[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for spne4:ACF56413.1

[Show Plain Result]


## Summary of Sequence Search
    1::240
    1::227     6e-42  43%  235 aa  RSUA_YERPE RecName: Full=Ribosomal small subunit pseudouridine
    1::227     2e-41  42%  231 aa  RSUA_SALTY RecName: Full=Ribosomal small subunit pseudouridine
    1::227     2e-41  42%  231 aa  RSUA_SALTI RecName: Full=Ribosomal small subunit pseudouridine
    1::227     4e-41  42%  231 aa  RSUA_SHIFL RecName: Full=Ribosomal small subunit pseudouridine
    1::227     4e-41  42%  231 aa  RSUA_ECOLI RecName: Full=Ribosomal small subunit pseudouridine
    1::227     4e-41  42%  231 aa  RSUA_ECOL6 RecName: Full=Ribosomal small subunit pseudouridine
    1::227     4e-41  42%  231 aa  RSUA_ECO57 RecName: Full=Ribosomal small subunit pseudouridine
    1::226     3e-39  41%  231 aa  RSUA_VIBCH RecName: Full=Ribosomal small subunit pseudouridine
    1::229     1e-38  39%  233 aa  RSUA_VIBVU RecName: Full=Ribosomal small subunit pseudouridine
    1::229     2e-35  37%  233 aa  RSUA_VIBPA RecName: Full=Ribosomal small subunit pseudouridine
    4::246     3e-35  38%  249 aa  Y361_SYNY3 RecName: Full=Uncharacterized RNA pseudouridine synthase
    4::232     8e-34  34%  249 aa  Y1464_AQUAE RecName: Full=Uncharacterized RNA pseudouridine
    1::227     2e-33  37%  230 aa  RSUA_PSEAE RecName: Full=Ribosomal small subunit pseudouridine
    3::235     8e-32  36%  244 aa  RLUB_BACSU RecName: Full=Ribosomal large subunit pseudouridine
    1::230     2e-31  35%  232 aa  RSUA_HAEIN RecName: Full=Ribosomal small subunit pseudouridine
    4::240     3e-30  36%  312 aa  RLUB_VIBPA RecName: Full=Ribosomal large subunit pseudouridine
    4::240     4e-30  37%  321 aa  RLUB_VIBCH RecName: Full=Ribosomal large subunit pseudouridine
    1::139     1e-28  47%  157 aa  YTZF_BACSU RecName: Full=Uncharacterized RNA pseudouridine synthase
    4::241     2e-28  36%  318 aa  RLUB_YERPE RecName: Full=Ribosomal large subunit pseudouridine
    4::240     4e-28  36%  320 aa  RLUB_VIBVU RecName: Full=Ribosomal large subunit pseudouridine
    7::229     7e-28  34%  290 aa  RLUF_ECOLI RecName: Full=Ribosomal large subunit pseudouridine
    8::229     2e-27  32%  289 aa  RLUF_SALTI RecName: Full=Ribosomal large subunit pseudouridine
    1::215     2e-27  36%  238 aa  Y554_AQUAE RecName: Full=Uncharacterized RNA pseudouridine synthase
    8::229     2e-27  32%  289 aa  RLUF_SALTY RecName: Full=Ribosomal large subunit pseudouridine
    7::229     2e-27  34%  290 aa  RLUF_ECOL6 RecName: Full=Ribosomal large subunit pseudouridine
    7::229     2e-27  34%  290 aa  RLUF_ECO57 RecName: Full=Ribosomal large subunit pseudouridine
    7::229     3e-27  34%  290 aa  RLUF_SHIFL RecName: Full=Ribosomal large subunit pseudouridine
    4::241     6e-27  35%  291 aa  RLUB_ECOL6 RecName: Full=Ribosomal large subunit pseudouridine
    4::241     7e-27  35%  290 aa  RLUB_SHIFL RecName: Full=Ribosomal large subunit pseudouridine
    4::241     7e-27  35%  291 aa  RLUB_ECOLI RecName: Full=Ribosomal large subunit pseudouridine
    4::241     7e-27  35%  290 aa  RLUB_ECO57 RecName: Full=Ribosomal large subunit pseudouridine
    4::241     1e-26  34%  291 aa  RLUB_SALTY RecName: Full=Ribosomal large subunit pseudouridine
    4::241     1e-26  34%  291 aa  RLUB_SALTI RecName: Full=Ribosomal large subunit pseudouridine
   77::314     4e-26  36%  357 aa  RLUB_HAEIN RecName: Full=Ribosomal large subunit pseudouridine
    1::227     5e-26  33%  232 aa  RSUA_PASMU RecName: Full=Ribosomal small subunit pseudouridine
   15::254     1e-25  33%  386 aa  RLUB_PSEAE RecName: Full=Ribosomal large subunit pseudouridine
   14::234     5e-25  34%  240 aa  RLUE_HAEIN RecName: Full=Ribosomal large subunit pseudouridine
   14::245     1e-24  34%  254 aa  Y1738_MYCBO RecName: Full=Uncharacterized RNA pseudouridine
   14::245     1e-24  34%  254 aa  Y1711_MYCTU RecName: Full=Uncharacterized RNA pseudouridine
   65::302     3e-24  35%  345 aa  RLUB_PASMU RecName: Full=Ribosomal large subunit pseudouridine
   16::253     6e-24  34%  256 aa  Y1370_MYCLE RecName: Full=Uncharacterized RNA pseudouridine
    4::230     6e-24  28%  250 aa  RLUB_BUCAI RecName: Full=Ribosomal large subunit pseudouridine
   23::233     4e-23  34%  241 aa  RLUE_PASMU RecName: Full=Ribosomal large subunit pseudouridine
   15::231     1e-22  35%  234 aa  RLUE_VIBVU RecName: Full=Ribosomal large subunit pseudouridine
   65::236     2e-21  38%  238 aa  RLUE_VIBPA RecName: Full=Ribosomal large subunit pseudouridine
    4::233     2e-21  29%  257 aa  RLUB_BUCAP RecName: Full=Ribosomal large subunit pseudouridine
    3::228     3e-21  33%  230 aa  Y807_RICCN RecName: Full=Uncharacterized RNA pseudouridine synthase
   43::216     4e-21  39%  217 aa  RLUE_SHIFL RecName: Full=Ribosomal large subunit pseudouridine
