[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for spne4:ACF56337.1

[Show Plain Result]


## Summary of Sequence Search
    1::269
   18::259     4e-19  26%  279 aa  Y189_CLOPE RecName: Full=Uncharacterized HTH-type transcriptional
   17::217     4e-13  29%  288 aa  Y143_HAEIN RecName: Full=Uncharacterized HTH-type transcriptional
   18::212     2e-12  26%  283 aa  Y191_CLOAB RecName: Full=Uncharacterized HTH-type transcriptional
    6::260     3e-12  24%  282 aa  YARA_PROST RecName: Full=Uncharacterized HTH-type transcriptional
   16::222     1e-11  25%  296 aa  RPIR_ECOLI RecName: Full=HTH-type transcriptional regulator
   16::222     1e-11  25%  296 aa  RPIR_ECOL6 RecName: Full=HTH-type transcriptional regulator
   18::217     6e-11  26%  285 aa  YFET_ECOLI RecName: Full=Uncharacterized HTH-type transcriptional
  376::550     6e-11  28%  641 aa  GLK_BURTA RecName: Full=Bifunctional protein glk;Includes:
  376::550     6e-11  29%  642 aa  GLK_BURS3 RecName: Full=Bifunctional protein glk;Includes:
  376::550     6e-11  28%  641 aa  GLK_BURPS RecName: Full=Bifunctional protein glk;Includes:
  376::550     6e-11  28%  641 aa  GLK_BURP1 RecName: Full=Bifunctional protein glk;Includes:
  376::550     6e-11  29%  642 aa  GLK_BURCA RecName: Full=Bifunctional protein glk;Includes:
  377::551     8e-11  28%  638 aa  GLK_BURXL RecName: Full=Bifunctional protein glk;Includes:
  385::550     2e-10  27%  641 aa  GLK_BURMA RecName: Full=Bifunctional protein glk;Includes:
   39::254     7e-10  26%  254 aa  GLVR_BACSU RecName: Full=HTH-type transcriptional regulator
    3::210     1e-09  22%  282 aa  Y211_THETN RecName: Full=Uncharacterized HTH-type transcriptional
    6::211     2e-09  24%  283 aa  YBBH_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
    2::210     2e-09  22%  285 aa  HEXR_PSEAE RecName: Full=HTH-type transcriptional regulator
    3::210     3e-09  24%  289 aa  HEXR_ECOLI RecName: Full=HTH-type transcriptional regulator
    7::213     5e-09  26%  282 aa  YFHH_ECOLI RecName: Full=Uncharacterized HTH-type transcriptional
    2::211     7e-07  25%  280 aa  Y326_THEMA RecName: Full=Uncharacterized HTH-type transcriptional
  268::368     8e-06  24%  599 aa  GLMS_METMP RecName: Full=Glucosamine--fructose-6-phosphate
  749::868     1e-05  28% 1099 aa  GLMS_METJA RecName: Full=Glucosamine--fructose-6-phosphate
    6::112     1e-04  28%  181 aa  PHI_METAM RecName: Full=3-hexulose-6-phosphate isomerase;       
    7::146     1e-04  33%  192 aa  GMHA_HELP2 RecName: Full=Phosphoheptose isomerase;       
   25::98      2e-04  36%  197 aa  Y249_METTH RecName: Full=Uncharacterized protein MTH_249;
   32::103     2e-04  25%  110 aa  Y2743_CLOBJ RecName: Full=UPF0122 protein CLM_2743;
   32::103     2e-04  25%  110 aa  Y2675_CLOB6 RecName: Full=UPF0122 protein CLJ_B2675;
   32::103     2e-04  25%  110 aa  Y2506_CLOBL RecName: Full=UPF0122 protein CLI_2506;
