[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for spne4:ACF56466.1

[Show Plain Result]


## Summary of Sequence Search
    1::121
    1::120     8e-49  79%  121 aa  Y1614_STRP6 RecName: Full=Uncharacterized protein Spy1614;
    1::117     1e-29  46%  120 aa  YLOU_BACSU RecName: Full=Uncharacterized protein yloU;
   17::121     8e-14  36%  135 aa  YQHY_BACSU RecName: Full=Uncharacterized protein yqhY;
    7::108     5e-13  32%  129 aa  Y1535_STRP6 RecName: Full=Uncharacterized protein Spy1535;
   43::142     4e-08  31%  166 aa  ASP23_STAS1 RecName: Full=Alkaline shock protein 23;
   44::149     9e-08  28%  176 aa  ASP23_STAHJ RecName: Full=Alkaline shock protein 23;
   45::144     9e-08  30%  169 aa  ASP23_STAAW RecName: Full=Alkaline shock protein 23;
   45::144     9e-08  30%  169 aa  ASP23_STAAU RecName: Full=Alkaline shock protein 23;
   45::144     9e-08  30%  169 aa  ASP23_STAAS RecName: Full=Alkaline shock protein 23;
   45::144     9e-08  30%  169 aa  ASP23_STAAR RecName: Full=Alkaline shock protein 23;
   45::144     9e-08  30%  169 aa  ASP23_STAAN RecName: Full=Alkaline shock protein 23;
   45::144     9e-08  30%  169 aa  ASP23_STAAM RecName: Full=Alkaline shock protein 23;
   45::144     9e-08  30%  169 aa  ASP23_STAAC RecName: Full=Alkaline shock protein 23;
   45::144     9e-08  30%  169 aa  ASP23_STAAB RecName: Full=Alkaline shock protein 23;
   45::144     9e-08  30%  169 aa  ASP23_STAA8 RecName: Full=Alkaline shock protein 23;
   45::144     9e-08  30%  169 aa  ASP23_STAA3 RecName: Full=Alkaline shock protein 23;
   43::142     7e-07  28%  166 aa  ASP23_STAES RecName: Full=Alkaline shock protein 23;
   43::142     7e-07  28%  166 aa  ASP23_STAEQ RecName: Full=Alkaline shock protein 23;
   19::124     6e-04  29%  179 aa  GLS24_STRPM RecName: Full=Stress response regulator gls24 homolog;
   19::124     6e-04  29%  179 aa  GLS24_STRP8 RecName: Full=Stress response regulator gls24 homolog;
   19::124     6e-04  29%  179 aa  GLS24_STRP6 RecName: Full=Stress response regulator gls24 homolog;
   19::124     6e-04  29%  179 aa  GLS24_STRP3 RecName: Full=Stress response regulator gls24 homolog;
   19::124     6e-04  29%  179 aa  GLS24_STRP1 RecName: Full=Stress response regulator gls24 homolog;
    1::121

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTVKIXTKDGQXELTDEVIATVVGGAATEIFGVVGMASKNALKDNFQALLGKENYSKGVVVKAAEDGSIA
Y1614_STRP6     MTVKINTKDGLIELSDDVIATVVGGSATEIFGVVGMASKSAIKDNFQSLLRKENYAKGVVVKSTDLG-IS
YLOU_BACSU      MSIELRTKYGQIDISNEVIAMVAGGAAVDCYGIVGMASKNQIKDGLTEILRKENFSRGVQVR-QEGEQIH
YQHY_BACSU      ---------GKVEIAPEVIEVIAGIAASEVDGVAEMRGNFAT--GVVERFGKVNHGKGVKVDLADDG-IT
Y1535_STRP6     ---------GEIVISPRVLEVITGIATTQVEGVHSLHNKK-MADSFN----KASLGKGVYLQTEEDGSVT
ASP23_STAS1     --------------SDEVIEKIAGIAAREVSGILEM--KGGFVDNISSSFGSNNVSQGVSVEVGEKQA-A
ASP23_STAHJ     --------ENKLTFSDEVVEKIAGIAAREVKGILDM--KGGFADNFNAFSSGNNVTTGVSVEVGEKQA-A
ASP23_STAAW     --------------SDEVVEKIAGIAAREVKGILDM--KGGLTDTFNAFSSGNNVTQGVSVEVGEKQA-A
ASP23_STAAU     --------------SDEVVEKIAGIAAREVKGILDM--KGGLTDTFNAFSSGNNVTQGVSVEVGEKQA-A
ASP23_STAAS     --------------SDEVVEKIAGIAAREVKGILDM--KGGLTDTFNAFSSGNNVTQGVSVEVGEKQA-A
ASP23_STAAR     --------------SDEVVEKIAGIAAREVKGILDM--KGGLTDTFNAFSSGNNVTQGVSVEVGEKQA-A
ASP23_STAAN     --------------SDEVVEKIAGIAAREVKGILDM--KGGLTDTFNAFSSGNNVTQGVSVEVGEKQA-A
ASP23_STAAM     --------------SDEVVEKIAGIAAREVKGILDM--KGGLTDTFNAFSSGNNVTQGVSVEVGEKQA-A
ASP23_STAAC     --------------SDEVVEKIAGIAAREVKGILDM--KGGLTDTFNAFSSGNNVTQGVSVEVGEKQA-A
ASP23_STAAB     --------------SDEVVEKIAGIAAREVKGILDM--KGGLTDTFNAFSSGNNVTQGVSVEVGEKQA-A
ASP23_STAA8     --------------SDEVVEKIAGIAAREVKGILDM--KGGLTDTFNAFSSGNNVTQGVSVEVGEKQA-A
ASP23_STAA3     --------------SDEVVEKIAGIAAREVKGILDM--KGGLTDTFNAFSSGNNVTQGVSVEVGEKQA-A
ASP23_STAES     --------------SDEVVEKIAGIAAREVKGILDM--KGGFTDSFNAFSNGNNVTTGVSVEVGEKQA-A
ASP23_STAEQ     --------------SDEVVEKIAGIAAREVKGILDM--KGGFTDSFNAFSNGNNVTTGVSVEVGEKQA-A
GLS24_STRPM     ---------GQLTYDDKVIEKIVGLALENVDGLLGVNGGANLKDK---LVNTESVRDGVNVEVGKK-QVA
GLS24_STRP8     ---------GQLTYDDKVIEKIVGLALENVDGLLGVNGGANLKDK---LVNTESVRDGVNVEVGKK-QVA
GLS24_STRP6     ---------GQLTYDDKVIEKIVGLALENVDGLLGVNGGANLKDK---LVNTESVRDGVNVEVGKK-QVA
GLS24_STRP3     ---------GQLTYDDKVIEKIVGLALENVDGLLGVNGGANLKDK---LVNTESVRDGVNVEVGKK-QVA
GLS24_STRP1     ---------GQLTYDDKVIEKIVGLALENVDGLLGVNGGANLKDK---LVNTESVRDGVNVEVGKK-QVA


