWV
DHAS_ECOLI      KQLDNGQSREEWKGQAETNKILNTSSIPVDGLCVRVGALRCHSQAFTIKLKKDVSIPTVEELLAAHPWAV
DHAS_ECO57      KQLDNGQSREEWKGQAETNKILNTSSIPVDGLCVRVGALRCHSQAFTIKLKKDVSIPTVEELLAAHPWAV
DHAS_SALTY      KQLDNGQSREEWKGQAETNKILNTASIPVDGLCVRVGALRCHSQAFTIKLKKEVSIPTVEELLAAHPWAK
DHAS_SALTI      KQLDNGQSREEWKGQAETNKILNTASIPVDGLCVRVGALRCHSQAFTIKLKKEVSIPTVEELLAAHPWAK
DHAS_BUCBP      KKMRNGQSREEWKIQAETNKILSSNKILIDGLCVRIGALRCHSQSFVIKLKKDISIPEIEQILKVIPNR-
DHAS_PSEAE      KELPNSREEWKAQAETNKILARFKNPIPVDGICVRVGAMRCHSQALTIKLNKDVPLTDIEGLISQHPWVK
DHAS_BORPE      MSREEWKAEAETNKILGRGAAFGTPATPIDGLCVRIGAMRCHSQALTIKLKRDVPLDEIEDLIAAVPNT-
DHAS_ACTPL      KLLESTKEEWKGYAETNKILGLSDNPIPVDGLCVRIGALRCHSQAFTIKLKK------------------
USG_HAEIN       ----------------------------------------------------------------------
DHAS_AZOVI      --------------------------IPVDGICVRVGAMRCHSQALTIKLNKDVPIADIEGLISQHPWVK
ARGC_BACSU      ----------------------------------------------------------------------
G3PA_GUITH      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           LEDDVAHQIYPQAINAVGSRDTFVGRIRKDLDAEKGIHMWVVSDNLLKGAAWNSVQIAETLHERGLVRPT
DHAS_STRMU      LEDDIKHQIYPQAANAVGSRETFVGRIRKDLDIENGIHMWVVSDNLLKGAAWNSVQIAESLHERGLVRST
DHAS_BACSU      LQDDPSQQLYPMPADAVGKNDVFVGRIRKDLDRANGFHLWVVSDNLLKGAAWNSVQIAESLKKLNLV---
DHAS_AQUAE      VIDNPQNNEYPMPIMAEGRDEVFVGRIRKDRVFEPGLSMWVVADNIRKGAATNAVQIAELLVKEGLI---
DHAS_LEGPN      VVDNLSKASYPTAINAVGHDDVFVGRIRQDISHPCGLNLWIVADNIRKGAATNAVQIAEILQREFLLK--
DHAS_SHEVI      LFE--SNEEYPTAVESAGTDPVYVGRVRKDISHSHGINLWVVSDNIRKGAALNSVQIAEVL---------
DHAS_SHESP      LFE--SNEEYPTAVESAGTDPVYVGRVRKDISHSHGINLWVVSDNIRKGAALNSVQIAEVL---------
DHAS_VIBCH      L---FRGADFPTQVRDAGGKDVLVGRVRNDISHHSGINLWVVADNVRKGAATNAVQIAELL---------
DHAS_PROMA      LLEDIQMNRFPMPIDVTGKDDIAVGRIRQDLSNPKALELWLCGDQIRKGAALNAIQIAELLLTR------
DHAS_SYNY3      LVEDWQKNYFPMPMDATGQDDVLVGRIRQDISHPNGLDLWLCGDQIRKGAALNAVQIAELLVERG-----
DHAS_CAMJE      VIDDPKNKKYPMPLMTSDTNETYVGRIRADVYDKKILHLWCVADQIRVGAATNAVRIAQ-----------
DHAS_HELPJ      VCDDPSHNLYPTPLKASHTDSVFIGRLRKDLFDKKTLHGFCVADQLRVGAATNALKIA------------
DHAS_HELPY      VCDDPSHNLYPTPLKASHTDSVFIGRLRKDLFDKKTLHGFCVADQLRVGAATNALKIA------------
DHAS_VIBMI      L---FRGADFPTQVRDAGGKDVLVGRVRNDISHHSGVNLWVVADN-------------------------
DHAS_MYCSM      LVD------VPTPLAAAGIDDCLVGRIRQDVPDGRGLALFVSGDNLRKGAALNTIQIAELL---------