   32::103     2e-04  25%  110 aa  Y2450_CLOBH RecName: Full=UPF0122 protein CBO2450/CLC_2298;
   32::103     2e-04  25%  110 aa  Y2314_CLOB1 RecName: Full=UPF0122 protein CLB_2314;
   32::103     2e-04  25%  110 aa  Y2190_CLOBK RecName: Full=UPF0122 protein CLD_2190;
   32::103     2e-04  25%  110 aa  Y1827_CLOBM RecName: Full=UPF0122 protein CLK_1827;
  277::366     3e-04  32%  598 aa  GLMS_PYRFU RecName: Full=Glucosamine--fructose-6-phosphate
   14::128     3e-04  29%  340 aa  FRLB_SHIFL RecName: Full=Fructoselysine 6-phosphate deglycase;     
   14::128     3e-04  29%  340 aa  FRLB_ECOLI RecName: Full=Fructoselysine 6-phosphate deglycase;     
   31::130     4e-04  31%  212 aa  Y1940_AERPE RecName: Full=Uncharacterized protein APE_1940.1;
  116::167     4e-04  42%  294 aa  MURQ_BACWK RecName: Full=N-acetylmuramic acid 6-phosphate etherase;
   76::163     6e-04  36%  295 aa  MURQ_STAS1 RecName: Full=N-acetylmuramic acid 6-phosphate etherase;
  120::166     6e-04  45%  297 aa  MURQ_LACLA RecName: Full=N-acetylmuramic acid 6-phosphate etherase;
    7::146     8e-04  32%  192 aa  GMHA_HELPJ RecName: Full=Phosphoheptose isomerase;       
  260::364     8e-04  24%  602 aa  GLMS_PYRAE RecName: Full=Glucosamine--fructose-6-phosphate
  247::373     8e-04  28%  608 aa  GLMS_CLOTE RecName: Full=Glucosamine--fructose-6-phosphate
   14::128     8e-04  29%  340 aa  FRLB_ECO57 RecName: Full=Fructoselysine 6-phosphate deglycase;     
    7::146     0.001  32%  192 aa  GMHA_HELPH RecName: Full=Phosphoheptose isomerase;       
    7::145     0.001  31%  189 aa  GMHA_ARCB4 RecName: Full=Phosphoheptose isomerase;       
    1::269

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxQKELIPMIEANLPNMAYAEKDIAKFFLKQQPLNDYSSKALCEYLNVSKATLTRFAKKCGFKGFRQFI
Y189_CLOPE      ---EKTLIEYIKSDLDNIIYKSISI-----------------IAKESGVGEATITRFTKKLGFNGFQDFK
Y143_HAEIN      ----------------SLTKSEKKIADTILRSPDLSQCSLSEIAKHLQVGEATLVRFCRTIGFKGFSEFK
Y191_CLOAB      --------------------SERKIAEYILNNKAISDLSIKELAGKSGSSKSAVVRLCKILNYKGYKEFI
YARA_PROST      ------LTSKLESLLNRGKGTEQRLARFLLDSRDNFVAMNVALAQAAGVSSASVIRFTRQMGYRGYSDFK
RPIR_ECOLI      ------LAPYLRMKQEGMTENESRIVEWLLKPGNLSCAPAKDVAEALAVSEAMIVKVSKLLGFSGFRNLR
RPIR_ECOL6      ------LAPYLRMKQEGMTENESRIVEWLLKPGNLSCAPAKDVAEALAVSEAMIVKVSKLLGFSGFRNLR
YFET_ECOLI      ---------------------EQKIADFLQANSELQSVSSRQMAKQLGISQSSIVKFAQKLGAQGFTELI
GLK_BURTA       ---------------------------------PIVDIARKA-----DVSQPTVIRFCRSLGCQGLSDFK
GLK_BURS3       ---------------------------------PIVDIARKA-----DVSQPTVIRFCRSLGCQGLSDFK
GLK_BURPS       ---------------------------------PIVDIARKA-----DVSQPTVIRFCRSLGCQGLSDFK
GLK_BURP1       ---------------------------------PIVDIARKA-----DVSQPTVIRFCRSLGCQGLSDFK
GLK_BURCA       ---------------------------------PIVDIARKA-----DVSQPTVIRFCRSLGCQGLSDFK
GLK_BURXL       ---------------------------------PIVDIARKA-----DVSQPTVIRFCRSLGCQGLSDFK
GLK_BURMA       -----------------------------------------------DVSQPTVIRFCRSLGCQGLSDFK