   43::216     4e-21  39%  217 aa  RLUE_ECOLI RecName: Full=Ribosomal large subunit pseudouridine
   43::217     5e-21  38%  217 aa  RLUE_ECO57 RecName: Full=Ribosomal large subunit pseudouridine
   35::240     8e-21  35%  241 aa  RLUE_VIBCH RecName: Full=Ribosomal large subunit pseudouridine
   43::216     1e-20  39%  217 aa  RLUE_ECOL6 RecName: Full=Ribosomal large subunit pseudouridine
    3::225     5e-20  32%  229 aa  Y321_RICBR RecName: Full=Uncharacterized RNA pseudouridine synthase
   33::206     5e-20  36%  208 aa  RLUE_YERPE RecName: Full=Ribosomal large subunit pseudouridine
    3::228     7e-20  32%  229 aa  Y544_RICFE RecName: Full=Uncharacterized RNA pseudouridine synthase
   28::270     9e-20  32%  476 aa  RLUB_XYLFT RecName: Full=Ribosomal large subunit pseudouridine
   28::270     9e-20  32%  476 aa  RLUB_XYLFA RecName: Full=Ribosomal large subunit pseudouridine
   43::219     3e-19  35%  221 aa  RLUE_SALTY RecName: Full=Ribosomal large subunit pseudouridine
   43::219     3e-19  35%  221 aa  RLUE_SALTI RecName: Full=Ribosomal large subunit pseudouridine
    3::228     6e-19  31%  235 aa  Y544_RICPR RecName: Full=Uncharacterized RNA pseudouridine synthase
    4::176     1e-18  36%  190 aa  RLUE_XANAC RecName: Full=Ribosomal large subunit pseudouridine
    3::220     4e-18  32%  242 aa  Y532_RICTY RecName: Full=Uncharacterized RNA pseudouridine synthase
    6::251     6e-18  31%  262 aa  YE59_HELPJ RecName: Full=Uncharacterized RNA pseudouridine synthase
    4::175     6e-18  38%  187 aa  RLUE_XANCP RecName: Full=Ribosomal large subunit pseudouridine
   13::184     6e-18  34%  189 aa  RLUE_PSEAE RecName: Full=Ribosomal large subunit pseudouridine
   40::237     8e-18  38%  261 aa  Y612_SYNY3 RecName: Full=Uncharacterized RNA pseudouridine synthase
    6::251     8e-18  31%  262 aa  Y1459_HELPY RecName: Full=Uncharacterized RNA pseudouridine
    8::241     5e-17  27%  249 aa  Y129_BORBU RecName: Full=Uncharacterized RNA pseudouridine synthase
    4::240     2e-16  25%  247 aa  RLUB_BUCBP RecName: Full=Ribosomal large subunit pseudouridine
   29::271     7e-15  30%  492 aa  RLUB_XANCP RecName: Full=Ribosomal large subunit pseudouridine
   29::271     9e-14  29%  550 aa  RLUB_XANAC RecName: Full=Ribosomal large subunit pseudouridine
   16::182     6e-08  33%  303 aa  YLYB_BACSU RecName: Full=Uncharacterized RNA pseudouridine synthase
   27::257     6e-08  29%  316 aa  Y901_CHLAA RecName: Full=Uncharacterized RNA pseudouridine synthase
   12::143     4e-07  36%  309 aa  Y292_MYCPN RecName: Full=Uncharacterized RNA pseudouridine synthase
   32::242     1e-06  30%  325 aa  RLUD_VIBVU RecName: Full=Ribosomal large subunit pseudouridine
   10::148     3e-06  29%  246 aa  TRUC_VIBPA RecName: Full=tRNA pseudouridine synthase C;       
   24::281     3e-06  30%  320 aa  RLUC_HAEDU RecName: Full=Ribosomal large subunit pseudouridine
   24::185     4e-06  30%  318 aa  RLUC_PSEAE RecName: Full=Ribosomal large subunit pseudouridine
   32::180     6e-06  35%  324 aa  RLUD_VIBCH RecName: Full=Ribosomal large subunit pseudouridine
    6::144     9e-06  33%  244 aa  TRUC_VIBCH RecName: Full=tRNA pseudouridine synthase C;       
   32::180     9e-06  35%  325 aa  RLUD_YERPE RecName: Full=Ribosomal large subunit pseudouridine
    6::94      3e-05  35%  239 aa  TRUC_HAEIN RecName: Full=tRNA pseudouridine synthase C;       
    7::144     4e-05  30%  243 aa  TRUC_HAEDU RecName: Full=tRNA pseudouridine synthase C;       
    6::144     6e-05  28%  245 aa  TRUC_VIBVU RecName: Full=tRNA pseudouridine synthase C;       
   27::261     1e-04  30%  326 aa  RLUC_PASMU RecName: Full=Ribosomal large subunit pseudouridine
   90::206     1e-04  30%  404 aa  PUS6_YEAST RecName: Full=Pseudouridylate synthase 6;       
    7::98      2e-04  31%  243 aa  TRUC_PASMU RecName: Full=tRNA pseudouridine synthase C;       
  250::385     2e-04  24%  545 aa  RUSD2_HUMAN RecName: Full=RNA pseudouridylate synthase
    1::56      5e-04  43%   88 aa  Y007_STRR6 RecName: Full=Uncharacterized protein spr0007;
    1::56      5e-04  43%   88 aa  Y007_STRPN RecName: Full=Uncharacterized protein SP_0007;
   31::180     5e-04  30%  324 aa  RLUD_HAEIN RecName: Full=Ribosomal large subunit pseudouridine
  120::213     7e-04  31%  376 aa  TRUC_PECCC RecName: Full=tRNA pseudouridine synthase C;       
  201::290     7e-04  32%  369 aa  PUS5_ARATH RecName: Full=RNA pseudourine synthase 5;       
   97::181     9e-04  37%  325 aa  RLUD_HAEDU RecName: Full=Ribosomal large subunit pseudouridine
    1::240

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRLDKFLVACAVGSRTEVKNLLKAGRVTVNGKKEKSAKLQIDEKIDEIRFDGQVLEYEEFVYYMMNKPKG
RSUA_YERPE      MRLDKFLSQQLGVSRALVARELRAKRVTIDGEVVKSGAIKLTPEQD-VRFDGNPLQ--QMVYFMLNKPQG
RSUA_SALTY      MRLDKFIAQQLGVSRAIAGREIRGNRVTVDGDIIKNAAFKLLPE-HAVAYDGNPLAQQHGPYFMLNKPQG