                         .         .         *         .         .         .         .:140
query           VDVYTVLSYGTKISEVSKNIQERVAFSLENQLGITAQTVNVYIQNIKVVGE
Y1614_STRP6     VDVYTVMSYGVKISEVSKNIQERVKFNLESQLGLTADMVNVYVQNIKVVGE
YLOU_BACSU      IDMYIIVSYGTKISEVAHNVQTKVKYTVNQTIGLAVDSVNIYVQGVRV---
YQHY_BACSU      IDVYCVVTFGVSIPKVAASVQENIRQTLLNMTSLSINEINIHIVGIQ----
Y1535_STRP6     ADIYVYLQYGVKVPTVSMNIQKTVKSAVYDMAEVPISAVNIHVEGI-----
ASP23_STAS1     VDLKVVLEYGESAPKIFRKVTDLVKEQVKYITGLDVVEVNMRVEDV-----
ASP23_STAHJ     IDLKVILEYGESAPKIFRKVTELVKEQVKYITGLQVVEVNMQVDDV-----
ASP23_STAAW     VDLKVILEYGESAPKIFRKVTELVKEQVKYITGLDVVEVNMQVDDV-----
ASP23_STAAU     VDLKVILEYGESAPKIFRKVTELVKEQVKYITGLDVVEVNMQVDDV-----
ASP23_STAAS     VDLKVILEYGESAPKIFRKVTELVKEQVKYITGLDVVEVNMQVDDV-----
ASP23_STAAR     VDLKVILEYGESAPKIFRKVTELVKEQVKYITGLDVVEVNMQVDDV-----
ASP23_STAAN     VDLKVILEYGESAPKIFRKVTELVKEQVKYITGLDVVEVNMQVDDV-----
ASP23_STAAM     VDLKVILEYGESAPKIFRKVTELVKEQVKYITGLDVVEVNMQVDDV-----
ASP23_STAAC     VDLKVILEYGESAPKIFRKVTELVKEQVKYITGLDVVEVNMQVDDV-----
ASP23_STAAB     VDLKVILEYGESAPKIFRKVTELVKEQVKYITGLDVVEVNMQVDDV-----
ASP23_STAA8     VDLKVILEYGESAPKIFRKVTELVKEQVKYITGLDVVEVNMQVDDV-----
ASP23_STAA3     VDLKVILEYGESAPKIFRKVTELVKEQVKYITGLDVVEVNMQVDDV-----
ASP23_STAES     VDLKVILEYGESAPKIFRKVTDLVKEQVKYITGLEVVEVNMQVDDV-----
ASP23_STAEQ     VDLKVILEYGESAPKIFRKVTDLVKEQVKYITGLEVVEVNMQVDDV-----
GLS24_STRPM     VDLDIVAEYQKHVPTIYDSIKSIVEEEVKRMTDLDVIEVNVKVVDIK----
GLS24_STRP8     VDLDIVAEYQKHVPTIYDSIKSIVEEEVKRMTDLDVIEVNVKVVDIK----
GLS24_STRP6     VDLDIVAEYQKHVPTIYDSIKSIVEEEVKRMTDLDVIEVNVKVVDIK----
GLS24_STRP3     VDLDIVAEYQKHVPTIYDSIKSIVEEEVKRMTDLDVIEVNVKVVDIK----
GLS24_STRP1     VDLDIVAEYQKHVPTIYDSIKSIVEEEVKRMTDLDVIEVNVKVVDIK----