GLVR_BACSU      -----------------------------------------ALAKACSVSRSSILRLAQKLGFSGYSEFF
Y211_THETN      -----DVLAVIREMSSSFTPSEAKIAKYILENPTVTELSVNELANACDTSEASIIRFCRTIGLKGFQELK
YBBH_BACSU      -------LAIIQSMKHKLPPSERKLADYILAESTVNEISALA-----NSSDAAVIRLCKSLGLKGFQDLK
HEXR_PSEAE      ----KNLLEQIQSRLDELNKAERKVAEVILQNQQATRFSIXXXXXXXXVSEPTVNRFCRSFGMSGYPELK
HEXR_ECOLI      ------MLEKIQSQLEHLSKSERKVAEVILASPDNAIHSSAAMALEANVSEPTVNRFCRSMDTRGFPDFK
YFHH_ECOLI      ----------IRQRYQGLAQSDKKLADYLLLQDTARHLSSQQLANEAGVSQSSVVKFAQKLGYKGFPXXX
Y326_THEMA      -----DVIQRIKEKYDEFTNAEKKIADTILSESSISDLSEKAGVK----SEASVVKFYKKLGLNSFQQFK
GLMS_METMP      ----------------------------------------------------------------------
GLMS_METJA      ----------------------------------------------------------------------
PHI_METAM       ----------------------------------------------------------------------
GMHA_HELP2      ----------------------------------------------------------------------
Y249_METTH      ----------------------------------------------------------------------
Y2743_CLOBJ     -----------------------------------NDYSLKEISELTNTSRQAVHDIVKRC-----HKAL
Y2675_CLOB6     -----------------------------------NDYSLKEISELTNTSRQAVHDIVKRC-----HKAL
Y2506_CLOBL     -----------------------------------NDYSLKEISELTNTSRQAVHDIVKRC-----HKAL
Y2450_CLOBH     -----------------------------------NDYSLKEISELTNTSRQAVHDIVKRC-----HKAL
Y2314_CLOB1     -----------------------------------NDYSLKEISELTNTSRQAVHDIVKRC-----HKAL
Y2190_CLOBK     -----------------------------------NDYSLKEISELTNTSRQAVHDIVKRC-----HKAL
Y1827_CLOBM     -----------------------------------NDYSLKEISELTNTSRQAVHDIVKRC-----HKAL
GLMS_PYRFU      ----------------------------------------------------------------------
FRLB_SHIFL      ----------------------------------------------------------------------
FRLB_ECOLI      ----------------------------------------------------------------------
Y1940_AERPE     ----------------------------------------------------------------------
MURQ_BACWK      ----------------------------------------------------------------------
MURQ_STAS1      ----------------------------------------------------------------------
MURQ_LACLA      ----------------------------------------------------------------------
GMHA_HELPJ      ----------------------------------------------------------------------
GLMS_PYRAE      ----------------------------------------------------------------------
GLMS_CLOTE      ----------------------------------------------------------------GYDHFM
FRLB_ECO57      ----------------------------------------------------------------------
GMHA_HELPH      ----------------------------------------------------------------------
GMHA_ARCB4      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           FKYQEMIHEKEKLALYTEATEKVLSDYEEMLRKTYTVLDEVQLERIAEMIETAERVYLYGKGSSVLALQE
Y189_CLOPE      VTLAKEISNKKNTSIITETANKMLKSSINILEQTVKQIDLDLMCKCRDLIMNAKRVYFIGIGYSGIAATD