RSUA_SALTI      MRLDKFIAQQLGVSRAIAGREIRGNRVTVDGDIIKNAAFKLLPE-HAVAYDGNPLAQQHGPYFMLNKPQG
RSUA_SHIFL      MRLDKFIAQQLGVSRAIAGREIRGNRVTVDGEIVRNAAFKLLPEHD-VAYDGNPLAQQHGPYFMLNKPQG
RSUA_ECOLI      MRLDKFIAQQLGVSRAIAGREIRGNRVTVDGEIVRNAAFKLLPEHD-VAYDGNPLAQQHGPYFMLNKPQG
RSUA_ECOL6      MRLDKFIAQQLGVSRAIAGREIRGNRVTVDGEIVRNAAFKLLPEHD-VAYDGNPLAQQHGPYFMLNKPQG
RSUA_ECO57      MRLDKFIAQQLGVSRAIAGREIRGNRVTVDGEIVRNAAFKLLPEHD-VAYDGNPLAQQHGPYFMLNKPQG
RSUA_VIBCH      MRLDKFLCDALGTTRKEATQLLKSGEVTVDDVVQKSGAFKLKET-SCVEWQGREITLHGPRYIMMHKPDG
RSUA_VIBVU      MRLDKFLCDALGATRKEATKILKSGEVTVNEQVQKSGAVKVTEEC-VVEWQGRELAMQGPRYIMLYKPEG
RSUA_VIBPA      MRLDKYLCDALGATRKQATKIIKSGEVLVDGEVQKSGSFKVPEG-GVVEWDGREVGAPGPRYIMLYKPAD
Y361_SYNY3      -RIQKLLSQWGIASRRHAEEMILAGRVSVNGKVANLGD-KADPQQDFLSVDGKQIKADNRIYLLVNKPRD
Y1464_AQUAE     VRINKFLSEAGVASRRKAEKLILEGRVKVNGEVVRSLGVKVNPEVDIVEVDGKPVKPQRKRYIILNKPCC
RSUA_PSEAE      MRLDRFLANLPELSRRDAQMLIAGGHLRVDGQVVRDGTHEV-RVFSRVELDERLLQAGKPAYYMLHKPMG
RLUB_BACSU      -RLQKVIAHAGVASRRKAEELIXXXXXXXXXXXXTELGVKVTGS-DQIEVNGLKVEREEPVYFLLYKPRG
RSUA_HAEIN      MRLDKFIAENVGLTRSQATKAIRQSAVKINGEIVKSGSVQISQE-DEIYFEDELLTWEEGQYFMLNKPQG
RLUB_VIBPA      -KLQKVLARAGHGSRREIESLIKSGRVSVNGVVAKLGE-RLEDESSVVRIDGHIVSQEEVICRVLAKPEG
RLUB_VIBCH      -KLQKVLARAGHGSRRELEALIRAGRVSVNGKVAVGERLEDDNAV--VRIDGHVVSVEEVICRVLAKPEG
YTZF_BACSU      ----------------------------------------------------------------------
RLUB_YERPE      -KLQKILARAGHGSRREIEAIIQQGRVSVDGKVSKLGDRVEVTQSTKIRLDGHLLSIKELAYY---KPEG
RLUB_VIBVU      -KLQKVLARAGHGSRRELEALIKSGRVSVNGIVAKLGERLEDEQA-VVRIDGHVVSVEEVICRVLAKPEG
RLUF_ECOLI      VRLNKYISESGICSRREADRYIEQGNVFLNGKRAT-----IGDQVDVVKVNGQLIEAEDLVLIALNKPVG
RLUF_SALTI      -RLNKYISESGICSRREADRFIEQGNVFINGKRAAIGDQVVAG--DVVKVNGRLIEPRELVLIALNKPVG
Y554_AQUAE      MRLDKYLSKSLHISRKEAKELIREGRVKVSGKVVKQAEYRXXXXXXXXXXXXXXXXXXN-VYLMLYKPKG
RLUF_SALTY      -RLNKYISESGICSRREADRFIEQGNVFINGKRAAIGDQVVAGDI--VKVNGRLIEPRELVLIALNKPVG
RLUF_ECOL6      VRLNKYISESGICSRREADRYIEQGNVFLNGKRAT-----IGDQVDVVKVNGQLIESEDLVLIALNKPVG
RLUF_ECO57      VRLNKYISESGICSRREADRYIEQGNVFLNGKRAT-----IGDQVDVVKVNGQLIEAEDLVLIALNKPVG
RLUF_SHIFL      VRLNKYISESGICSRREADRYIEQGNVFLNGKRAT-----IGDQVDIVKVNGQLIEAEDLVLIALNKPVG
RLUB_ECOL6      -KLQKVLARAGHGSRREIESIIEAGRVSVDGKIAKLGRVEITPGL-KIRIDGHLISVRELAYY---KPEG
RLUB_SHIFL      -KLQKVLARAGHGSRREIESIIEAGRVSVDGKIAKLGRVEVTPGL-KIRIDGHLISVRELAYY---KPEG
RLUB_ECOLI      -KLQKVLARAGHGSRREIESIIEAGRVSVDGKIAKLGRVEVTPGL-KIRIDGHLISVRELAYY---KPEG
RLUB_ECO57      -KLQKVLARAGHGSRREIESIIEAGRVSVDGKIAKLGRVEVTPGL-KIRIDGHLISVRELAYY---KPEG
RLUB_SALTY      -KLQKVLARAGHGSRREIESIIEAGRVSVDGKATLGDRVEVTPGL-KIRIDGHLISVKELAYY---KPEG
RLUB_SALTI      -KLQKVLARAGHGSRREIESIIEAGRVSVDGKATLGDRVEVTPGL-KIRIDGHLISVKELAYY---KPEG
RLUB_HAEIN      -KLQKVLARAGQGSRREIETMIAAGRVSVEGKIAT-----LGDRIDKVRIDGQIINLSHLMYY---KPEG
RSUA_PASMU      MRLDKFLAENTGLTRSQANKVLKQSAVTVNGHVEKNGAQKVSQT-DEICLEGEHLPWVSAQYLMLYKPQG
RLUB_PSEAE      -KLQKVLARLGVGSRRDVEVWIAEGRVNVNGSVASLGQ-RVDSH-DAITVDGHLIXXXXXXXXIYNKPEG
RLUE_HAEIN      -----------------MKKNFSAGKLPSKGKSAVNFHRTFKPKLKP-----KTLSLDETKVVLFNKPFD
Y1738_MYCBO     IRLQKVLSQAGIASRRAAEKMIVDGRVEVDGHVVTELGTRVDQXXXXXXXXXXXXXXXSLVYLALNKPRG
Y1711_MYCTU     IRLQKVLSQAGIASRRAAEKMIVDGRVEVDGHVVTELGTRVDQXXXXXXXXXXXXXXXSLVYLALNKPRG
RLUB_PASMU      -KLQKVLARAGQGSRREIEAMIAENRVSVDGKIAT-----LGDRIDKIRIDGHLIQKEVCRVLMYYKPEG
Y1370_MYCLE     VRLQKILSRAGIASRRAAEKLIIEGRVEVDGQLVRELGTRXXXXXXXXXXXXXXXXXXXXXXYLLNKPRG
RLUB_BUCAI      -KIQKILSHLGYGSRRNIENMIKFGDISINGKKIVIGQRLNNKNIEVITIKGETVSXXXXXXXXXNKPEG
RLUE_PASMU      --------------------------------KRKAAEIKPQKRPLSFR-QKKTVNFAETQVILFNKPYD
RLUE_VIBVU      --------------QTATKRFKQSGQASVGSPKRHSVKRKNNEQ------SKKSLSLAERKIIIFNKPYD
RLUE_VIBPA      ---------------------------------------------------------------IFNKPYD
RLUB_BUCAP      -KIQKILSDLGYGSRRFIECMIKCGKISINGEKAIIGQYLNKKNPGEILIDKKKIIVKRNKVLIYNKPIG
Y807_RICCN      -RLAKIISNAGVCSRRDAEKLIVAGQVKVDGITILSPTTNVDIS-NQIEVSGTLINNIHWIYY---KPVG
RLUE_SHIFL      ---------------------------------------------------------------LFNKPYD
RLUE_ECOLI      ---------------------------------------------------------------LFNKPYD
RLUE_ECO57      ---------------------------------------------------------------LFNKPYD
RLUE_VIBCH      ----------------------RANRKSVANKKKNATQTALSPK--------RPLSPAERKVILFNKPYD
RLUE_ECOL6      ---------------------------------------------------------------LFNKPYD
Y321_RICBR      -RLAKLISNAGICSRRDAEKLILDGQVKVNGIIVTSPATNVDTD-NQVEVSGSLITSSQWIYY---KPVG
RLUE_YERPE      ---------------------------------------------------------------LFNKPFD
Y544_RICFE      -RLAKIISNAGICSRRDAEKLILEGQVKVDGITILSPATNVDIS-NQIEVSGILINQSQWIYY---KPVG
RLUB_XYLFT      -RLHKVLAQAGLGSRRALEQRISNGLIKVNGD---IAQLGMSVKSDKIELDGRLTEPARVLIY--NKPEG
RLUB_XYLFA      -RLHKVLAQAGLGSRRALEQRISNGLIKVNGD---IAQLGMSVKSDKIELDGRLTEPARVLIY--NKPEG
RLUE_SALTY      ---------------------------------------------------------------LFNKPYD