DHAS_STRAK      LSD------IPTPLQAAGKDPSYVGRIRSDETVDNGLALFVSNDNLRKGAALNAVQIAE-----------
DHAS_CORFL      LVD------VPTPLAAAGIDESLVGRIRQDVDDNRGLVLVVSGDNLRKGAALNTIQIAELL---------
DHAS_CORML      LVD------VPTPLAAAGIDESLVGRIRQDVDDNRGLVLVVSGDNLRKGAALNTIQIAELL---------
DHAS_CORGL      LVD------VPTPLAAAGIDESLVGRIRQDVDDNRGLVLVVSGDNLRKGAALNTIQIAELL---------
DHAS_RICCN      TISNNNYLAYISPVEVVGEDAVYVSRIRNDVSRDNTINLWITCDNLRKGAALNSVQIAEEL---------
DHAS_RICTY      TISNNNDLAYISPIEVVGKDAVYVSRIRNDLSKENTINLWITCDNLRKGAALNSVQIAEEL---------
DHAS_RICFE      TISNNNDLAYISPVEVVGEDAVYVSRIRNDVSKPNAINLWITCDNLRKGAALNSVQIAEEL---------
DHAS_RICBR      MISQTKDLAYISPTEVVGEDAVYVSRIRDDESKENAINLWITCDNLRKGAALNSVQIAEEL---------
DHAS_MYCTU      LVD------VPTPLAAAGVDESLVGRIRRDVPDGRGLALFVSGDNLRKGAALNTIQIAELL---------
DHAS_MYCBO      LVD------VPTPLAAAGVDESLVGRIRRDVPDGRGLALFVSGDNLRKGAALNTIQIAELL---------
DHAS_RICPR      TISNNNGLAYISPIEVVGEDAVYVSRIRNDLSKDNTINLWITCDNLRKGAALNSVQIAEAL---------
DHAS_METJA      IREEIDRPQPRLDRNEGNGMSIVVGRIRKDPIFD--VKYTALEHNTIRGAAGASVLNAE-----------
USG_AZOVI       IEPDDCPTVIG---DAVGQDVAYVGRVRTGVDDACELDLWIASDNVRKGSALNAVQLAELLIKQG-----
DHAS_ARCFU      LPTSPEKVIIPQPRDAGNGMSITVGRIRK--DGERGLKYIVLGHNTVRGAAGASILNAELMIKEKII---
USG_PSEAE       --EWVGEGDYPTVVDALGQDETYVGRVRAGQADPCQVNLWIVSDNVRKGAALNAVLLGELL---------
USG_ECOLI       LSEE--NEFPTQVGDASGTPHLSVGCVRNDYGMPEQVQFWSVADNVRFGGALMAVKIAEKL---------
DHAS_METTH      VVRDEENRPQPRMDRDMGGMAVTVGRLREDAAFKNSLRYVLVGHNTVRGAAGASILNAELINE-------
DHAS_YEAST      YKLG-CHSAPKQTIHVLEQPDVSVGRIREDLD----FKMVVLSHNTIIGAAGSGVLIAEILLARNLI---
DHAS_BUCAI      --QDTLLKLTPSSV--TGTLNIPIGRLRKLNMGKKYLSAFTVGDQLLWGAA-------------------
DHAS_NEIMA      KKEASIHELTPAKV--TGTLSVPVGRIRKLEMGGEYISAFTVGDQLLWGAA-------------------
DHAS_HAEIN      IPNDTLRELTPAKV--TGTLSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAA-------------------
DHAS_BUCAP      --DVIPNNMQKTLCNLTPSTDTLIGRLRKLNIDDRYLSAFTVGDQLLWGAA-------------------
DHAS_LEPIN      ----------------------------------------------------------------------
DHAS_LEPIC      ----------------------------------------------------------------------
DHAS_ECOL6      VPNDTMRELTPAAV--TGTLTTPVGRLRKLNMGPEFLSAFTVGDQLLWGAA-------------------
DHAS_SHIFL      VPNDTMRELTPAAV--TGTLTTPVGRLRKLNMGPEFLSAFTVGDQLLWGAA-------------------
DHAS_NEIMB      KKEASIHELTPAKV--TGTLSVPVGRIRKLGMGGEYISAFTVGDQLLWGAA-------------------
