[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for spne4:ACF56432.1

[Show Plain Result]


## Summary of Sequence Search
    1::652
    1::652       0.0 100%  652 aa  ALIB_STRR6 RecName: Full=Oligopeptide-binding protein aliB;Flags:
    1::652       0.0 100%  652 aa  ALIB_STRPN RecName: Full=Oligopeptide-binding protein aliB;Flags:
   34::660       0.0  60%  660 aa  ALIA_STRPN RecName: Full=Oligopeptide-binding protein aliA;AltName:
   38::663       0.0  60%  663 aa  SARA_STRGC RecName: Full=Oligopeptide-binding protein sarA;AltName:
   33::659       0.0  57%  659 aa  AMIA_STRPN RecName: Full=Oligopeptide-binding protein amiA;Flags:
   33::304     2e-28  32%  535 aa  YGIS_ECOLI RecName: Full=Putative binding protein ygiS;Flags:
   19::512     1e-27  27%  545 aa  OPPA_BACSU RecName: Full=Oligopeptide-binding protein oppA;AltName:
   49::331     1e-25  30%  543 aa  OPPA_SALTY RecName: Full=Periplasmic oligopeptide-binding
   49::331     3e-25  29%  543 aa  OPPA_ECOLI RecName: Full=Periplasmic oligopeptide-binding
   44::343     3e-21  29%  537 aa  MPPA_ECOLI RecName: Full=Periplasmic murein peptide-binding
   73::510     3e-21  29%  543 aa  DPPE_BACSU RecName: Full=Dipeptide-binding protein dppE;Flags:
   41::496     4e-17  26%  541 aa  OPPA_HAEIN RecName: Full=Periplasmic oligopeptide-binding
   24::236     6e-16  33%  535 aa  DPPA_ECOLI RecName: Full=Periplasmic dipeptide transport
   84::330     2e-12  30%  547 aa  HBPA_HAEIN RecName: Full=Heme-binding protein A;AltName:
   92::401     5e-12  31%  600 aa  OPPA_LACLS RecName: Full=Oligopeptide-binding protein oppA;Flags:
   73::477     2e-11  33%  514 aa  Y213_HAEIN RecName: Full=Putative binding protein HI0213;Flags:
   92::361     2e-11  32%  600 aa  OPPA2_LACLA RecName: Full=Oligopeptide-binding protein oppA;Flags:
   40::343     9e-11  29%  594 aa  UF71_DEIRA RecName: Full=Probable ABC transporter-binding protein
   26::295     7e-09  25%  512 aa  GSIB_SHIBS RecName: Full=Glutathione-binding protein gsiB;Flags:
   26::295     7e-09  26%  512 aa  GSIB_ECOUT RecName: Full=Glutathione-binding protein gsiB;Flags:
   26::295     7e-09  26%  512 aa  GSIB_ECOL6 RecName: Full=Glutathione-binding protein gsiB;Flags:
   26::295     7e-09  26%  512 aa  GSIB_ECOL5 RecName: Full=Glutathione-binding protein gsiB;Flags:
   26::295     7e-09  26%  512 aa  GSIB_ECOK1 RecName: Full=Glutathione-binding protein gsiB;Flags:
   26::295     9e-09  26%  514 aa  GSIB_SHIF8 RecName: Full=Glutathione-binding protein gsiB;Flags:
   26::295     1e-08  25%  512 aa  GSIB_SHIDS RecName: Full=Glutathione-binding protein gsiB;Flags:
   26::295     1e-08  25%  512 aa  GSIB_ECO57 RecName: Full=Glutathione-binding protein gsiB;Flags:
   26::295     1e-08  26%  512 aa  GSIB_SHISS RecName: Full=Glutathione-binding protein gsiB;Flags:
   26::295     1e-08  26%  512 aa  GSIB_SHIFL RecName: Full=Glutathione-binding protein gsiB;Flags:
   26::295     2e-08  25%  512 aa  GSIB_ECOLI RecName: Full=Glutathione-binding protein gsiB;Flags:
   63::243     3e-08  29%  549 aa  SAPA_SALTY RecName: Full=Peptide transport periplasmic protein
   92::385     6e-08  29%  600 aa  OPPA1_LACLA RecName: Full=Oligopeptide-binding protein oppA;Flags:
   61::241     4e-07  27%  547 aa  SAPA_ECOLI RecName: Full=Peptide transport periplasmic protein
   36::208     3e-06  25%  512 aa  GSIB_SALCH RecName: Full=Glutathione-binding protein gsiB;Flags:
   36::208     4e-06  25%  512 aa  GSIB_SALTY RecName: Full=Glutathione-binding protein gsiB;Flags:
   36::208     4e-06  25%  512 aa  GSIB_SALTI RecName: Full=Glutathione-binding protein gsiB;Flags:
   36::208     7e-06  25%  512 aa  GSIB_SALPA RecName: Full=Glutathione-binding protein gsiB;Flags:
   68::217     1e-05  28%  527 aa  Y3859_BRUME RecName: Full=Putative ABC transporter peptide-binding
   68::217     1e-05  28%  527 aa  Y3409_BRUSU RecName: Full=Putative ABC transporter peptide-binding
   68::217     1e-05  28%  527 aa  Y3312_BRUA2 RecName: Full=Putative ABC transporter peptide-binding
   68::217     1e-05  28%  527 aa  Y3092_BRUAB RecName: Full=Putative ABC transporter peptide-binding
   68::217     1e-05  28%  527 aa  Y2552_BRUO2 RecName: Full=Putative ABC transporter peptide-binding
   66::110     1e-05  50%  524 aa  NIKA_ECOLI RecName: Full=Nickel-binding periplasmic protein;Flags:
   54::362     1e-05  26%  543 aa  APPA_BACSU RecName: Full=Oligopeptide-binding protein appA;Flags:
   31::100     2e-05  33%  514 aa  Y210_BRUME RecName: Full=Putative peptide-binding periplasmic
   31::100     2e-05  33%  514 aa  Y1049_BRUA2 RecName: Full=Putative peptide-binding periplasmic
   31::100     2e-05  33%  514 aa  Y1030_BRUAB RecName: Full=Putative peptide-binding periplasmic
   31::100     1e-04  31%  514 aa  Y1090_BRUSU RecName: Full=Putative peptide-binding periplasmic
  724::853     3e-04  29%  864 aa  SYL_PROM5 RecName: Full=Leucyl-tRNA synthetase;       
  680::923     5e-04  29% 1305 aa  RPOC_UREU1 RecName: Full=DNA-directed RNA polymerase subunit beta';
   64::120     8e-04  35%  531 aa  Y4TO_RHISN RecName: Full=Probable peptide ABC transporter
    1::652

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKKSKSKYXXXXXXXXXXXXXXSACGNSSTASKTYNYVYSSDPSSLNYLAENRAATSDIVANLVDGLLEN
ALIB_STRR6      MKKSKSKYXXXXXXXXXXXXXXSACGNSSTASKTYNYVYSSDPSSLNYLAENRAATSDIVANLVDGLLEN
ALIB_STRPN      MKKSKSKYXXXXXXXXXXXXXXSACGNSSTASKTYNYVYSSDPSSLNYLAENRAATSDIVANLVDGLLEN
ALIA_STRPN      --------------------------------KTFSYIYETDPDNLNYLTTAKAATANITSNVVDGLLEN
SARA_STRGC      ------------------------------ADQVFNYIYEVDPENLNYLISSKAATTDLTANLIDGLLEN
AMIA_STRPN      ------------------------------APKAYGYVYTADPETLDYLIXXXXXXXXXXXXGIDGLFTN
YGIS_ECOLI      --------------------------------QVFRYNNHSDPGTLDPQKVEENTAAQIVLDLFEGLVWM
OPPA_BACSU      ----------------------SACGFGGTGSNTLNINIKTEPFSLHPGLANDSVSGGVIRQTFEGLTRI
OPPA_SALTY      -------------------------------------VQSLDPHKIEGVPE-----SNVSRDLFEGLLIS