RLUE_SALTI      ---------------------------------------------------------------LFNKPYD
Y544_RICPR      -RLAKIISNAGVCSRRNAEKLIVGGKVKIDGITILSPATNVDMS-NQIEVSGRLINNTQWIYY---KPVG
RLUE_XANAC      ---------------------------------------------------------------LLNKPYG
Y532_RICTY      -RLAKIISNAGVCSRRNAEKLIVGGKVKIDGITILSPATNVDIS-NQIEVSGRLINNIQWIYY---KPIG
YE59_HELPJ      LRINQFLAHYTKHSRREAEKLVLEGRVKINHEHAKLAS--VVKENDKVFLDKRLLKNKKFSVLVYHKPKG
RLUE_XANCP      ---------------------------------------------------------------LLNKPYG
RLUE_PSEAE      ---------------------------------------------------------------LFNKPFD
Y612_SYNY3      ---------------------------------------------------------QTIVFY---KPYG
Y1459_HELPY     LRINQFLAHYTKHSRREAEKLVLEGRVKINHEHAKLAS--VVKENDRVFLDKRLLKNKKFSVLVYHKPKG
Y129_BORBU      -RVHVFLAEKGVGSRRFCEELIRKKLVRVNNTIAK-----LGDKVDRIIYKKQIFVFKDFIYLALNKPRN
RLUB_BUCBP      -KIQKILARHGYGSRRYIESLIKSHSVKINDEVVKVGQXXXXXXXXXXXXXXXXXXXXSLKVLLYNKPEG
RLUB_XANCP      -RLHKVLAQAGLGSRRALEQRIADGLIKVNGAVAQTGMSV--RSGDKIELDGRLTESSRVLVY--NKPEG
RLUB_XANAC      -RLHKVLAQAGLGSRRALEQRIADGLIKVNGAVAQTGMSV--RSGDKIELDGRLTEPSRVLIY--NKPEG
YLYB_BACSU      -RIDKFLASTENDSRTQVQQWVKDGQVVVNGSAVKNYKIQPGDQVTVTVPEPEALDYEDQDVLVVNKPRG
Y901_CHLAA      -RIDRFLAGAMPDSRAQVQRLIEQGFVLYDGRSPRASQPVRPGAVIQLTIPPPIVVYEDADIAVINKPAG
Y292_MYCPN      -RLDTFLATLLNLSRVKVAKLIVDGLVSVNGKKTKNGWLVQPEDRVHVNWSEELFEYEDEQIMVVNKPNG
RLUD_VIBVU      -------------SRSRLKEWLLDGKVTVDGNVVTKPRTKVAELEDEVRWEAQDIPYEDDDILVINKPRD
TRUC_VIBPA      --------------------------------------------------------YQDEYFVAVNKPAG
RLUC_HAEDU      -RLDNFLLAKLKGPKSLIYRIVRKGEVRVNGRVKPDYKLQISTKLNKVAELEQHILYEDDVMLVLNKPSG
RLUC_PSEAE      -RIDNFLIARLKGAKTLIYRILRKGEVRVNGDQVRVPPLRLAERDEPAPLAQGLLEYEDKALIVVNKPXX
RLUD_VIBCH      -------------SRSRLKEWLLEGKIAVNGDVITKPRTKVAELEDEQRWEAQDLPYEDDDIIVINKPRD
TRUC_VIBCH      --------------------------------------------------------YQDEYLVAVNKPAG
RLUD_YERPE      -------------SRSRIKEWILDSRVTVNGKKINKPKVAIDAQIEEARWAPQEIPYEDNDILVINKPRG
TRUC_HAEIN      --------------------------------------------------------YQDGFLVAVNKPAG
TRUC_HAEDU      --------------------------------------------------------YRDDELIAINKPAG
TRUC_VIBVU      --------------------------------------------------------YQDEYFVAVNKPAG
RLUC_PASMU      -RIDNYLLAKLKGPKSLIYRILRKGEVRVNGRIKPEYKLQISTKLNKVQLEKQIL-FEDECLLVLNKPSG
PUS6_YEAST      ---------------------------TTTHKHEPPVKQWCSQEVEAEDLPGRIIVFEDESILVIDKPSG
TRUC_PASMU      --------------------------------------------------------YQDPYLIAVNKPAG
RUSD2_HUMAN     ----------------------------------------------------------------------
Y007_STRR6      MRLDKYLVSRIIKRRTVAKEVADKGRIKVNGILAKSSDLKVNDQV-EIRFGNKLL---------------
Y007_STRPN      MRLDKYLVSRIIKRRTVAKEVADKGRIKVNGILAKSSDLKVNDQV-EIRFGNKLL---------------
RLUD_HAEIN      -------------SRSRLKTWIEADLVKLNDRITNIPREKVXXXXDETRFEAENIPYEDDDIIVINKPKD
TRUC_PECCC      --------------------------------------------------------YQDEHLVAVNKPSG
PUS5_ARATH      ----------------------------------------------------------------------
RLUD_HAEDU      -----------------------------------------------------------------NKPKN


                         .         .         *         .         .         .         .:140
query           VISATEDPKHRTVLDLLDDLARSKEVFPVGRLDIDTHGLLLLTNNGQLAHVLLSPKRHVDKTYQAQVKGI
RSUA_YERPE      YVCSTEDPDHPTVLYFLDEPVAYK-LHAAGRLDIDTTGLVLMTDDGQWSHRVTSPRHHCEKTYLVTLEHP
RSUA_SALTY      YVCSTDDPDHPTVLYFLDEPVAYK-LHAAGRLDIDTTGLVLMTDDGQWSHRITSPRHHCEKTYLVTLESP
RSUA_SALTI      YVCSTDDPDHPTVLYFLDEPVAYK-LHAAGRLDIDTTGLVLMTDDGQWSHRITSPRHHCEKTYLVTLESP
RSUA_SHIFL      YVCSTDDPDHPTVLYFLDEPVAWK-LHAAGRLDIDTTGLVLMTDDGQWSHRITSPRHHCEKTYLVTLESP
RSUA_ECOLI      YVCSTDDPDHPTVLYFLDEPVAWK-LHAAGRLDIDTTGLVLMTDDGQWSHRITSPRHHCEKTYLVTLESP
RSUA_ECOL6      YVCSTDDPDHPTVLYFLDEPVAWK-LHAAGRLDIDTTGLVLMTDDGQWSHRITSPRHHCEKTYLVTLESP
RSUA_ECO57      YVCSTDDPDHPTVLYFLDEPVAWK-LHAAGRLDIDTTGLVLMTDDGQWSHRITSPRHHCEKTYLVTLESP
RSUA_VIBCH      VVCSHEDGFNQTALTLLDEV-NIQDLHFAGRLDVDTTGLLLITDDGQWSHRVTSPKHKCEKTYRVWLADP
RSUA_VIBVU      FVCSHEDGFNHTAFVLLDEV-KMDELHFAGRLDVDTTGLVLITDDGKWSHRITSPKHKCDKTYRVWLADP
RSUA_VIBPA      FVCSHEDGYNPTAFVLLDE-PKVENLHFAGRLDVDTTGLVLITDDGQWSHRITSPKHKCKKTYRVWLADA
Y361_SYNY3      VLSTCDDPRGRTVLDLLQDLQRGKGLHPVGRLDRNSTGALLLTNDGELTLRLTHPRYHLPKTYDVWLEGN
Y1464_AQUAE     YLTGRSPDGRKTIEELIKDIP--ERVFPVGRLDYNTEGLLILTNDGELANRILHPRYKLPKVYLALVEGK
RSUA_PSEAE      CVSATRDPQHPTVLDLFPEDLRD-DLHIGGRLDYNTTGLMLLTNDGQWSRRLTLPGSRRDKVYYVETEAP
RLUB_BACSU      VISAAQDDKGRKVVDFFKNIPQ--RIYPIGRLDYDTSGLLLLTNDGEFANKLMHPKYEIDKTYVAKVKGI
RSUA_HAEIN      CVCSNDDGDYPTIYQFFDYPLAGK-LHSAGRXXXXXXXXXXXXXXXQWSHRITSPKHHCEKTYLVTLADP
RLUB_VIBPA      ELCTRHDPERRTVFDRLPKIRGSRWI-SVGRLDANTSGLLLFTTDGELANRLMHPSRQVEREYLVRVFGE
RLUB_VIBCH      ELCTRHDPERRTVFDRLPKIRGSRWI-SVGRLDANTSGLLLFTTDGELANRLMHPSRQVEREYLVRVFGD
YTZF_BACSU      ------------MVDLLTPEEMRFEPFPAGRLDKDTEGFLLLTNDGQLAHRLLSPKKHVPKTYEVHLKSQ