Y143_HAEIN      LELSIELATKDNQDESILETEIMPSDDSTIAQKLQTAVANVMEETIXXXXXXARRIFLFGVGSSGVTAED
Y191_CLOAB      AIAKDTVNVDKEENRYTDINPKISYNNKKSIDNTMEVLSEELVEKASEAISKAYRVDFYGIGASYIVAMD
YARA_PROST      VDYDEKQYKAESLSGSLDDTEQIIAKSGQMIEKSLELLDPNTMDEIAQKIVEAKRIVLFGVGTSAIVAYD
RPIR_ECOLI      SALEDYFSQSEQVLAFDEAPQDVVNKVFNITLRTISIVNVDEIHXXXXXXXXXXXXDLYGAGGSNAICAD
RPIR_ECOL6      SALEDYFSQSEQVLAFDEAPQDVVNKVFNITLRTISIVNVDEIHXXXXXXXXXXXXDLYGAGGSNAICAD
YFET_ECOLI      GEYSASREKTNATALHLHSSRKLNREKELALEQTCALLDYARLQKIIEVISKAPFIQITGLGGSALVGRD
GLK_BURTA       LKLATMSHSQVHLGTATDFGAKVLDNTVSAILQLREHLNFEHVEQAIDILNNARRIEFYGLGNSNIVAQD
GLK_BURS3       LKLATMSHSQVHLGTATDFGAKVLDNTVSAILQLREHLNFEHVENAIEILNGARRIEFYGLGNSNIVAQD
GLK_BURPS       LKLATMSHSQVHLGTATDFGAKVLDNTVSAILQLREHLNFEHVEQAIDILNNARRIEFYGLGNSNIVAQD
GLK_BURP1       LKLATMSHSQVHLGTATDFGAKVLDNTVSAILQLREHLNFEHVEQAIDILNNARRIEFYGLGNSNIVAQD
GLK_BURCA       LKLATMSHSQVHLGTATDFGAKVLDNTVSAILQLREHLNFEHVENAIEILNGARRIEFYGLGNSNIVAQD
GLK_BURXL       LKLATGLHSQVHLGTATDFGAKVLDNTVSAILQLREHLNFEHVERAIDLLNGARRIEFYGLGNSNIVAQD
GLK_BURMA       LKLATMSHSQVHLGTATDFGAKVLDNTVSAILQLREHLNFEHVEQAIDILNNARRIEFYGLGNSNIVAQD
GLVR_BACSU      LKWEDQPEEGESMSF-----EKLLDDIEANLK----FLRTKDMTDMCQLIDAADRIFVYGSGNAARDLQR
Y211_THETN      IKIASLAKQTRKLGITSEVIQKIANFNKQAIDSTIAVXXXXXXXXXXXXXXXXXXIDFYGVAASGVVAYD
YBBH_BACSU      MRYRDIVPHEPLPSI----SEKTAGNAIQAIQDTSDLMDYKELERAVSLLLKAHTVHFIGLGASGIVAKD
HEXR_PSEAE      IQLAQSL--ASGAAFVTQATRKIFSNTIASLDSAHKLLDPRVIDRAVDLLIQARQIHFFGLGASASVALD
HEXR_ECOLI      LHLAQSVNEDDSVESYTG---KIFESAMATLDHVRHSLDKSAINRAVDLLTQAKKIAFFGLGSSAAVAHD
YFHH_ECOLI      XXXXXXXXESPSVPIHNQVGEKLIKENTAAMYATLNVNSEEKLHECVTMLRSARRIILTGIGASGLVAQN
Y326_THEMA      VLLAQSISRAPLEIVYEDVTEKIFKATVRAILDTLNWLDIDSIERTVDLFKNAQRXXXXXXXXXXXXXXX
GLMS_METMP      ---------------------------EPVILKNSMKISKLEIENLGKEIEKCDKIYITAMGTSLHAAMV
GLMS_METJA      ------ISSAEKMG-YPHFMLKEIMEQPEVLKVSAKISAE-EIKELAKCIKDYDRVYFVAMGTSLHAAMV
PHI_METAM       --------------------ELVVSKLTNVINNTAEGYDD----KILSLVDAAGRTFIGGAGRSLLVSRF
GMHA_HELP2      --------QKEFLA-HKEALKKSLESLQEMLKQSVHLL--------IETLENQGKILICGNGGSASDAQH
Y249_METTH      -------------------------------------VDEAELEMMISKIMDASSVFIVGTGRSELIGKA
Y2743_CLOBJ     LQYEEKLHMMERFINLENSKEKLLNMLNKVTKENIKEIDHIK----------------------------
Y2675_CLOB6     IQYEEKLHMMERFINLENSKEKLLNMLNKVTKENIKEIDHIK----------------------------
Y2506_CLOBL     LQYEEKLHMMERFINLENSKEKLLNMLNKVTKENIKEIDHIK----------------------------
Y2450_CLOBH     LQYEEKLHMMERFINLENSKEKLLNMLNKVTKENIKEIDHIK----------------------------
Y2314_CLOB1     LQYEEKLHMMERFINLENSKEKLLNMLNKVTKENIKEIDHIK----------------------------
Y2190_CLOBK     LQYEEKLHMMERFINLENSKEKLLNMLNKVTKENIKEIDHIK----------------------------
Y1827_CLOBM     IQYEERLHMMERFINLENSKEKLLNMLNKVTKENIKEIDHIK----------------------------
GLMS_PYRFU      ------------------------------------------IKEVAEVVSNYDKIIMIGMGTSALVGKY
FRLB_SHIFL      -------------------TENMVQEVEKVLSHDVPLVHAIVEEMVKRDID---RIYFVACGSPLNAAQT