OPPA_ECOLI      -------------------------------------VQSLDPHKIEGVPE-----SNISRDLFEGLLVS
MPPA_ECOLI      -----------------------------------------EPASLDPAKAVGLPEIQVIRDLFEGLVNQ
DPPE_BACSU      -------------------------------------------------------------NIMEGLTRL
OPPA_HAEIN      ----------------------------------------AEPQSFDPHKTEGVPESNVAYQLLEGLVTS
DPPA_ECOLI      ---------------------------ASVQAKTLVYCSEGSPEGFNPQLFTSGTTYDASSVPLYNRLVE
HBPA_HAEIN      ----------------------------------------------------------------------
OPPA_LACLS      ----------------------------------------------------------------DGLFFT
Y213_HAEIN      --------------------------------------------------------TQLLRDLFEGLTAY
OPPA2_LACLA     ----------------------------------------------------------------DGLFFT
UF71_DEIRA      ---------------------------------TFRSVNLQDFKTLNPFVSSESPNLPAVLSAGSLLGYN
GSIB_SHIBS      ------------------------------AAKDVVVAVGSNFTTLDPYDANDTLSQAVAKSFYQGLFGL
GSIB_ECOUT      ------------------------------AAKEVVVAVGSNFTTLDPYDANDTLSQAVAKSFYQGLFGL
GSIB_ECOL6      ------------------------------AAKEVVVAVGSNFTTLDPYDANDTLSQAVAKSFYQGLFGL
GSIB_ECOL5      ------------------------------AAKNVVVAVGSNFTTLDPYDANDTLSQAVAKSFYQGLFGL
GSIB_ECOK1      ------------------------------AAKEVVVAVGSNFTTLDPYDANDTLSQAVAKSFYQGLFGL
GSIB_SHIF8      ------------------------------AAKDVVVAVGSNFTTLDPYDANDTLSQAVAKSFYQGLFGL
GSIB_SHIDS      ------------------------------AAKDVVVAVGSNFTTLDPYDANDTLSQAVAKSFYQGLFGL
GSIB_ECO57      ------------------------------AAKDVVVAVGSNFTTLDPYDANDTLSQAVAKSFYQGLFGL
GSIB_SHISS      ------------------------------AAKDVVVAVGSNFTTLDPYDANDTLSQAVAKSFYQGLFGL
GSIB_SHIFL      ------------------------------AAKDVVVAVGSNFTTLDPYDANDTLSQAVAKSFYQGLFGL
GSIB_ECOLI      ------------------------------AAKDVVVAVGSNFTTLDPYDANDTLSQAVAKSFYQGLFGL
SAPA_SALTY      ----------------------------------------------------------LAAQLYDRLLDV
OPPA1_LACLA     ----------------------------------------------------------------DGLFFT
SAPA_ECOLI      ----------------------------------------------------------LAAQFYDRLLDV
GSIB_SALCH      ----------------------------------------SNFTTLDPYDANDTLSQAVAKSFYQGLFGL
GSIB_SALTY      ----------------------------------------SNFTTLDPYDANDTLSQAVAKSFYQGLFGL
GSIB_SALTI      ----------------------------------------SNFTTLDPYDANDTLSQAVAKSFYQGLFGL
GSIB_SALPA      ----------------------------------------SNFTTLDPYDANDTLSQAVAKSFYQGLFGL
Y3859_BRUME     ------------------------------------------------------------------VIYD
Y3409_BRUSU     ------------------------------------------------------------------VIYD
Y3312_BRUA2     ------------------------------------------------------------------VIYD
Y3092_BRUAB     ------------------------------------------------------------------VIYD
Y2552_BRUO2     ------------------------------------------------------------------VIYD
NIKA_ECOLI      ----------------------------------------------------------------------
APPA_BACSU      -----------------------------------------EPTLFNSLYSTDDASTDIENMLYSFLTKT
Y210_BRUME      ---------------------------------TLVYASNAGPGTLDPHMGNSLVELEIAHQIYEGLVTI
Y1049_BRUA2     ---------------------------------TLVYASNAGPGTLDPHMGNSLVELEIAHQIYEGLVTI
Y1030_BRUAB     ---------------------------------TLVYASNAGPGTLDPHMGNSLVELEIAHQIYEGLVTI
Y1090_BRUSU     ---------------------------------TLVYASNAGPGTLDPHMGNSLVELEIAHQIYEGLVTI
SYL_PROM5       -------------------------------------------------------------------IKN
RPOC_UREU1      ----------------------------------------------------------------------
Y4TO_RHISN      --------------------------------------------------------------IYDTLFSA


                         .         .         *         .         .         .         .:140
query           DQYGNIIPSLAEDWTVSQDGLTYTYKLRKDAKWFTSEGEEYAPVTAQDFVTGLQYAADKKSEALYLVQDS
ALIB_STRR6      DQYGNIIPSLAEDWTVSQDGLTYTYKLRKDAKWFTSEGEEYAPVTAQDFVTGLQYAADKKSEALYLVQDS
ALIB_STRPN      DQYGNIIPSLAEDWTVSQDGLTYTYKLRKDAKWFTSEGEEYAPVTAQDFVTGLQYAADKKSEALYLVQDS
ALIA_STRPN      DRYGNFVPSMAEDWSVSKDGLTYTYTIRKDAKWYTSEGEEYAAVKAQDFVTGLKYAADKKSDALYLVQES
SARA_STRGC      DNYGNLVPSMAEDWTVSKDGLTYTYTLRKDAKWYTSDGEEYADVKAQDFVAGLKYAADNKSETLYLVQSS
AMIA_STRPN      DNYGNLAPAVAEDWEVSKDGLTYTYKIRKGVKWFTSDGEEYAEVTAKDFVNGLKHAADKKSEAMYLAENS
YGIS_ECOLI      DGEGQVQPAQAERWEILDGGKRYIFHLRSGLQW--SDGQ---PLTAEDFVLGWQRAVDPKTAAGYLAQAH
OPPA_BACSU      NADGEPEEGMASKIETSKDGKTYTFTIRDGVKW--SNGD---PVTAQDFEYAWKWALDPNNESQYAYQYY
OPPA_SALTY      DVEGHPSPGVAEKWE-NKDFKVWTFHLRENAKW--SDG---TPVTAHDFVYSWQRLADPNTAASYLQYGH
OPPA_ECOLI      DLDGHPAPGVAESWD-NKDAKVWTFHLRKDAKW--SDG---TPVTAQDFVYSWQRSVDPNTAASYLQYGH
MPPA_ECOLI      NEKGEIVPGVATQWK-SNDNRIWTFTLRDNAKW-----ADGTPVTAQDFVYSWQRLVDPKTLSPFAWFAA
DPPE_BACSU      GKDHEPEPAMAEKWSVSKDNKTYTFTIRENAKWTNGD-----PVTAGDFEYAWKRMLDPKKGA------S
OPPA_HAEIN      DSEGKLQPGAAESWENTPDFKTWTFHLRKDAKW--SNGD---PVTAHDFVFAWRRLVDPATAASYLSYLQ
DPPA_ECOLI      FKIGTVIPGLAEKWEVSEDGKTYTFHLRKGVKW--HDNKEFKPLNADDVV----FSFDRQKNAQNPYHKV
HBPA_HAEIN      ----DIEPALAESWEISDDGLSYTFHLRKGVKFHTT--KEFTPTNADDVVFSFQRQLDPN----HPYHNV
OPPA_LACLS      DSGFKFIKGGAADVALDKESKTATITLRKDLKW--SDGSE---VTAKDYIANPAYGSDRWTDSLA----N
Y213_HAEIN      DVQGNLVPAVAENWQ-TEDNKTWIFTLRENAKW--SNGE---PITASDFVQSWQTLSQSESPAFMNLKNA
OPPA2_LACLA     DSGFKFIKGGAADVALDKESKTATITLRKDLKW--SDGSE---VTAKDYIANPAYGSDRWTDSLA----N
UF71_DEIRA      PVTGNYAPYMAEKYTQSADKRTFTFDIRKGMKW--SDGK---PITVDDWITA--YTIDSN-------KDV
GSIB_SHIBS      DKEMKLKNVLAESYTVSDDGITYTVKLREGIK----------------FQDGTDFNAAAVKANLDRASDP
GSIB_ECOUT      DKEMKLKNVLAESYTVSDDGLTYTVKLREGIK----------------FQDGTDFNAAAVKANLDRASDP
GSIB_ECOL6      DKEMKLKNVLAESYTVSDDGLTYTVKLREGIK----------------FQDGTDFNAAAVKANLDRASDP
GSIB_ECOL5      DKEMKLKNVLAESYTVSDDGLTYTVKLREGIK----------------FQDGTDFNAAAVKANLDRASDP
GSIB_ECOK1      DKEMKLKNVLAESYTVSDDGLTYTVKLREGIK----------------FQDGTDFNAAAVKANLDRASDP