RLUB_YERPE      ELCTRNDPEGRTVFDRLPKLRGSRWV-AVGRLDVNTSGLLLFTTDGELANRLMHPSREVEREYAVRVFGQ
RLUB_VIBVU      ELCTRHDPERRTVFDRLPKIRGSRWI-SVGRLDANTSGLLLFTTDGELANRLMHPSRQVEREYLVRVFGE
RLUF_ECOLI      IVSTTEDGERDNIVDFVN---HSKRVFPIGRLDKDSQGLIFLTNHGDLVNKILRAGNDHEKEYLVTVDKP
RLUF_SALTI      IVSTTEDGERDNIVDFVN---HSKRIFPIGRLDKDSQGLIFLTNHGDLVNKILRAGNDHEKEYLVTVDKP
Y554_AQUAE      YLSTTEDKKYPSFLELIREHFPSRKLFSAGRLDVDAEGLLLITDDGELAHRLTHPKWKVEKEYIVRLDRD
RLUF_SALTY      IVSTTEDGERDNIVDFVN---HSKRIFPIGRLDKDSQGLIFLTNHGDLVNKILRAGNDHEKEYLVTVDKP
RLUF_ECOL6      IVSTTEDGERDNIVDFVN---HSKRVFPIGRLDKDSQGLIFLTNHGDLVNKILRAGNDHEKEYLVTVDKP
RLUF_ECO57      IVSTTEDGERDNIVDFVN---HSKRVFPIGRLDKDSQGLIFLTNHGDLVNKILRAGNDHEKEYLVTVDKP
RLUF_SHIFL      IVSTTEDGERDNIVDFVN---HSKRVFPIGRLDKDSQGLIFLTNHGDLVNKILRAGNDHEKEYLVTVDKP
RLUB_ECOL6      ELCTRNDPEGRTVFDRLPKL-RGARWIAVGRLDVNTCGLLLFTTDGELANRLMHPSREVEREYAVRVFGQ
RLUB_SHIFL      ELCTRNDPEGRTVFDRLPKL-RGARWIAVGRLDVNTCGLLLFTTDGELANRLMHPSREVEREYAVRVFGQ
RLUB_ECOLI      ELCTRNDPEGRTVFDRLPKL-RGARWIAVGRLDVNTCGLLLFTTDGELANRLMHPSREVEREYAVRVFGQ
RLUB_ECO57      ELCTRNDPEGRTVFDRLPKL-RGARWIAVGRLDVNTCGLLLFTTDGELANRLMHPSREVEREYAVRVFGQ
RLUB_SALTY      ELCTRNDPEGRTVFDRLPKL-RGARWIAVGRLDVNTCGLLLFTTDGELANRLMHPSREVEREYAVRVFGQ
RLUB_SALTI      ELCTRNDPEGRTVFDRLPKL-RGARWIAVGRLDVNTCGLLLFTTDGELANRLMHPSREVEREYAVRVFGQ
RLUB_HAEIN      ELCTRSDPEGRTVFDRLPRLTGSRWI-AVGRLDINTSGLLLFTTDGELANRLMHPSREVEREYSVRVFGQ
RSUA_PASMU      YVCSHEDGDYPTIYQFFDYPLAGK-LHSAGRXXXXXXXXXXXXXXXKWSHRITSPKHHCEKTYLVTLADP
RLUB_PSEAE      EVCTRDDPEGRTIFDRLPRL-RTGRWINVGRLDINTTGLLLFTTDGELANRLMHPSYEMDREYAVRVRGE
RLUE_HAEIN      VLTQFTDEQGRATLK---DFISIPNVYAAGRLDRDSEGLLILTNNGELQHRLADPKFKTEKTYWVQVEGI
Y1738_MYCBO     MHSTMSDDRGRPCIDLIERKVRTKKLFHVGRLDADTEGLMLLTNDGELAHRLMHPSHEVPKTYLATVTGS
Y1711_MYCTU     MHSTMSDDRGRPCIDLIERKVRTKKLFHVGRLDADTEGLMLLTNDGELAHRLMHPSHEVPKTYLATVTGS
RLUB_PASMU      ELCTRHDPEGRTVFDRLPRLTGSRWI-AVGRLDINTSGLLLFTTDGELANRLMHPSREVEREYSVRVFGQ
Y1370_MYCLE     MYSTMSDDRGRPCVDLIERRVRNKKLFHVGRLDADTEGLILLTNDGELAHRLMHPSHEVSKTYLATVKGA
RLUB_BUCAI      EICTRNDYKKRPIVFDKLPLLNIHRWISIGRLDINTRGLLLFTNNGNLANELMHPSNKIEREYYIRVFGK
RLUE_PASMU      VLTQFSDEEGRATLKAFIPIPH---VYPAGRLDRDSEGLVLLTNNGEIQHRLAVPKFNTEKTYFAQVEGI
RLUE_VIBVU      TLSQFTDGEGRKTLA---DFIPVKEVYAAGRLDRDSEGLMVLTNDGILQAKLTQPKSKSPKTYWVQVEGA
RLUE_VIBPA      TLSQFTDGDGRKTLA---DYIPVKDVYAAGRLDRDSEGLMVLTNDGILQAKLTQPKSKSPKTYWVQVDGA
RLUB_BUCAP      EVCTRDDQKRLTVFDKLPKLNLNRWV-SVGRLDINTKGLLLFTNDGTLANKLMHPRSQIEREYNIRIFGE
Y807_RICCN      LITTHKDPLSRTVFEQLTGLPR---VISIGRLDLNSEGLLLLTNSGDLARQFELPSSRLKRVYHVRAYG-
RLUE_SHIFL      VLPQFTDETGRKTLK---EFIPVQGVYAAGRLDRDSEGLLVLTNNGALQARLTQPGKRTGKIYYVQVEGI
RLUE_ECOLI      VLPQFTDEAGRKTLK---EFIPVQGVYAAGRLDRDSEGLLVLTNNGALQARLTQPGKRTGKIYYVQVEGI
RLUE_ECO57      VLPQFTDEAGRKTLK---EFIPVQGVYAAGRLDRDSEGLLVLTNNGALQARLTQPGKRTGKIYYVQVEGI
RLUE_VIBCH      TLSQFTDGDGRKTLA---DYIPIKDVYAAGRLDRDSEGLLILTNDGILQARLTQPQSKAPKTYWVQVEGS
RLUE_ECOL6      VLPQFTDEAGRKTLK---EFIPVQGVYAAGRLDRDSEGLLVLTNNGALQARLTQPGKRTGKIYYVQVEGI
Y321_RICBR      LITTHKDPLSRTVFEQLTGLPR---VISIGRLDLNSEGLLLLTNNGDLARQFELPSSKLKRVYHVRAYG-
RLUE_YERPE      VLPQFTDESGRTTLQ---GFIPFKDVYAAGRLDRDSEGLLVLTNDGKLQARLTQPAQKTGKVYFVQVEGV
Y544_RICFE      LITTHKDPLSRTVFEQLTGLPR---VISIGRLDLNSEGLLLLTNSGDLARQFELPSNRLKRVYHVRAYGI
RLUB_XYLFT      EVTTREDPEGRTVFETLPVLKGARWI-AIGRLDINXXXXXXXXXDGELANAMMHPSSEIEREYVVRVRSP
RLUB_XYLFA      EVTTREDPEGRTVFETLPVLKGARWI-AIGRLDINXXXXXXXXXDGELANAMMHPSSEIEREYVVRVRSP
RLUE_SALTY      VLPQFTDEAGRRTLK---DFIPVQGVYAAGRLDRDSEGLLVLTNDGALQARLTQPGKRTGKIYYVQVEGI
RLUE_SALTI      VLPQFTDEAGRRTLK---DFIPVQGVYAAGRLDRDSEGLLVLTNDGALQARLTQPGKRTGKIYYVQVEGI
Y544_RICPR      LITTHKDPLSRTVFEQLIGLPR---VISIGRLDLNSEGLLLLTNSGDLAHQFEMPASKLKRVYNVRAYG-
RLUE_XANAC      VLSQFSDPPKRT----LAEFGLPPDVYAAGRLDHDSEGLLVLTDDGALAHRLTDPRHKQPKTYWVQVEGA
Y532_RICTY      LITTHKDPLSRTVFEQLIGLPR---VISIGRLDLNSEGLLLLTNSGDLAHQFEMPSSKLKRVYNVRAYG-
YE59_HELPJ      ELVSKADPLKRHVI--YESLEKKYAHFPVGRLDFASEGVLLLSDSKAVVSALMHA--NLEKEYLVKIQGF
RLUE_XANCP      VLSQFSDPPKRT----LAEFGLPPQVYAAGRLDHDSEGLLLLTDDGPLAHRLTDPRHKQPKTYWVQVEGD
RLUE_PSEAE      VLTQFNDEQGRSTLK---DFIPVPGVYPAGRLDRDSEGLLLLTNDGRLQARIADPRHKLPKTYWVQVEGT
Y612_SYNY3      VLCQTDNSAHPR--PTLKDYINLPDLYPVGRLDQDSEGLLLLTSNGKLQHRLAHREFAHQRTYFAQVEGS
Y1459_HELPY     ELVSKADPLKRRVI--YESLEKKYAHFPVGRLDFASEGVLLLSDSKAVVSALMHAD--LEKEYLIKIQGF
Y129_BORBU      YLCSNFDVDGRKLAISLVQPLFKERVFSIGRLDFKSSGLLLFTNDGKFANDIIHPRQKVEREYIIESKKD
RLUB_BUCBP      EICTRKDQRNRTIFEKLPKLSNARWI-NIGRLDLNSSGLLLFTTDGELAYRLTHPSFNIERIYKVRVFGQ
RLUB_XANCP      EVTTREDPEGRTVFESLPALKGSRWI-AIGRLDINXXXXXXXXXDGELANAMMHPSXXXXXXXXXXXXAP
RLUB_XANAC      EVTTREDPEGRTVFESLPVLKGSRWI-AIGRLDINXXXXXXXXXDGELANAMMHPSXXXXXXXXXXXXAP
YLYB_BACSU      MV-VHPAPGHLTLMAHCTDLSGINGVMRPGRIDKDTSGLLMVAKNDMAHESLVNQNKTVTRKYTAVVHGL
Y901_CHLAA      MVPAPGHPRGTLVNALLPDLAIGGELRPVHRLDRDTSGLLVIARHDQAMRSLVDQQRRMRKIYQALVIGR
Y292_MYCPN      LISPTSFNESESLLGAALFHCNHQPVFLVHRLDRDTSGVIMLAKN-------------------------