DHAS_ECOLI      VPNDTMRELTPAAV--TGTLTTPVGRLRKLNMGPEFLSAFTVGDQLLWGAA-------------------
DHAS_ECO57      VPNDTMRELTPAAV--TGTLTTPVGRLRKLNMGPEFLSAFTVGDQLLWGAA-------------------
DHAS_SALTY      VRDITMRELTPAAV--TGTLTTPVGRLRKLNMGPEFLSAFTVGDQLLWGAA-------------------
DHAS_SALTI      VRDITMRELTPAAV--TGTLTTPVGRLRKLNMGPEFLSAFTVGDQLLWGAA-------------------
DHAS_BUCBP      -KHDTMTELTPAAV--TGTLNTPVGRLRKLNIGQKYLSAFTVGDQLLWGAS-------------------
DHAS_PSEAE      LREVSVRELTPAAV--TGTLSVPVGRLRKLNMGSQYLGAFTVGDQLLWGAAEPLRRMLRILLER------
DHAS_BORPE      -KEDTVKALTPVAV--TGTLDIPVGRLRKLSMGLQYLGAFTVGDQLLWGAA-------------------
DHAS_ACTPL      ----------------------------------------------------------------------
USG_HAEIN       ----------------------------------------------------------------------
DHAS_AZOVI      LREASMQELSPAAI--TGTLTVPVGRLRKLNMGSQYLGAFTVGDQLLWGAA-------------------
ARGC_BACSU      ----------------------------------------------------------------------
G3PA_GUITH      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           AELKFELK
DHAS_STRMU      SELKFELK
DHAS_BACSU      --------
DHAS_AQUAE      --------
DHAS_LEGPN      --------
DHAS_SHEVI      --------
DHAS_SHESP      --------
DHAS_VIBCH      --------
DHAS_PROMA      --------
DHAS_SYNY3      --------
DHAS_CAMJE      --------
DHAS_HELPJ      --------
DHAS_HELPY      --------
DHAS_VIBMI      --------
DHAS_MYCSM      --------
DHAS_STRAK      --------
DHAS_CORFL      --------
DHAS_CORML      --------
DHAS_CORGL      --------
DHAS_RICCN      --------
DHAS_RICTY      --------
DHAS_RICFE      --------
DHAS_RICBR      --------
DHAS_MYCTU      --------
DHAS_MYCBO      --------
DHAS_RICPR      --------
DHAS_METJA      --------
USG_AZOVI       --------
DHAS_ARCFU      --------
USG_PSEAE       --------
USG_ECOLI       --------
DHAS_METTH      --------
DHAS_YEAST      --------
DHAS_BUCAI      --------
DHAS_NEIMA      --------
DHAS_HAEIN      --------
DHAS_BUCAP      --------
DHAS_LEPIN      --------
DHAS_LEPIC      --------
DHAS_ECOL6      --------
DHAS_SHIFL      --------
DHAS_NEIMB      --------
DHAS_ECOLI      --------
DHAS_ECO57      --------
DHAS_SALTY      --------
DHAS_SALTI      --------
DHAS_BUCBP      --------
DHAS_PSEAE      --------
DHAS_BORPE      --------
DHAS_ACTPL      --------
USG_HAEIN       --------
DHAS_AZOVI      --------
ARGC_BACSU      --------
G3PA_GUITH      --------