GSIB_SHIF8      DKEMKLKNVLAESYTVSDDGITYTVKLREGIKF--QDGTDFNAVAVK---ANLDRASDPANHKRYNLYKN
GSIB_SHIDS      DKEMKLKNVLAESYTVSDDGITYTVKLREGIK----------------FQDGTDFNAAAVKANLDRASDP
GSIB_ECO57      DKEMKLKNVLAESYTVSDDGITYTVKLREGIK----------------FQDGTDFNAAAVKANLDRASDP
GSIB_SHISS      DKEMKLKNVLAESYTVSDDGITYTVKLREGIKF--QDGTDFNAVAVK---ANLDRASDPANHKRYNLYKN
GSIB_SHIFL      DKEMKLKNVLAESYTVSDDGITYTVKLREGIKF--QDGTDFNAVAVK---ANLDRASDPANHKRYNLYKN
GSIB_ECOLI      DKEMKLKNVLAESYTVSDDGITYTVKLREGIK----------------FQDGTDFNAAAVKANLDRASDP
SAPA_SALTY      DPYTRLVPELAESWEVLDNGATYRFHLRRDVSWFTPTRK----LNADDVVFTFQRIFDRRHPWHNINGSS
OPPA1_LACLA     NSSFKYINGGPANVSLYKDAKTATITLRKDLKW--SDGSE---VTAKDYTANPAYGSDRWTDSLA----N
SAPA_ECOLI      DPYTRLMPELAESWEVLDNGATYRFHLRRDTDWFTPTRK----MNADDVVFTFQRIFDRNNP-----WHN
GSIB_SALCH      DKDMKVKNVLAEGYTVSDDGLTYTITLRRGVKF--------------------QDGADFNAAAVKANLDR
GSIB_SALTY      DKDMKVKNVLAEGYTVSDDGLTYTITLRQGVKF--------------------QDGADFNAAAVKANLDR
GSIB_SALTI      DKDMKVKNVLAEGYTVSDDGLTYTITLRQGVKF--------------------QDGADFNAAAVKANLDR
GSIB_SALPA      DKDMKVKNVLAEGYTVSDDGLTYTITLRQGVKF--------------------QDGADFDAAAVKANLDR
Y3859_BRUME     DKLENIVGDLAKSFEISPDQLTYTFKL-AHAKWHDGE-----PFTSKDAKFTFDLARNGKTGSVFAARLA
Y3409_BRUSU     DKLENIVGDLAKSFEISPDQLTYTFKL-AHAKWHDGE-----PFTSKDAKFTFDLARNGKTGSVFAARLA
Y3312_BRUA2     DKLENIVGDLAKSFEISPDQLTYTFKL-AHAKWHDGE-----PFTSKDAKFTFDLARNGKTGSVFAARLA
Y3092_BRUAB     DKLENIVGDLAKSFEISPDQLTYTFKL-AHAKWHDGE-----PFTSKDAKFTFDLARNGKTGSVFAARLA
Y2552_BRUO2     DKLENIVGDLAKSFEISPDQLTYTFKL-AHAKWHDGE-----PFTSKDAKFTFDLARNGKTGSVFAARLA
NIKA_ECOLI      ---GSVIPWLAKSWTHSEDGKTWTFTLRDDVKF--SNGEPFAEAAAENF---------------------
APPA_BACSU      DEKLNVKLSLAESIKELDGGLAYDVKIKKGVKF--HDGKE---LTADDFTYSVPLSKDYKGE--------
Y210_BRUME      DANYNTATMLAESYVLSEDGKTLTFKLRKGVKF-------------------------------------
Y1049_BRUA2     DANYNTATMLAESYVLSEDGKTLTFKLRKGVKF-------------------------------------
Y1030_BRUAB     DANYNTATMLAESYVLSEDGKTLTFKLRKGVKF-------------------------------------
Y1090_BRUSU     DANYNTATMLAESYVLSEDSKTLTFKLRKGVKF-------------------------------------
SYL_PROM5       NQFNTAISELMKFYNSLSSSMIYVNKLRKDAKKFCILLAPFAPHIAEEIWNLIGYQKSVHLERWPIFNED
RPOC_UREU1      ----------------------------------------------------------------------
Y4TO_RHISN      DSQSQPHPQMVGNWGVSDDKKTYTFELRDGLGW-----HDGTPVTAADCVASIR----------------


                         +         .         .         .         .         *         .:210
query           VAGLDDYITGKTSDFSTVGVKALDDQTVQYTLVKPELYWNSKTLATILFPVNADFLKSKGDDFGKADPSS
ALIB_STRR6      VAGLDDYITGKTSDFSTVGVKALDDQTVQYTLVKPELYWNSKTLATILFPVNADFLKSKGDDFGKADPSS
ALIB_STRPN      VAGLDDYITGKTSDFSTVGVKALDDQTVQYTLVKPELYWNSKTLATILFPVNADFLKSKGDDFGKADPSS
ALIA_STRPN      IKGLDAYVKGEIKDFSQVGIKALDEQTVQYTLNKPESFWNSKTTMGVLAPVNEEFLNSKGDDFAKADPSS
SARA_STRGC      IKGLDDYVNGKTKDFSSVGVKAVDDHTVQYTLNEPESFWNSKTTMGILYPVNEEFLKSKGDKFAQADPTS
AMIA_STRPN      VKGLADYLSGTSTDFSTVGVKAVDDYTLQYTLNQPEPFWNSKLTYSIFWPLNEEFETSKGSDFAKTDPTS
YGIS_ECOLI      INNAAAIVAGK-ADVTSLGVKATDDRTLEVTLEQPVPWFTTMLAWPTLFPVPHHVIAKHGDSWSK--PEN
OPPA_BACSU      IKGAEAANTGKGS-LDDVAVKAVNDKTLKVELNNPTPYFTELTAFYTYMPIN-EKIAEKNKKWNTNAGDD
OPPA_SALTY      IANIDDIIAGK-KPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKW--TQPAN
OPPA_ECOLI      IAGIDEILEGK-KPITDLGVKAIDDHTLEVTLSEPVPYFYKLLVHPSTSPVPKAAIEKFGEKW--TQPGN
MPPA_ECOLI      LAGINNIIDGKATP-DQLGVTAVDAHTLKIQLDKPLPWFVNLTANFAFFPVQKANVES-GKEWTK--PGN
DPPE_BACSU      SAFLGYFIEGGEAYNSXXXXXXXXXRTLEVTLEAPQKYFLSVVSNPAYFPVNEKVDKDNPKWFAESD--T
OPPA_HAEIN      VENAQDIIDGKKKP-AELGVEXKDDYTFVVHTTNPVPYTVSXXTHQSXXXXXXXXXXXXGDAWVKKE--N
DPPA_ECOLI      SGGSYEYFEGMGLPELISEVKKVDDNTVQFVLTRPELADLAMDFASILSKEYADAMMKAGTP-EKLDLNP
HBPA_HAEIN      SKGTYPYFKAMKFPELLKSVEKVDDNTIRITL--------NKTDATFLASLGMDFISIYSAEYGKPEDSR
OPPA_LACLS      IVGLSDYHAGKAKTIS--GITFPDGENVQFKEMKPGMTQNGYFLETV---APYQYLKDVAPKDLASSPKT
Y213_HAEIN      KAVLE-----KALPVESLGLFAENDRTLRIELDKASPYLPSMLAHVSLLP---HYAKS---------TEI
OPPA2_LACLA     IVGLSDYHTGKAKTIS--GITFPDGENVQFKEMKPGMTQNGYFLETV---APYQYLKDVAPKDLASSPKT
UF71_DEIRA      GSNTFDY---WTINNQPIKVTKVDSNTLKVVFPKADV-TAIEFLSGIFLPVFMPVWKAKGAQGIKTNPDN
GSIB_SHIBS      ANHLKRYNLYK----NIAKTEAIDPTTVKITLKQP----FSAFINILVHPATAMISPAALEKYGKEIGFH
GSIB_ECOUT      ANHLKRYNLYK----NIAKTEAIDPTTVKITLKQP----FSAFINILAHPATAMISPAALEKYGKEIGFH
GSIB_ECOL6      ANHLKRYNLYK----NIAKTEAIDPTTVKITLKQP----FSAFINILAHPATAMISPAALEKYGKEIGFH
GSIB_ECOL5      ANHLKRYNLYK----NIAKTEAIDPTTVKITLKQP----FSAFINILAHPATAMISPAALEKYGKEIGFH
GSIB_ECOK1      ANHLKRYNLYK----NIAKTEAIDPTTVKITLKQP----FSAFINILAHPATAMISPAALEKYGKEIGFH
GSIB_SHIF8      IA--------KT--------EAIDPTTVKITLKQP----FSAFINILVHPATAMISPTALEKYGKEIGFH
GSIB_SHIDS      ANHLKRYNLYK----NIAKTEAIDPTTVKITLKQP----FSAFINILAHPATAMISPAALEKYGKEIGFH
GSIB_ECO57      ANHLKRYNLYK----NIAKTEAIDPTTVKITLKQP----FSAFINILAHPATAMISPAALEKYGKEIGFH
GSIB_SHISS      IA--------KT--------EAIDPTTVKITLKQP----FSAFINILAHPATAMISPAALEKYGKEIGFH
GSIB_SHIFL      IA--------KT--------EAIDPTTVKITLKQP----FSAFINILAHPATAMISPTALEKYGKEIGFH
GSIB_ECOLI      ANHLKRYNLYK----NIAKTEAIDPTTVKITLKQP----FSAFINILAHPATAMISPAALEKYGKEIGFY
SAPA_SALTY      FPYFDSL---QFAD-NVKSVRKLDNNTVEFRLTQPDFLWHLATYASVMSAEYAAQLSRK--DRQELLDRQ
OPPA1_LACLA     IVGLSDYHAGKAKTIS--GITFPDGENVQFKEMTPGMNQNGYFLETV---APYQYLKDVAPKDLASSPKS
SAPA_ECOLI      VNGSNPYFDSLQFADNVKSVRKLDNHTVEFRLAQPDFLWHLATHYASVMSAEYARKLEKEDRQEQLDRQP
GSIB_SALCH      ASNPDNHLKRYNLYKNIAKTEVVDPATVKITLKQP----FSAFINILAHPATAMISPQALEKYGKDIGFH
GSIB_SALTY      ASNPDNHLKRYNLYKNIAKTEVVDPATVKITLKQP----FSAFINILAHPATAMISPQALEKYGKDIGFH
GSIB_SALTI      ASNPDNHLKRYNLYKNIAKTEVVDPATVKITLKQP----FSAFINILAHPATAMISPQALEKYGKDIGFH
GSIB_SALPA      ASNPDNHLKRYNLYKNIAKTEVVDPVTVKITLKQP----FSAFINILAHPATAMISPQALEKYGKDIGFH
Y3859_BRUME     ---------------SIASVETPDEKTVVIKLKEPSPSMLDTLTKVMMLPEHA-LASIPPEQLAKNASST
Y3409_BRUSU     ---------------SIASVETPDEKTVVIKLKEPSPSMLDTLTKVMMLPEHA-LASIPPEQLAKNASST
Y3312_BRUA2     ---------------SIASVETPDEKTVVIKLKEPSPSMLDTLTKVMMLPEHA-LASIPPEQLAKNASST