FRLB_ECOLI      -------------------TENMVQEVEKVLSHDVPLVHAIVEEMVKRDID---RIYFVACGSPLNAAQT
Y1940_AERPE     -------------------------------------INEIDVGQVDRFVGELERVYVMGAGRSGLVGKA
MURQ_BACWK      ----------------------------------------------------------------------
MURQ_STAS1      ------------------------------------------------VLDAAECVPTFNTSTNVIGLIA
MURQ_LACLA      ----------------------------------------------------------------------
GMHA_HELPJ      --------QKEFLA-HKEALEKSLESLQDALKQSVHLL--------IETLENQGKILICGNGGSASDAQH
GLMS_PYRAE      ---------------------KEIYEQPESLASTAAGLEPAQIETVANALLAARNVYIVGAGTSYHAGLT
GLMS_CLOTE      LKE---IHEQPKVIKDT-MTSRI------MLGKDIK-LDNIEISK--EQMEKINKIYIVACGTAYHAGLV
FRLB_ECO57      -------------------TENMVQEVEKVLSHDVPLVHTIVEEMVKRDID---RIYFVACGSPLNAAQT
GMHA_HELPH      --------QKEFLA-HKEALEKSLESLQEALKQSVHLL--------IETLENQGKILICGNGGSASDAQH
GMHA_ARCB4      ---------KEFLA-HQETIAKVIETMQEPLEKASKIA--------VETLKNGNKILLCGNGGSAADAQH


                         +         .         .         .         .         *         .:210
query           MKMRFMRLGVIGEVLSDEDMILWSSLLLNENCLVIGASISGQTDIVLEGLQKAADKGAKTVLMTTRKXXX
Y189_CLOPE      INYKFMRIGFTTVPVTDSHTMVIMSSITNDDDVIVAISNSGTTKEVIKTVKQAKENGTKIITLTEDSDNP
Y143_HAEIN      AKNKLMRIGFQVDASGNNHFMYMQAALLTSSDVAIGLSHSGYSAETAHTIKIAKQNGATTVALT------
Y191_CLOAB      AFQKFMRINKNVRATPDTHLQVEFASNLKKGDVAVAISYTGETKDTFESIKAAKEAGATTISVT------
YARA_PROST      IFYKLIRVNKYALFSPDLHVQLSYSSNVDADDLVIAITAKGNTPDINHMLKLANKKGCSTIVLTRFGQDE
RPIR_ECOLI      VQHKFLRIGVRCQAYPDAHIMMMSASLLQEGDVVLVVTHSGRTSDVKAAVELAKKNGAKIICIT------
RPIR_ECOL6      VQHKFLRIGVRCQAYPDAHIMMMSASLLQEGDVVLVVTHSGRTSDVKAAVELAKKNGAKIICIT------
YFET_ECOLI      LSFKLMKIGYRVACEADTHVQATVSQALKKGDVQIAISYSGSKKEIVLCAEAARKQGATVIAITS-----
GLK_BURTA       AHYKFFRFGIPTIAYGDLYMQAASAALLGKGDVIVAVSKSGRAPELLRVLDVAMQAGAKVIAITS-----
GLK_BURS3       AHYKFFRFGIPTIAYGDLYMQAASAALLGKGDVIVAVSKSGRAPELLRVLDVAMQAGAKVIAITS-----
GLK_BURPS       AHYKFFRFGIPTIAYGDLYMQAASAALLGKGDVIVAVSKSGRAPELLRVLDVAMQAGAKVIAITS-----
GLK_BURP1       AHYKFFRFGIPTIAYGDLYMQAASAALLGKGDVIVAVSKSGRAPELLRVLDVAMQAGAKVIAITS-----
GLK_BURCA       AHYKFFRFGIPTIAYGDLYMQAASAALLGKGDVIVAVSKSGRAPELLRVLDVAMQAGAKVIAITS-----
GLK_BURXL       AHYKFFRFGIPTIAYGDLYMQAASAALLGKGDVIVAVSKSGRAPELLRVLDVAMQAGAKVIAITS-----
GLK_BURMA       AHYKFFRFGIPTIAYGDLYMQAASAALLGKGDVIVAVSKSGRAPELLRVLDVAMQAGAKVIAITS-----
GLVR_BACSU      MFIPRHRYLILIED-TNEFNLMRDDFKVNDLFIII--SLSGETPELIPQARMLSAKGIPFISITNLKNNV
Y211_THETN      AMLKFSRINIPCTAYQDTHLQLTSAVNLKKGDVAFGISYSGATKEIVEAIQTAKEAGATTISLT------
YBBH_BACSU      AQQKWLRIHKQATAFTDTHLV--ASLIANKDDIVFAISFSGETQEIVELFAMAKEKGITTISLT------
HEXR_PSEAE      AQHKFFRFNLAVSAQADVLMQRMIASVAHTGDLFVVISYTGRTRELVEVAHLARENGASVLGLT------
HEXR_ECOLI      AMNKFFRFNV--PVVYSDDIVLMSCMNCSDGDVVVLISHTGRTKNLVELAQLARENDAMVIALTS-----
YFHH_ECOLI      FAWKLMKIGFNAAAVRDMHALLATVQASSPDDLLLAISYTG----VRRELNLAADEGGKVLAIT------