RLUD_VIBVU      VVHPGAGTPDGTVLNALPEVAEVPRAGIVHRLDKDTTGLMVVTVPAQTRLVRALQKRNITREYEAIAIGR
TRUC_VIBPA      MVHRSWLDKHETVMQTLRDQI-GQHVFPLHRLDRPTSGVLVFALSSEVASQVMPAEHKMEKTYHAIVRGW
RLUC_HAEDU      IGVHGGSGLSFGVIEALRALARFLEL--VHRIDRDTSGILLVAKKRSALRALHEQLREVQKDYLALVRG-
RLUC_PSEAE      XXXXXXXXXXXXXXEVFRQLRPAKDIELVHRLDRDTSGLLMIAKKRSMLHEALRGEKIVDKRYHALVRG-
RLUD_VIBCH      VVHPGAGQADKTVLNALSPIAEVPRAGIVHRLDKDTTGLMVVTVPAQTRLVRALQKRDVTREYEAIVIGT
TRUC_VIBCH      MVHRSWLDKHETVMQTLRDQI-GQHVFPLHRLDRPTSGVLVFALSSQIASEVMPANHEMEKTYHAIVRGW
RLUD_YERPE      LVPGAGNPDGTVLNALLHYYPEIMDVPRAGRLDKDTTGLMVVTVPAQTRLVEALQAREITREYEAVAIGN
TRUC_HAEIN      MLVHRSDP-HETVMQTLRDQI-GQHVFPIHRLDRPTSGVLLFALSSEIANLMCEEQKYVQKSYLAVVRGY
TRUC_HAEDU      MLV------HRSWLDKAETLFANQHVFPIHRLDRPTSGVLLFALNSEMARLMSEEQHKVEKEYLAIVRGY
TRUC_VIBVU      MVHRSWLDKHETVMQTLRDQI-GQHVFPLHRLDRPTSGVLVFALSSEVASQVMPAGQEMSKTYHAIVRGW
RLUC_PASMU      IAVHGGSGLSFGVIEALRTLARFLEL--VHRLDRDTSGILLVAKKRSALRSLHEQLREVQKDYLALVRG-
PUS6_YEAST      IVHPTGQFYQNTITELLK--LHGVDALPCYRLDKITSGLLILAKNSQSAGEIQKSIRSRDKIYLARVKG-
TRUC_PASMU      MLSWLDRHETQFVMQTLRDQI-GQHVYPIHRLDRPTSGVLLFALSSEVANLLCFENKQVQKSYLAIVRGY
RUSD2_HUMAN     --------RHNTVIFILGKEHQLKELHPLHRLDRLTSGVLMFAKTAAVSERIHEQDRQLEKEYVCRVEGE
Y007_STRR6      ----------------------------------------------------------------------
Y007_STRPN      ----------------------------------------------------------------------
RLUD_HAEIN      LVPGAGNPNGTVLNALLYHYPPIVEVPRAGRLDKDTTGLMVVAKTAQTKLVRDLQKRKITREYEAVASGI
TRUC_PECCC      VHRSWLDRKEKVVVMQTVRDQIGQHVYTVHRLDRPTSGVLLLALSSEVARALSQESHQMQKTYHAVVRGY
PUS5_ARATH      --------------------------------------------------------RKLSKIYRALADGI
RLUD_HAEDU      VVHPGAGNPDGTVLNALPPIAEVPRAGIIHRLDKDTTGLMVVAKNAQTHLVTALQKRRITREYEAIASGI


                         +         .         .         .         .         *         .:210
query           MTQEDVETFIKGIPLKDFTCQPARLEILSTDAEKNQSQIRVTIAEGKFHQIKRMVGYCGKEVVDLQRLTM
RSUA_YERPE      LSDDTAQQFADGVQLKSLT-KPAQLDVIEPQ------RVRLTISEGRYHQVKRMFAAVGNRVIELHRERI
RSUA_SALTY      VADDTAAQFAKGVQLKDLT-KPATLEVITP------VQVRLTISEGRYHQVKRMFAAVGNRVVELHRERI
RSUA_SALTI      VADDTAAQFAKGVQLKDLT-KPATLEVITP------VQVRLTISEGRYHQVKRMFAAVGNRVVELHRERI
RSUA_SHIFL      VADDTAEQFAKGVQLKDLT-KPAVLEVITP------TQVRLTISEGRYHQVKRMFAAVGNHVVELHRERI
RSUA_ECOLI      VADDTAEQFAKGVQLKDLT-KPAVLEVITP------TQVRLTISEGRYHQVKRMFAAVGNHVVELHRERI
RSUA_ECOL6      VADDTAEQFAKGVQLKDLT-KPAVLEVITP------TQVRLTISEGRYHQVKRMFAAVGNHVVELHRERI
RSUA_ECO57      VADDTAEQFAKGVQLKDLT-KPAVLEVITP------TQVRLTISEGRYHQVKRMFAAVGNHVVELHRERI
RSUA_VIBCH      IQADYAEQFNRGIELRELTL-PAQLEVIS------ETEVLLTIHEGKYHQVKRMFAALGNKVIGLHRERI
RSUA_VIBVU      IGSDYAEKLAEGVQLKELTL-PAQMTIVNAD----ENEVLLTIHEGKYHQVKRMFAALGNKVEQLHRERI
RSUA_VIBPA      IQPDYVEKFAQGIELRNEATLPAHLEIVN----EAENEVLLTIVEGKYHQVKRMFAALGNKVELLHRERI
Y361_SYNY3      PSDEDLEKWRSGMMLDGKKTLPATLEVISEN--KDQIHLLVTLTEGRNRQIRRLAEELGLTVLKLHRRTI
Y1464_AQUAE     VDQKTLKRMKQGIELEDGFAKPDNIRIVR--YEGKNTLLEITFHEGRKHLVKRFLGAFGHKVKRLKRIAI
RSUA_PSEAE      IDQRYVDAFAAGLHFRDLVTLPAQLEPIGPRCA------RLTLHEGRYHQVKRMFGHFDNKVLRLHRERM
RLUB_BACSU      PPKELLRKLERGIRLEEGKTXXXXXXXXXXXXXXQTSIIQLTIHEGRNRQVRRMFEAIGHEVIKLKREEY
RSUA_HAEIN      VEENYSAACAEGILLRGEKTKPAKLEIL------DDYNVNLTISEGRYHQVKRMFAALGNKVVGLHRWKI
RLUB_VIBPA      VTEQKVRNLVKGVELEDGL---ARFEVVYAGGEGMNHTFYVVINEGRNREVRRLWESQECTVSRLKRVRY
RLUB_VIBCH      VTEEKVRNLVRGVQLED---GMARFEVMYAGGEGINHTFYVVINEGRNREVRRLWESQGTTVSRLKRVRY
YTZF_BACSU      ISREDISDLETGVYIEGYKTKPAKAEIKTNDS--GNTVIYLTITEGKYHQVKQMAKAVGNEVVYLKRLSM
RLUB_YERPE      IDDDKIKQLSRGVQLED---GPAAFRTISYQGGEGINQYNVTLTEGRNREVRRLWEAVGVQVSRLIRVRY
RLUB_VIBVU      VNEHKVRNLVNGVELDDGL---ARFEVVYTGGEGMNHTFYVVINEGRNREVRRLWESQDCTVSRLKRVRY
RLUF_ECOLI      ITEEFIRGMSAGVPILGTVTKKCKVK------KEAPFVFRITLVQGLNRQIRRMCEHFGYEVKKLERTRI
RLUF_SALTI      ITDEFIRGMGAGVPILGTVTKKCKVK------KEAPFVFRITLVQGLNRQIRRMCEYFGYEVTKLERTRI
Y554_AQUAE      I-GDXXXXXXXXXXXXXXPVQLVKAEKLSGDT------VKAILTEGRHHVVKRLFKAVGHNVVYLKRTRV
RLUF_SALTY      ITDEFIRGMGAGVPILGTVTKKCKVK------KEAPFVFRITLVQGLNRQIRRMCEYFGYEVTKLERTRI
RLUF_ECOL6      ITDEFIRGMGAGVPILGTVTKKCKVK------KEAPFVFRITLVQGLNRQIRRMCEHFGYEVKKLERTRI
RLUF_ECO57      ITDEFIRGMGAGVPILGTVTKKCKVK------KEAPFVFRITLVQGLNRQIRRMCEHFGYEVKKLERTRI
RLUF_SHIFL      ITDEFIRGMGAGVPILGTVTKKCKVK------KEAPFVFRITLVQGLNRQIRRMCEHFGYEVKKLERTRI
RLUB_ECOL6      VDDAKLRDLSRGVQLED---GPAAFKTIKFSGGEGINQYNVTLTEGRNREVRRLWEAVGVQVSRLIRVRY
RLUB_SHIFL      VDDAKLRDLSRGVQLED---GPAAFKTIKFSGGEGINQYNVTLTEGRNREVRRLWEAVGVQVSRLIRVRY
RLUB_ECOLI      VDDAKLRDLSRGVQLED---GPAAFKTIKFSGGEGINQYNVTLTEGRNREVRRLWEAVGVQVSRLIRVRY
RLUB_ECO57      VDDAKLRDLSRGVQLED---GPAAFKTIKFSGGEGINQYNVTLTEGRNREVRRLWEAVGVQVSRLIRVRY
RLUB_SALTY      VDESKLRDLSRGVQLED---GPAAFKTIKFSGGEGINQYNVTLTEGRNREVRRLWEAVGVQVSRLIRVRY
RLUB_SALTI      VDESKLRDLSRGVQLED---GPAAFKTIKFSGGEGINQYNVTLTEGRNREVRRLWEAVGVQVSRLIRVRY