Y3092_BRUAB     ---------------SIASVETPDEKTVVIKLKEPSPSMLDTLTKVMMLPEHA-LASIPPEQLAKNASST
Y2552_BRUO2     ---------------SIASVETPDEKTVVIKLKEPSPSMLDTLTKVMMLPEHA-LASIPPEQLAKNASST
NIKA_ECOLI      ----------------------------------------------------------------------
APPA_BACSU      --------RGSTYEMLKSVEKKGDYEVLFKLKYKDGNFYNNALDSTAILPKNVPIADLEENEFNRKKP--
Y210_BRUME      ----------------------------------------------------------------------
Y1049_BRUA2     ----------------------------------------------------------------------
Y1030_BRUAB     ----------------------------------------------------------------------
Y1090_BRUSU     ----------------------------------------------------------------------
SYL_PROM5       ALKEDCYINGKVRDKINVGIDISEDQIKQKTLTRPNVWIDQKTIRKII----------------------
RPOC_UREU1      ------------NQFEIIGMESILDYLKAYNLKEP---LTKKTLSTVIVPQTMDKIKALGFKYSMISATS
Y4TO_RHISN      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           ILYNGPFLMKALVSKSAIEYKKNPNYWDAKNVFVDDVKLTYYDGSDQESLERNFTAGAYTTARLFPNSSS
ALIB_STRR6      ILYNGPFLMKALVSKSAIEYKKNPNYWDAKNVFVDDVKLTYYDGSDQESLERNFTAGAYTTARLFPNSSS
ALIB_STRPN      ILYNGPFLMKALVSKSAIEYKKNPNYWDAKNVFVDDVKLTYYDGSDQESLERNFTAGAYTTARLFPNSSS
ALIA_STRPN      LLYNGPYLLKSIVTKSSVEFAKNPNYWDKDNVHVDKVKLSFWDGQDTSKPAENFKDGSLTAARLYPTSAS
SARA_STRGC      LLYNGPFLLKSITSKSSIEFAKNPNYWDKDNVHVSDVKLTYFDGQDQGKPAEQFAKGALSAARLAPTSAT
AMIA_STRPN      LLYNGPFLLKGLTAKSSVEFVKNEQYWDKENVHLDTINLAYYDGSDQESLERNFTSGAYSYARLYPTSSN
YGIS_ECOLI      MVYNGAFVLDQWVVNEKITARKNPKYRDAQHTVLQQVEYLALDNS--VTGYNRYRAGTWVPAQQIP----
OPPA_BACSU      YVSNGPFKMTAWKHSGSITLEKNDQYWDKDKVKLKKIDMVMINNNNTEL--KKFQAGELDWAGMPLGQLP
OPPA_SALTY      IVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQV--TYLPISSEVTDVNRYRSGEIDMTYNNMPIEL
OPPA_ECOLI      IVTNGAYTLKDWVVNERIVLERSPTYWNNAKTVINQV--TYLPIASEVTDVNRYRSGEIDMTNNSMPIEL
MPPA_ECOLI      LIGNGAYVLKERVVNEKLVVVPNTHYWDAKTVL---QKVTFLPINQESAATKRYLAGDIDITESFPKNMY
DPPE_BACSU      FVGNGPFKLTEWKHDDSITMEKSDTYWDKDTVKLDKVKWAMV--SDRNTDYQMFQSGELDTA--YVPAEL
OPPA_HAEIN      YVGNGAYKLANHIINEKIEFERNPLYWNDKETVINSA--TFLAIENPSTDVARYRAGDLDMTSYGLPPEQ
DPPA_ECOLI      I-GTGPFQLQQYQKDSRIRYKAFDGYWGTK----------------------------------------
HBPA_HAEIN      PVGTGPFVFVDYKTDQAIQYVAHENYWKGRTPL---DRLVISIVPDATTRYAKLQAGTCDLI-LFPNVAD
OPPA_LACLS      TLVTGPFKPENVVAGESIKYVPNPYYWGKKNSITYEVVSTAKSVAALSSSKYDFINGMV--------SSQ
Y213_HAEIN      FISNGAYQLQRQAENQHI-LTTNPYYWAKEKVIFQQVK--------------------------------
OPPA2_LACLA     TLVTGPFKPENVVAGESIKYVPNPYYWGEKNSITYEVVSTAKSVAALSSSKYDIINGMV--------SSQ
UF71_DEIRA      IVTSGPFMLDRYVRGERAILKKNP-YFGEWNKDSAGKSLPYLDGADANAQLAQFLAGNLDTDKLAQVKSA
GSIB_SHIBS      PVGTGPYELDTWNQTDFVKVKKFAGYWQPGLPKLDSI--TWRPVADNNTRAAMLQTGEAQFA--FPIPYE
GSIB_ECOUT      PVGTGPYELDTWNQTDFVKVKKFAGYWQPGLPKLDSI--TWRPVADNNTRAAMLQTGEAQFA--FPIPYE
GSIB_ECOL6      PVGTGPYELDTWNQTDFVKVKKFAGYWQPGLPKLDSI--TWRPVADNNTRAAMLQTGEAQFA--FPIPYE
GSIB_ECOL5      PVGTGPYELDTWNQTDFVKVKKFVGYWQPGLPKLDSI--TWRPVADNNTRAAMLQTGEAQFA--FPIPYE
GSIB_ECOK1      PVGTGPYELDTWNQTDFVKVKKFAGYWQPGLPKLDSI--TWRPVADNNTRAAMLQTGEAQFA--FPIPYE
GSIB_SHIF8      PVGTGPYELDTWNQTDFVKVKKFAGYWQPGLPKLDSI--TWRPVADNNTRAAMLQTGEAQFA--FPIPYE
GSIB_SHIDS      PVGTGPYELDTWNQTDFVKVKKFAGYWQPGLPKLDSI--TWRPVADNNTRAAMLQTGEAQFA--FPIPYE
GSIB_ECO57      PVGTGPYELDTWNQTDFVKVKKFAGYWQPGLPKLDSI--TWRPVADNNTRAAMLQTGEAQFA--FPIPYE
GSIB_SHISS      PVGTGPYELDTWNQTDFVKVKKFAGYWQPGLPKLDSI--TWRPVADNNTRAAMLQTGEAQFA--FPIPYE
GSIB_SHIFL      PVGTGPYELDTWNQTDFVKVKKFAGYWQPGLPKLDSI--TWRPVADNNTRAAMLQTGEAQFA--FPIPYE
GSIB_ECOLI      PVGTGPYELDTWNQTDFVKVKKFAGYWQPGLPKLDSI--TWRPVADNNTRAAMLQTGEAQFA--FPIPYE
SAPA_SALTY      PVGTGPFQLSEYRAGQFIRLQRHDGFWRGK----------------------------------------
OPPA1_LACLA     TLVTGPFKPENVVAGESIKYVPNPYYWGEKPKL---NSITYEIVSTAKSVAA-LSAHKYDYINDM-RASQ
SAPA_ECOLI      V-GTGPYQLSEYRAGQFIRLQRHDDFWRGK----------------------------------------
GSIB_SALCH      PVGTGPYQLETWNQTDFVKVKKFAGYW-------------------------------------------
GSIB_SALTY      PVGTGPYQLETWNQTDFVKVKKFAGYW-------------------------------------------
GSIB_SALTI      PVGTGPYQLETWNQTDFVKVKKFAGYW-------------------------------------------
GSIB_SALPA      PVGTGPYQLETWNQTDFVKVKKFSGYW-------------------------------------------
Y3859_BRUME     PIGTGPFKFNKYVADQYVELTANPDY--------------------------------------------
Y3409_BRUSU     PIGTGPFKFNKYVADQYVELTANPDY--------------------------------------------
Y3312_BRUA2     PIGTGPFKFNKYVADQYVELTANPDY--------------------------------------------
Y3092_BRUAB     PIGTGPFKFNKYVADQYVELTANPDY--------------------------------------------
Y2552_BRUO2     PIGTGPFKFNKYVADQYVELTANPDY--------------------------------------------
NIKA_ECOLI      ----------------------------------------------------------------------
APPA_BACSU      -IGSGPFKFKEWKQGQYIKLEANDDYFEGR-PYLDTV--TYKVIPDANAAEAQLQAG---DINFFNVPAT
Y210_BRUME      ----------------------------------------------------------------------
Y1049_BRUA2     ----------------------------------------------------------------------
Y1030_BRUAB     ----------------------------------------------------------------------
Y1090_BRUSU     ----------------------------------------------------------------------
SYL_PROM5       ----------------------------------------------------------------------
RPOC_UREU1      I--------------SAFDYDQKYEYFKETDELVAKLREFYLDGTDDERYTKVVQAWSQTKDKVTHDIEK
Y4TO_RHISN      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           YEGIKEKYKNNIIYSMQNSTSYFFNFNLDRKSYNYTSKTSDIEKKSTQEAVLNKNFRQAINFAFDRTSYG
ALIB_STRR6      YEGIKEKYKNNIIYSMQNSTSYFFNFNLDRKSYNYTSKTSDIEKKSTQEAVLNKNFRQAINFAFDRTSYG
ALIB_STRPN      YEGIKEKYKNNIIYSMQNSTSYFFNFNLDRKSYNYTSKTSDIEKKSTQEAVLNKNFRQAINFAFDRTSYG
ALIA_STRPN      FAELEKSMKDNIVYTQQDSITYLVGTNIDRQSYKYTSKTSDEQKASTKKALLNKDFRQAIAFGFDRTAYA
SARA_STRGC      FSKVEKEFKDNIVYTPQDSTSYLVGVNIDRQAYNHTAKSSDAQKSSTKKALMNKDFRQALSFAFDRTAYA
AMIA_STRPN      YSKVAEEYKDNIYYTQSGSGIAGLGVNIDRQSYNYTSKTTDSEKVATKKALLNKDFRQALNFALDRSAYS