Y326_THEMA      XXHKFTRIGKNCLFSNDEHIIAAILATASPSDLLVAISHTGETISVVNFAKKAKEMKMPVVTIT------
GLMS_METMP      AEYWFSGLNKLVIPIDSSEFL--TKGIVDEKTLVIAITQSGETYDTMKAVKYAKEKGAKT----------
GLMS_METJA      VEYLFAKLGKL--VIACDASEFLNKGVVDDKTLVIGITQSGETYDTLKALRFAKKNKAKT----------
PHI_METAM       FAMRLVHAGMVGEVVTPS---------IQAGDLFIVISGSGSTETLMPLVKKAKSQGAKIIVISMK----
GMHA_HELP2      FRYKLERKGLSAISLSTDTSALTAEALGNKEDVLIGISTSGNSKNVLKAYEKAKDLGMKTLSLAGR----
Y249_METTH      FAMRLMHLGFKVHVVGD----VTTPAIRDEDCL-IAISGSGETKTV------------------------
Y2743_CLOBJ     ----------------------------------------------------------------------
Y2675_CLOB6     ----------------------------------------------------------------------
Y2506_CLOBL     ----------------------------------------------------------------------
Y2450_CLOBH     ----------------------------------------------------------------------
Y2314_CLOB1     ----------------------------------------------------------------------
Y2190_CLOBK     ----------------------------------------------------------------------
Y1827_CLOBM     ----------------------------------------------------------------------
GLMS_PYRFU      LFQRFTKTPVIVEEASEEDII-------DKDTLVVAITQSGETADTVAGIKLAKNKGAKVL---------
FRLB_SHIFL      AKHRFSDLQVYA--ISGWEFCDNTPYRLDDRCAVIGVSDYGKTEEVIKALELGRACGALTAAFTKR----
FRLB_ECOLI      AKHRFSDLQVYA--ISGWEFCDNTPYRLDDRCAVIGVSDYGKTEEVIKALELGRACGALTAAFTKR----
Y1940_AERPE     FAMRLLHLGFNSYVLGET--IVPS---VREGDLVVAISGSGRTKVIVTAAETAKQVGATVAAITT-----
MURQ_BACWK      ------------EELAKEDL---KSIGLNEKDTVIGIAASGRTPYVIGGLKYASSVGASTASISCNK---
MURQ_STAS1      GGQRAMTVAVEGESLAREDL---KHIHLNEKDVVIGIAASGSTPYVMGGLKCATEIGAHTVAIS------
MURQ_LACLA      --------------LGRQDLI---DLKLNENDLVLGIAASGRTPYVIGALDYAKEIGAKTASLS------
GMHA_HELPJ      FRYKLERKGLSVISLSTDTSALTAEALGNKEDILIGISTSGNSKNVLKAYEKAKDLGMKTLSLAGR----
GLMS_PYRAE      LAFILPRLRITPIPVISSEYAIYED-LYDKDDLAIAISQSGETIDTIKAVKAMRERG-------------
GLMS_CLOTE      GKYTIEKLARIPVEVDIASEFRYKNPIIDKDTLMIVISQSGETADTLAALREAKKKGARVIAVT------
FRLB_ECO57      AKHRFSDLQVYA--ISGWEFCDNTPYRLDARCAVIGVSDYGKTEEVIKALELGRACGALTAAFTKR----
GMHA_HELPH      FRYKLERKGLSAISLNTDTSALTAEALGVKNDVLIGISTSGNSKNVLKAYEKAKDLGMKTLSLAGR----
GMHA_ARCB4      FRYKTERRGLPGIALTTDTSALTAEALASKGDLLIGISTSGNSTNVINALKVARDLGCKTIGLTGR----


                         .         .         .         +         .         .         .:280
query           XXXXXXXXXXXASTDHLSYGNRISPQFPILLITDCLFSNYLESPERQYYYNQxxxxxxx
Y189_CLOPE      LRKLSDYELTYTSAETIFETGSISSKIPQIFLLDLLYTEVIK-----------------
Y143_HAEIN      -----------------------------------------------------------
Y191_CLOAB      -----------------------------------------------------------
YARA_PROST      AVRLADLVLPYFYDEQLFQTGVITPQVLQMVVFDTLFFKYL------------------
RPIR_ECOLI      -----------------------------------------------------------
RPIR_ECOL6      -----------------------------------------------------------
YFET_ECOLI      -----------------------------------------------------------