RLUB_HAEIN      VDDAMLARLRKGVQLEDGLAN--FKEIKFTGGVGINQWYDVTLMEGRNREVRRLWESQGIQVSRLIRIRY
RSUA_PASMU      VESHYQQACAEGMLLRGTPTKPATLEIL------DDYNVNLTISEGRYHQVKRMFAALGNKVVGLHRWKI
RLUB_PSEAE      VTEEMIERLLNGVMLED---GPAKFSDIAPGGEGFNHWYHCVVMEGRNREVRRLWESQGLVVSRLKRVRF
RLUE_HAEIN      PEETDLAQLRKGVELKDGVTKSAKVRLISEPNERNTSWLEIKISEGRNRQVRRMTAHIGFPTLRLVRVSM
Y1738_MYCBO     VPRGLGRTLRAGIELDD---GPAFVDDFAVDAIPGKTLVRVTLHEGRNRIVRRLLAAAGFPVEALVRTDI
Y1711_MYCTU     VPRGLGRTLRAGIELDD---GPAFVDDFAVDAIPGKTLVRVTLHEGRNRIVRRLLAAAGFPVEALVRTDI
RLUB_PASMU      VDEAMLHRLKKGVQLED---GPANFKEIKFAGGVGMNQFDVTLMEGRNREVRRLWESQGVQVSRLIRTRY
Y1370_MYCLE     VPRGLGKKLSVGLELDD---GPAHVDDFAVDAIPGKTLVRLTLHEGRKRIVRRLLTAAGFPVEMLVRTDI
RLUB_BUCAI      INKNTMNILKNGVKIKDGNAAFKSIQTIDHACSKKNKWFKGVLCEGRNREIRSMWQAVQCQVSRLIRIRY
RLUE_PASMU      PQETDLAQLRQGVVLNDGKTLPAKVRLVPEPRERKQSWLEIKIHEGRNRQVRRMTAHIGFPTLRLIRYQM
RLUE_VIBVU      PTEAQLEPLRRGVELKDGLTLPAQVEIIQDPQERNTTWLAITIIEGRNRQVRRMTAHIGFPTLRLVRYSM
RLUE_VIBPA      PQEQDLEKLRKGVELKDGMTLPAKVEVIDTIWERNTTWLAITIIEGRNRQVRRMTAHIGFPTLRLVRYSM
RLUB_BUCAP      MNKNKINILRKGVKIIHGYVSFKEIVPLYDKKEGKNKWFKGILCEGKNREIRLMFKSIQCQVNQLIRVRY
Y807_RICCN      --KSDIKSNYKNLEIDGIFYNPHSIKLLKQN--KTNCWFEVVLFEGKNREIRRIFEYCGLKVNKLIRIQY
RLUE_SHIFL      PTQDALEALRNGVTLNDGPTLPAGAELVDEPAERKSSWLKITLYEGRNRQVRRMTAHVGFPTLRLIRYAM
RLUE_ECOLI      PTQDALEALRNGVTLNDGPTLPAGAELVDEPAERKSSWLKITLYEGRNRQVRRMTAHVGFPTLRLIRYAM
RLUE_ECO57      PTQDALEALRNGVTLNDGPTLPAGAELVDEPAERKSSWLKITLYEGRNRQVRRMTAHVGFPTLRLIRYAM
RLUE_VIBCH      PQESDLEALRHGVTLKDGPTLPAKVDIMPEPAAIPTTWLAITLMEGRNRQVRRMTAHIGFPTLRLIRYSM
RLUE_ECOL6      PTQDALEALRNGVTLNDGPTLPAGAELVEEPAERKSSWLKITLYEGRNRQVRRMTAHVGFPTLRLIRYAM
Y321_RICBR      NPDPLLKSNYKNLEIDGIFYNPQSIKLLRKNS--TNSWLEVILFEGKNREIRRIFEHFGLKVNKLIRTEY
RLUE_YERPE      PDNDALTQLKRGVTLKDGLTLPAGAELVAEPRERKTSWLKITLYEGRNRQVRRMTAHVGFPTLRLIRFSM
Y544_RICFE      LLKSD----YKNLEIDGIFYNPHSIKLFKQN--KSNSWFEVVLFEGKNREIRRIFEYFGLKVNKLIRIQY
RLUB_XYLFT      EGEEHVEQLTRGVMLEDGTAKFDTIEIGNTD---SHDWFRVVVKEGRNREVRRLWESQGCQVSRLKRTRY
RLUB_XYLFA      EGEEHVEQLTRGVMLEDGTAKFDTIEIGNTD---SHDWFRVVVKEGRNREVRRLWESQGCQVSRLKRTRY
RLUE_SALTY      PDNAALQALRTGVTLNDGPTLPAGIEIVAEPERKNTSWLKVTLYEGRNRQVRRMTAHVGHPTLRLIRYSM
RLUE_SALTI      PDNAALQALRTGVTLNDGPTLPAGIEIVAEPERKNTSWLKVTLYEGRNHQVRRMTAHVGHPTLRLIRYSM
Y544_RICPR      XXXXXXXXXXXXXXIDGIFYNPHSIKLLRQN--KSNSWFEVVLFEGKNREIRRIFEYFGLQVNKLIRIQY
RLUE_XANAC      PQAEHLQALRDGVALNDGPTRPAQVRMLDPAPQVPDAWLELQITEGRNRQVRRMTAAVGLPTLRLVRVAI
Y532_RICTY      XXXXXXXXXXXXXKIDGIFYNPYSIKLLRQN--KNNSWFEVVLFEGKNREIRRIFEYFGLKVNKLIRVQY
YE59_HELPJ      VTREMENAMQEGLPIKSMEFAPIGYEIIKNHAK--YSKLRVIINEGKNRELRRFFAFFNAGVLDLRRVRY
RLUE_XANCP      PDTSQLQALCDGVLLNDGPTRPARLECAPTLWPRDDAWLEVQITEGRNRQVRRMTASVGLPTLRLVRVAI
RLUE_PSEAE      PDEEQLRRLREGVTLNDGPTLPAEARLLDEPTSVPTHWLELVIREGRNRQVRRMTAAVGLPTLRLVRVRI
Y612_SYNY3      PTDEDLEPLRRGITFADYPTRPAIAKIITEPASIPTSWLSITLTEGRNRQVRRMTAAVGFPTLRLVRVSA
Y1459_HELPY     VTREMENAMQEGLPIKSMEFAPIGYEIIKNHAK--YSKLRVIINEGKNRELRRFFAFFNAGVLDLRRVRY
Y129_BORBU      IDENLLISFKSGIKVKKEFFKLKSYEIL------NKNSARLILDEGKNREIRKVFLSKNIFLKKIHRIRI
RLUB_BUCBP      FTENILKQLNVRVKLLDGYANFKSIQF--KYGEGKNKWFNVSLCEGRHRIVRRIWEKLGFQVNKLVRISY
RLUB_XANCP      EGEEKVERLSRGVLLEDGGAKFDEIEIGGTDSH---DWFRVVVKEGRNREVRRLWESQGCQVSRLKRTRY
RLUB_XANAC      EGEEKVERLSRGVLLEDGGAKFDEIEIGGTD---SHDWFRVVVKEGRNREVRRLWESQGCQVSRLKRSRY
YLYB_BACSU      ISHDD-----------------------------------------------------------------
Y901_CHLAA      PPETGTIDAPIGRDPRDRDGRPARTHYRLLDTFGDYSLLEVQLETGRTHQIRVHLRHLGYPIV-------
Y292_MYCPN      ----------------------------------------------------------------------
RLUD_VIBVU      MTHATKRTLMAVSPMG----KPAVTHFRVAEHFREHTRIRLRLETGRTHQIRVHMSY-------------
TRUC_VIBPA      IEEEGVLDYALKVELDKIADKFASQEKEAQEAYKPLAKVEVPYSTGKF----------------------
RLUC_HAEDU      QWQAHINV-IKAPLLKNELQSGERIVKVSEQGKPSETRIKASPITGRTHQIRVHTQYAGHPIACDDR--Y
RLUC_PSEAE      ----------------------------------------------------------------------
RLUD_VIBCH      MT--------------------------------------------------------------------
TRUC_VIBCH      IEEANVLDY----PLKEFAKQDKEAQSAVT-AYRPLAKVELPIATGKF----------------------
RLUD_YERPE      MT--------------------------------------------------------------------
TRUC_HAEIN      L---------------------------------------------------------------------
TRUC_HAEDU      IAEKEIDYPLKVIKIADKFSQPKAAQQAVT-FYQNLAKVEMPYSTGKY----------------------
TRUC_VIBVU      IEEEGELDYALKVELDKIADKFASQEKEAQDAYKPLAKVEVPYSTSKF----------------------
RLUC_PASMU      QWQSHCKV-VKAPLLKNELSSGERIVRVSEQGKPSETRVKASPVTGRTHQIRVHTQYAGHPI--------
PUS6_YEAST      ----------------------------------------------------------------------
TRUC_PASMU      LVGE------------------------------------------------------------------
RUSD2_HUMAN     FPTEEVTSYKVGVCRVDPRGKPCETVFQRLSYNGQSSVVRCRPLTGRTHQIRVHLQFLGHPILN------
Y007_STRR6      ----------------------------------------------------------------------