YGIS_ECOLI      ---AIEKSLPGELRIIPRLNSEYYNFNLEKPPFN------------------------------------
OPPA_BACSU      TESLPTLKKDGSLHVEPIAGVYWYKFNTEAKPLD------------------NVNIRKALTYSLDRQS--
OPPA_SALTY      FQKLKKEIPNEVRVDPYLCT-YYYEINNQKAPFNDVRVRTALKLALDRDIIVNK----------------
OPPA_ECOLI      FQKLKKEIPDEVHVDPYLCT-YYYEINNQKPPFNDVRVRTALKLGMDRDIIVNK----------------
MPPA_ECOLI      QKLLKD--IPGQVYTPPQLGTYYYAFNADQRVRLALSMT--IDRRLMTEKVLGTGEKPAWHFTPDVTA--
DPPE_BACSU      SDQLLDQDNVNIV---DQAGLYFYRFNVNMEPFQ------------------NENIRKAFAMAVDQVKYV
OPPA_HAEIN      FAKLQKELPGE-VYVTRTLGTYSYELNNKKAPFD------------------NVNIRKALNLSLDRNVIT
DPPA_ECOLI      ----------------------------------------------------------------------
HBPA_HAEIN      LAKMKTDPKVQLLEQKGLNVAY-IAFNTEKAPFD------------------NVKVRQALNYAVDK----
OPPA_LACLS      YKQVK-NLKGYKVLGQQAMAISLMYYNLG----HYDAKNS-INVQDRKTPLQDQNVRQAIGYA-------
Y213_HAEIN      ----------------------------------------------------------------------
OPPA2_LACLA     YKQVK-NLKGYKVLGQQAMYISLMYYNLG----HYDAKNS-INVQDRKTPLQDQNVRQAIGYA-------
UF71_DEIRA      MDGGKVK-GTLIPNASARASSDFMVFNMDDSATFKTKLFSNVKFRQAMSMLMNRD---------------
GSIB_SHIBS      QAALLEKNKNIELMASPSIMQRYISMNVTQKPFD------------------NPKVREALNYAINR----
GSIB_ECOUT      QAALLEKNKNIELMASPSIMQRYISMNVTQKPFD------------------NPKVREALNYAINR----
GSIB_ECOL6      QAALLEKNKNIELMASPSIMQRYISMNVTQKPFD------------------NPKVREALNYAINR----
GSIB_ECOL5      QAALLEKNKNIELMASPSIMQRYISMNVTQKPFD------------------NPKVREALNYAINR----
GSIB_ECOK1      QAALLEKNKNIELMASPSIMQRYISMNVTQKPFD------------------NPKVREALNYAINR----
GSIB_SHIF8      QATLLEKNKNIELMASPSIMQRYISMNVTQKPFD------------------NPKVREALNYAINR----
GSIB_SHIDS      QAALLEKNKNIELMASPSIMQRYISMNVTQKPFD------------------NPKVREALNYAINR----
GSIB_ECO57      QAALLEKNKNIELMASPSIMQRYISMNVTQKPFD------------------NPKVREALNYAINR----
GSIB_SHISS      QATLLEKNKNIELMASPSIMQRYISMNVTQKPFD------------------NPKVREALNYAINR----
GSIB_SHIFL      QATLLEKNKNIELMASPSIMQRYISMNVTQKPFD------------------NPKVREALNYAINR----
GSIB_ECOLI      QATLLEKNKNIELMASPSIMQRYISMNVTQKPFD------------------NPKVREALNYAINR----
SAPA_SALTY      ----------------------------------------------------------------------
OPPA1_LACLA     YKQVKD-VKGYKVLGQQELYISLMYYNLG----HYDVKKS-ISVQDRKTPLQDQNVREALGYA--RNVAA
SAPA_ECOLI      ----------------------------------------------------------------------
GSIB_SALCH      ----------------------------------------------------------------------
GSIB_SALTY      ----------------------------------------------------------------------
GSIB_SALTI      ----------------------------------------------------------------------
GSIB_SALPA      ----------------------------------------------------------------------
Y3859_BRUME     ----------------------------------------------------------------------
Y3409_BRUSU     ----------------------------------------------------------------------
Y3312_BRUA2     ----------------------------------------------------------------------
Y3092_BRUAB     ----------------------------------------------------------------------
Y2552_BRUO2     ----------------------------------------------------------------------
NIKA_ECOLI      ----------------------------------------------------------------------
APPA_BACSU      DYKTAEKF-NNLKIVTDLALSYVY-----------------IGWNEKNELFKDKKVRQALTTALDRESIV
Y210_BRUME      ----------------------------------------------------------------------
Y1049_BRUA2     ----------------------------------------------------------------------
Y1030_BRUAB     ----------------------------------------------------------------------
Y1090_BRUSU     ----------------------------------------------------------------------
SYL_PROM5       ----------------------------------------------------------------------
RPOC_UREU1      LIN-SDEYKDNPIVIMAKSTSNFTQLGLMSKSYNYDQKNNSGVIKDTIEIPIKHSFIEGLSVSYFNSSFG
Y4TO_RHISN      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           AQSEGKEGATKILRNLVVPPNFVSIKGKDFGEVVASKMVNYGKEWQGINFADGQDPYYNPXXXXXXXXXX
ALIB_STRR6      AQSEGKEGATKILRNLVVPPNFVSIKGKDFGEVVASKMVNYGKEWQGINFADGQDPYYNPXXXXXXXXXX
ALIB_STRPN      AQSEGKEGATKILRNLVVPPNFVSIKGKDFGEVVASKMVNYGKEWQGINFADGQDPYYNPXXXXXXXXXX
ALIA_STRPN      SQLNGQTGASKILRNLFVPPTFVQADGKNFGDMVKEKLVTYGDEWKDVNLADSQDGLYNPXXXXXXXXXX
SARA_STRGC      SQVNGKEGATKMLRNLYIPPTFVQADGKSFGELVKEKVASYGDEWKDVNFDDAQDGLYNXXXXXXXXXXX
AMIA_STRPN      AQINGKDGAALAVRNLFVKPDFVSAGEKTFGDLVAAQLPAYGDEWKGVNLADGQDGLFNXXXXXXXXXXX
YGIS_ECOLI      ----------------------------------------------------------------------
OPPA_BACSU      -----------IVKNVT--------QGEQMPAMAAVPPTMKG-------FEDNKEGYFKDNDVKTAKEYL
OPPA_SALTY      ----------------------------------------------------------------------
OPPA_ECOLI      ----------------------------------------------------------------------
MPPA_ECOLI      ----------------------------------------------------------------------
DPPE_BACSU      TKNNEKPA------HAFVSPGFTQPDGKDFREAGGDLIKPNESKAKQLLEKGMKEENYNKLP--------
OPPA_HAEIN      DKVLG-QGQTP---TYVFTPTYI-----EEGHLI--QQPAYSKE-----------PMAQRNEEAIKLLEE
DPPA_ECOLI      ----------------------------------------------------------------------
HBPA_HAEIN      ----------------------------------------------------------------------
OPPA_LACLS      --RNVAEVANKFSNGLSTPAN--SLIPPIFKQFTSSSVKGYEKQ--------------------------
Y213_HAEIN      ----------------------------------------------------------------------
OPPA2_LACLA     ----------------------------------------------------------------------
UF71_DEIRA      ----------------------------------------------------------------------
GSIB_SHIBS      ----------------------------------------------------------------------
GSIB_ECOUT      ----------------------------------------------------------------------
GSIB_ECOL6      ----------------------------------------------------------------------
GSIB_ECOL5      ----------------------------------------------------------------------