GLK_BURTA       -----------------------------------------------------------
GLK_BURS3       -----------------------------------------------------------
GLK_BURPS       -----------------------------------------------------------
GLK_BURP1       -----------------------------------------------------------
GLK_BURCA       -----------------------------------------------------------
GLK_BURXL       -----------------------------------------------------------
GLK_BURMA       -----------------------------------------------------------
GLVR_BACSU      LAQLTPHNLYATSKPTLSDRTEIVAFAPFFLVGEALFRAYVDYKEAEKNDNE-------
Y211_THETN      -----------------------------------------------------------
YBBH_BACSU      -----------------------------------------------------------
HEXR_PSEAE      -----------------------------------------------------------
HEXR_ECOLI      -----------------------------------------------------------
YFHH_ECOLI      -----------------------------------------------------------
Y326_THEMA      -----------------------------------------------------------
GLMS_METMP      -----------------------------------------------------------
GLMS_METJA      -----------------------------------------------------------
PHI_METAM       -----------------------------------------------------------
GMHA_HELP2      -----------------------------------------------------------
Y249_METTH      -----------------------------------------------------------
Y2743_CLOBJ     -----------------------------------------------------------
Y2675_CLOB6     -----------------------------------------------------------
Y2506_CLOBL     -----------------------------------------------------------
Y2450_CLOBH     -----------------------------------------------------------
Y2314_CLOB1     -----------------------------------------------------------
Y2190_CLOBK     -----------------------------------------------------------
Y1827_CLOBM     -----------------------------------------------------------
GLMS_PYRFU      -----------------------------------------------------------
FRLB_SHIFL      -----------------------------------------------------------
FRLB_ECOLI      -----------------------------------------------------------
Y1940_AERPE     -----------------------------------------------------------
MURQ_BACWK      -----------------------------------------------------------
MURQ_STAS1      -----------------------------------------------------------
MURQ_LACLA      -----------------------------------------------------------
GMHA_HELPJ      -----------------------------------------------------------
GLMS_PYRAE      -----------------------------------------------------------
GLMS_CLOTE      -----------------------------------------------------------
FRLB_ECO57      -----------------------------------------------------------
GMHA_HELPH      -----------------------------------------------------------
GMHA_ARCB4      -----------------------------------------------------------