Y007_STRPN      ----------------------------------------------------------------------
RLUD_HAEIN      MTK-------------------------------------------------------------------
TRUC_PECCC      VLDDGV----------------------------------------------------------------
PUS5_ARATH      VEEDEVVIVAQGLYVASPEGKPAKVFVLERDREKNCSLVKVEIQSGRPHQIRIHLAYMGHPLV-------
RLUD_HAEDU      MTQ-------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GTLVLDENLERGEWRRLTKEELEILRANIx
RSUA_YERPE      GDITLDDDLAPGEYRPLTTEEI--------
RSUA_SALTY      GAITLDENLAPGEYRPLTEEEI--------
RSUA_SALTI      GAITLDENLAPGEYRPLTEEEI--------
RSUA_SHIFL      GGITLDADLAPGEYRPLTEEEI--------
RSUA_ECOLI      GGITLDADLAPGEYRPLTEEEI--------
RSUA_ECOL6      GGITLDADLAPGEYRPLTEEEI--------
RSUA_ECO57      GGITLDADLAPGEYRPLTEEEI--------
RSUA_VIBCH      GQITLDETLEPGEYRYLTEEEV--------
RSUA_VIBVU      GAIELDESLEPGEYRYLTQEEID-------
RSUA_VIBPA      GDIVLDDTLEPGDYRYLTQEEVD-------
Y361_SYNY3      GPLQLHTRLGSGQFRFLSPAEIRLLKKQV-
Y1464_AQUAE     GPIKLGK-LSPGKWRELNQGEL--------
RSUA_PSEAE      GDICLDPQLPPGAWRPLNAEEI--------
RLUB_BACSU      AFLNL-RGLHTGDARELTPHEVKRLRA---
RSUA_HAEIN      GDVVLDESLEEGEYRPLTQSEIEKL-----
RLUB_VIBPA      GDIFLDKKLPRGGWMELDLKEVNYLR----
RLUB_VIBCH      GDIFLDKKLPRGGWMELDLKQVNYLR----
YTZF_BACSU      GRVSLDPALAPG------------------
RLUB_YERPE      GDINLPKGLPRGGWTELDLKATNYLR----
RLUB_VIBVU      GDIYLDKKLPRGGWMELELKDVNYLR----
RLUF_ECOLI      MNVSL-SGIPLGEWRDLTDDEL--------
RLUF_SALTI      MNVSL-SGIPLGEWRDLTDDEL--------
Y554_AQUAE      GNLRLDENMEPG------------------
RLUF_SALTY      MNVSL-SGIPLGEWRDLTDDEL--------
RLUF_ECOL6      MNVSL-SGIPLGEWRDLTDDEL--------
RLUF_ECO57      MNVSL-SGIPLGEWRDLTDDEL--------
RLUF_SHIFL      MNVSL-SGIPLGEWRDLTDDEL--------
RLUB_ECOL6      GDIPLPKGLPRGGWTELDLAQTNYLR----
RLUB_SHIFL      GDIPLPKGLPRGGWTELDLAQTNYLR----
RLUB_ECOLI      GDIPLPKGLPRGGWTELDLAQTNYLR----
RLUB_ECO57      GDIPLPKGLPRGGWTELDLAQTNYLR----
RLUB_SALTY      GDIPLPKGLPRGGWTELDLAQTNYLR----
RLUB_SALTI      GDIPLPKGLPRGGWTELDFAQTNYLR----
RLUB_HAEIN      GNIKLMKGLPRGGWEEMDLENVNYLR----
RSUA_PASMU      GQIELDDRLAEGEYRSLSAEEI--------
RLUB_PSEAE      GPVFLTSELTMGRYREMDQREIDILSEEV-
RLUE_HAEIN      GLLSIN-GLENGSFRLLSLDEIKAL-----
Y1738_MYCBO     GAVSLGKQ-RPGSVRALRSNEI--------
Y1711_MYCTU     GAVSLGKQ-RPGSVRALRSNEI--------
RLUB_PASMU      GNISLMKSLPRGGWEEMDLTNVNYLR----
Y1370_MYCLE     GAVSLGDQLLRDEIRQLYKE----------
RLUB_BUCAI      GNIFLPKNLKLGDW----------------
RLUE_PASMU      ALFNL-ANLEQGQYRQLSEVELTAL-----
RLUE_VIBVU      GGMTL-QDLQPGEWKEIS------------
RLUE_VIBPA      GDITLGD-LQPGQWKEI-------------
RLUB_BUCAP      GNIILPKNLKEGQWMML-------------
Y807_RICCN      GSFTID-NLKPGDYKEINNKILE-------
RLUE_SHIFL      GDYSLD-NLANGEWREVT------------
RLUE_ECOLI      GDYSLD-NLANGEWREVT------------
RLUE_ECO57      GDYSLD-NLANGEWREATE-----------
RLUE_VIBCH      GDWNLGD-LQPGEWREVT------------
RLUE_ECOL6      GDYSLD-NLANGEWRDAT------------
Y321_RICBR      GDFKLD-NLKPNEYREVTKK----------
RLUE_YERPE      GNLSLG-NLQPGEWKEIT------------
Y544_RICFE      GSFTID-NLKPGAYKEINNKILE-------
RLUB_XYLFT      GSVLLPRELLRGQSTELPKTQVEALRTQL-
RLUB_XYLFA      GSVLLPRELLRGQSTELPKTQVEALRTQL-
RLUE_SALTY      GDYTLN-GLDNGQWREIAQEK---------
RLUE_SALTI      GDYTLN-GLDNGQWCEIAQEK---------
Y544_RICPR      GALKIG-NLKPGNYQEISNKILE-------
RLUE_XANAC      GDWRLDA-LAPGQWR---------------
Y532_RICTY      GALKIG-NLKPGDYK---------------
YE59_HELPJ      GFVNLNA-LPVGKARFLNRQEYNELHA---
RLUE_XANCP      GAWSL-ASLQPGQW----------------
RLUE_PSEAE      GPWSLD-GLGLGEWREV-------------
Y612_SYNY3      ATWCLTEGLSPGQWRPLTPWE---------
Y1459_HELPY     GFVNLNA-LPVGKMRFLNRQEYNELHA---
Y129_BORBU      GNINLD-SLKEGQVKIVPLSKINSLKSRL-
RLUB_BUCBP      AHLTLPKTLFPGTWITLNKHDIDVL-----
RLUB_XANCP      GKVSLPRELLRGQSVELAQEKVDALRAEL-
RLUB_XANAC      GKISLPRELLRGHSVEVAQDKVDALRAEL-
YLYB_BACSU      ------------------------------
Y901_CHLAA      ------------------------------
Y292_MYCPN      ------------------------------
RLUD_VIBVU      ------------------------------
TRUC_VIBPA      ------------------------------
RLUC_HAEDU      GDQAFDAKLKQAGLNRL-------------
RLUC_PSEAE      ------------------------------
RLUD_VIBCH      ------------------------------
TRUC_VIBCH      ------------------------------
RLUD_YERPE      ------------------------------
TRUC_HAEIN      ------------------------------
TRUC_HAEDU      ------------------------------
TRUC_VIBVU      ------------------------------
RLUC_PASMU      ------------------------------
PUS6_YEAST      ------------------------------
TRUC_PASMU      ------------------------------
RUSD2_HUMAN     ------------------------------
Y007_STRR6      ------------------------------
Y007_STRPN      ------------------------------
RLUD_HAEIN      ------------------------------
TRUC_PECCC      ------------------------------
PUS5_ARATH      ------------------------------
RLUD_HAEDU      ------------------------------