GSIB_ECOK1      ----------------------------------------------------------------------
GSIB_SHIF8      ----------------------------------------------------------------------
GSIB_SHIDS      ----------------------------------------------------------------------
GSIB_ECO57      ----------------------------------------------------------------------
GSIB_SHISS      ----------------------------------------------------------------------
GSIB_SHIFL      ----------------------------------------------------------------------
GSIB_ECOLI      ----------------------------------------------------------------------
SAPA_SALTY      ----------------------------------------------------------------------
OPPA1_LACLA     VQAKFSNGLATPANGLIPP---------------------------------------------------
SAPA_ECOLI      ----------------------------------------------------------------------
GSIB_SALCH      ----------------------------------------------------------------------
GSIB_SALTY      ----------------------------------------------------------------------
GSIB_SALTI      ----------------------------------------------------------------------
GSIB_SALPA      ----------------------------------------------------------------------
Y3859_BRUME     ----------------------------------------------------------------------
Y3409_BRUSU     ----------------------------------------------------------------------
Y3312_BRUA2     ----------------------------------------------------------------------
Y3092_BRUAB     ----------------------------------------------------------------------
Y2552_BRUO2     ----------------------------------------------------------------------
NIKA_ECOLI      ----------------------------------------------------------------------
APPA_BACSU      SQVLDGDGEVAYIPESPLSWNYIDVPKFEYNEKKAKQML-------------------------------
Y210_BRUME      ----------------------------------------------------------------------
Y1049_BRUA2     ----------------------------------------------------------------------
Y1030_BRUAB     ----------------------------------------------------------------------
Y1090_BRUSU     ----------------------------------------------------------------------
SYL_PROM5       ----------------------------------------------------------------------
RPOC_UREU1      ARKGMTDTAMKMTRKLVDSTQAVVIKGNDCG---------------------------------------
Y4TO_RHISN      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           XXXXXXXGVQFPIHLDKTVEVTDKVGIQGVSSIKQSIESVLGSDNVVIDIQQLTSDEFDSSGYFAQTAAQ
ALIB_STRR6      XXXXXXXGVQFPIHLDKTVEVTDKVGIQGVSSIKQSIESVLGSDNVVIDIQQLTSDEFDSSGYFAQTAAQ
ALIB_STRPN      XXXXXXXGVQFPIHLDKTVEVTDKVGIQGVSSIKQSIESVLGSDNVVIDIQQLTSDEFDSSGYFAQTAAQ
ALIA_STRPN      XSALQAEGVQFPIHLDMPVDQTATTKVQRVQSMKQSLEATLGADNVIIDIQQLQKDEVNNITYFAENAAG
SARA_STRGC      XXXLQEEGVEFPIHLDMPVDQTATAKVQRVQSLKQSIESSLGTDNVVVDIHQMKTDDVLNITYYAASAAE
AMIA_STRPN      XXXXXXXGVQFPIHLDVPVDQASKNYISRIQSFKQSXXXXXXXXXXXXDIQQMTSDEFLNITYYAANASS
YGIS_ECOLI      ----------------------------------------------------------------------
OPPA_BACSU      EKGLKEMGLSKASDLPK-IKLSYNTD-DAHAKIAQAVQE-MWKKNLGVDV-ELDNSEWN---VYIDKLHS
OPPA_SALTY      ----------------------------------------------------------------------
OPPA_ECOLI      ----------------------------------------------------------------------
MPPA_ECOLI      ----------------------------------------------------------------------
DPPE_BACSU      -----------AITLTYSTKPEHK---KIAEAIQQKLKNSLGVDNVFLEDQKALKFQFSQSSFL------
OPPA_HAEIN      AGYSKANPLKFSI-LYNTNENHKKVAIAAASMWKANTKG-------LIDV-KLENQEWKT---YIDSRRA
DPPA_ECOLI      ----------------------------------------------------------------------
HBPA_HAEIN      ----------------------------------------------------------------------
OPPA_LACLS      ----------------------------------------------------------------------
Y213_HAEIN      -----------------------------------------------------------------QTART
OPPA2_LACLA     ----------------------------------------------------------------------
UF71_DEIRA      ----------------------------------------------------------------------
GSIB_SHIBS      ----------------------------------------------------------------------
GSIB_ECOUT      ----------------------------------------------------------------------
GSIB_ECOL6      ----------------------------------------------------------------------
GSIB_ECOL5      ----------------------------------------------------------------------
GSIB_ECOK1      ----------------------------------------------------------------------
GSIB_SHIF8      ----------------------------------------------------------------------
GSIB_SHIDS      ----------------------------------------------------------------------
GSIB_ECO57      ----------------------------------------------------------------------
GSIB_SHISS      ----------------------------------------------------------------------
GSIB_SHIFL      ----------------------------------------------------------------------
GSIB_ECOLI      ----------------------------------------------------------------------
SAPA_SALTY      ----------------------------------------------------------------------
OPPA1_LACLA     ----------------------------------------------------------------------
SAPA_ECOLI      ----------------------------------------------------------------------
GSIB_SALCH      ----------------------------------------------------------------------
GSIB_SALTY      ----------------------------------------------------------------------
GSIB_SALTI      ----------------------------------------------------------------------
GSIB_SALPA      ----------------------------------------------------------------------
Y3859_BRUME     ----------------------------------------------------------------------
Y3409_BRUSU     ----------------------------------------------------------------------
Y3312_BRUA2     ----------------------------------------------------------------------
Y3092_BRUAB     ----------------------------------------------------------------------
Y2552_BRUO2     ----------------------------------------------------------------------
NIKA_ECOLI      ----------------------------------------------------------------------
APPA_BACSU      ----------------------------------------------------------------------
Y210_BRUME      ----------------------------------------------------------------------
Y1049_BRUA2     ----------------------------------------------------------------------
Y1030_BRUAB     ----------------------------------------------------------------------
Y1090_BRUSU     ----------------------------------------------------------------------
SYL_PROM5       ----------------------------------------------------------------------
RPOC_UREU1      ----------------------------------------------------------------------
Y4TO_RHISN      ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           KDYDLYHGGWGPDYQDPSTYLDIFNTNSGGVLXNLGLEPGEXNDKAKAVGLDVYTQMLEEANKEQDPAKR
ALIB_STRR6      KDYDLYHGGWGPDYQDPSTYLDIFNTNSGGFLQNLGLEPGEANDKAKAVGLDVYTQMLEEANKEQDPAKR
ALIB_STRPN      KDYDLYHGGWGPDYQDPSTYLDIFNTNSGGFLQNLGLEPGEANDKAKAVGLDVYTQMLEEANKEQDPAKR
ALIA_STRPN      EDWDLSDNGWGPDFADPSTYLDIIKPSVGSTKTYLGFDSGEDNVAAKKVGLYDYEKLVTEAGDETDVAKR
SARA_STRGC      EDWDISDNGWSPDYQDPSTYLEIIKPGGENTKTFLGFD-GKENAAAEQVGLKEYAKLVDEAAAEKDVNKR
AMIA_STRPN      EDWDVSGGSWGPDYQDPSTYLDILKTTSSETTKTLGFD-NPNSPSVVQVGLKEYDKLVDEAARESDLNVR
YGIS_ECOLI      ----------------------------------------------------------------------
OPPA_BACSU      QDYQIGRMGWLGDFNDPINFLELFRDKNGG-----NNDTGWENPEFK--------KLLNQSQTETDKTKR
OPPA_SALTY      ----------------------------------------------------------------------
OPPA_ECOLI      ----------------------------------------------------------------------
MPPA_ECOLI      ----------------------------------------------------------------------
DPPE_BACSU      -----------PDYADPISFLEAFQT--GNSMNRTGWANKE------------YDQLIKQAKNEADEKTR
OPPA_HAEIN      GRYDVARAGWNADYNQATTFGNYFLSNSS-------------NNTAKYANPEYDKAMAESATDAEGRAKA
DPPA_ECOLI      ----------------------------------------------------------------------
HBPA_HAEIN      ----------------------------------------------------------------------
OPPA_LACLS      ----------------------------------------------------------------------
Y213_HAEIN      KDFQLIRSGWCADFNDPAAFLNLFYSKS----------PDNKNGYKNA----EFDRLFESAMTTISEKVR
OPPA2_LACLA     ----------------------------------------------------------------------
UF71_DEIRA      ----------------------------------------------------------------------
GSIB_SHIBS      ----------------------------------------------------------------------
GSIB_ECOUT      ----------------------------------------------------------------------
GSIB_ECOL6      ----------------------------------------------------------------------
GSIB_ECOL5      ----------------------------------------------------------------------
GSIB_ECOK1      ----------------------------------------------------------------------
GSIB_SHIF8      ----------------------------------------------------------------------
GSIB_SHIDS      ----------------------------------------------------------------------
GSIB_ECO57      ----------------------------------------------------------------------
GSIB_SHISS      ----------------------------------------------------------------------
GSIB_SHIFL      ----------------------------------------------------------------------
GSIB_ECOLI      ----------------------------------------------------------------------
SAPA_SALTY      ----------------------------------------------------------------------
OPPA1_LACLA     ----------------------------------------------------------------------
SAPA_ECOLI      ----------------------------------------------------------------------
GSIB_SALCH      ----------------------------------------------------------------------
GSIB_SALTY      ----------------------------------------------------------------------
GSIB_SALTI      ----------------------------------------------------------------------
GSIB_SALPA      ----------------------------------------------------------------------
Y3859_BRUME     ----------------------------------------------------------------------
Y3409_BRUSU     ----------------------------------------------------------------------
Y3312_BRUA2     ----------------------------------------------------------------------
Y3092_BRUAB     ----------------------------------------------------------------------
Y2552_BRUO2     ----------------------------------------------------------------------
NIKA_ECOLI      ----------------------------------------------------------------------
APPA_BACSU      ----------------------------------------------------------------------
Y210_BRUME      ----------------------------------------------------------------------
Y1049_BRUA2     ----------------------------------------------------------------------
Y1030_BRUAB     ----------------------------------------------------------------------
Y1090_BRUSU     ----------------------------------------------------------------------
SYL_PROM5       ----------------------------------------------------------------------
RPOC_UREU1      ----------------------------------------------------------------------
Y4TO_RHISN      ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           YEKYADIQAWLIDSSLVLPSVSRGGTPSLRRTVPFAAAYGLTGTKGVESYKYLKVQDKIVTTDEYAKARE
ALIB_STRR6      YEKYADIQAWLIDSSLVLPSVSRGGTPSLRRTVPFAAAYGLTGTKGVESYKYLKVQDKIVTTDEYAKARE
ALIB_STRPN      YEKYADIQAWLIDSSLVLPSVSRGGTPSLRRTVPFAAAYGLTGTKGVESYKYLKVQDKIVTTDEYAKARE
ALIA_STRPN      YDKYAAAQAWLTDSALIIPTTSRTGRPILSKMVPFTIPFALSGNKGTSEYKYLELQDKAVTVDEYQKAQE
SARA_STRGC      YEKYATAQAWLTDSALLIPTTSRTGRPVLTKIVPFTAPFAWSGAKGMASYKYLKLQDKAVTAKEYQKAQE
AMIA_STRPN      YEKYAAAQAWLTDSSLFIPAMSSGAAPVLSRIVPFTGASAQTGSKGSDVYKYLKSQDKVVTKEEYEKARE
YGIS_ECOLI      ----------------------------------------------------------------------
OPPA_BACSU      AELLKKAEGIFIDEMPVAP---------------------------------------------------
OPPA_SALTY      ----------------------------------------------------------------------
OPPA_ECOLI      ----------------------------------------------------------------------
MPPA_ECOLI      ----------------------------------------------------------------------
DPPE_BACSU      FSLMHQAEELLINEAPIIP---------------------------------------------------
OPPA_HAEIN      YAKAEEI---------------------------------------------------------------
DPPA_ECOLI      ----------------------------------------------------------------------
HBPA_HAEIN      ----------------------------------------------------------------------
OPPA_LACLS      ----------------------------------------------------------------------
Y213_HAEIN      LENYAKLKGIVQQEHLVLP---------------------------------------------------
OPPA2_LACLA     ----------------------------------------------------------------------
UF71_DEIRA      ----------------------------------------------------------------------
GSIB_SHIBS      ----------------------------------------------------------------------
GSIB_ECOUT      ----------------------------------------------------------------------
GSIB_ECOL6      ----------------------------------------------------------------------
GSIB_ECOL5      ----------------------------------------------------------------------
GSIB_ECOK1      ----------------------------------------------------------------------
GSIB_SHIF8      ----------------------------------------------------------------------
GSIB_SHIDS      ----------------------------------------------------------------------
GSIB_ECO57      ----------------------------------------------------------------------
GSIB_SHISS      ----------------------------------------------------------------------
GSIB_SHIFL      ----------------------------------------------------------------------
GSIB_ECOLI      ----------------------------------------------------------------------
SAPA_SALTY      ----------------------------------------------------------------------
OPPA1_LACLA     ----------------------------------------------------------------------
SAPA_ECOLI      ----------------------------------------------------------------------
GSIB_SALCH      ----------------------------------------------------------------------
GSIB_SALTY      ----------------------------------------------------------------------
GSIB_SALTI      ----------------------------------------------------------------------
GSIB_SALPA      ----------------------------------------------------------------------
Y3859_BRUME     ----------------------------------------------------------------------
Y3409_BRUSU     ----------------------------------------------------------------------
Y3312_BRUA2     ----------------------------------------------------------------------
Y3092_BRUAB     ----------------------------------------------------------------------
Y2552_BRUO2     ----------------------------------------------------------------------
NIKA_ECOLI      ----------------------------------------------------------------------
APPA_BACSU      ----------------------------------------------------------------------
Y210_BRUME      ----------------------------------------------------------------------
Y1049_BRUA2     ----------------------------------------------------------------------
Y1030_BRUAB     ----------------------------------------------------------------------
Y1090_BRUSU     ----------------------------------------------------------------------
SYL_PROM5       ----------------------------------------------------------------------
RPOC_UREU1      ----------------------------------------------------------------------
Y4TO_RHISN      ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           KWLKEKEESNKKAQEELAKHVK
ALIB_STRR6      KWLKEKEESNKKAQEELAKHVK
ALIB_STRPN      KWLKEKEESNKKAQEELAKHVK
ALIA_STRPN      KWMKEKEESNKKAQEDLAKHVK
SARA_STRGC      KWNKERAESNKKAQEELEKHVK
AMIA_STRPN      KWLKEKAESNEKAQKELASHVK
YGIS_ECOLI      ----------------------
OPPA_BACSU      ----------------------
OPPA_SALTY      ----------------------
OPPA_ECOLI      ----------------------
MPPA_ECOLI      ----------------------
DPPE_BACSU      ----------------------
OPPA_HAEIN      ----------------------
DPPA_ECOLI      ----------------------
HBPA_HAEIN      ----------------------
OPPA_LACLS      ----------------------
Y213_HAEIN      ----------------------
OPPA2_LACLA     ----------------------
UF71_DEIRA      ----------------------
GSIB_SHIBS      ----------------------
GSIB_ECOUT      ----------------------
GSIB_ECOL6      ----------------------
GSIB_ECOL5      ----------------------
GSIB_ECOK1      ----------------------
GSIB_SHIF8      ----------------------
GSIB_SHIDS      ----------------------
GSIB_ECO57      ----------------------
GSIB_SHISS      ----------------------
GSIB_SHIFL      ----------------------
GSIB_ECOLI      ----------------------
SAPA_SALTY      ----------------------
OPPA1_LACLA     ----------------------
SAPA_ECOLI      ----------------------
GSIB_SALCH      ----------------------
GSIB_SALTY      ----------------------
GSIB_SALTI      ----------------------
GSIB_SALPA      ----------------------
Y3859_BRUME     ----------------------
Y3409_BRUSU     ----------------------
Y3312_BRUA2     ----------------------
Y3092_BRUAB     ----------------------
Y2552_BRUO2     ----------------------
NIKA_ECOLI      ----------------------
APPA_BACSU      ----------------------
Y210_BRUME      ----------------------
Y1049_BRUA2     ----------------------
Y1030_BRUAB     ----------------------
Y1090_BRUSU     ----------------------
SYL_PROM5       ----------------------
RPOC_UREU1      ----------------------
Y4TO_RHISN      ----------------------