[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for spne4:ACF56471.1

[Show Plain Result]


## Summary of Sequence Search
    1::234
  464::663     8e-37  40%  663 aa  SARA_STRGC RecName: Full=Oligopeptide-binding protein sarA;AltName:
  475::660     3e-35  42%  660 aa  ALIA_STRPN RecName: Full=Oligopeptide-binding protein aliA;AltName:
  489::652     9e-35  45%  652 aa  ALIB_STRR6 RecName: Full=Oligopeptide-binding protein aliB;Flags:
  489::652     9e-35  45%  652 aa  ALIB_STRPN RecName: Full=Oligopeptide-binding protein aliB;Flags:
  476::659     8e-32  43%  659 aa  AMIA_STRPN RecName: Full=Oligopeptide-binding protein amiA;Flags:
  381::507     4e-06  30%  543 aa  OPPA_SALTY RecName: Full=Periplasmic oligopeptide-binding
  143::269     4e-04  31%  273 aa  GLNH_BACSU RecName: Full=ABC transporter glutamine-binding protein
  362::477     5e-04  33%  514 aa  Y213_HAEIN RecName: Full=Putative binding protein HI0213;Flags:
  437::512     9e-04  33%  545 aa  OPPA_BACSU RecName: Full=Oligopeptide-binding protein oppA;AltName:
    1::234

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxADAPTTFSYVYAVDPASLGYSIATRTSTTDVIGNVIDGLMENDKYGNVAPSQ
SARA_STRGC      ----------------------------------SIESSLGTDNVVVDIHQMKTDDVL-NITYYAASAAE
ALIA_STRPN      ---------------------------------------------------------LQKDEVNNITAAG
ALIB_STRR6      --------------------------------------------------------------------AQ
ALIB_STRPN      --------------------------------------------------------------------AQ
AMIA_STRPN      ---------------------------------------------------------MTSDEFLNITASS
OPPA_SALTY      ------------------ADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVN--LENQEWKTFLDTQ
GLNH_BACSU      ----------------------------------------------------------------------
Y213_HAEIN      -------------------------------DDLSLNQTIAMRLSQSDLLRVENQGMSWQEL--QTARTK
OPPA_BACSU      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           KDYDLNSTGWAPSYQDPASYLNIMDPKSGSAMKHLGITKGKDKDVVAKPGLDKYKKLLEDAVSETTDLEK
SARA_STRGC      EDWDISNVGWSPDYQDPSTYLEIIKPGGENTKTFLGFD-GKENAAAEQVGLKEYAKLVDEAAAEKTDVNK
ALIA_STRPN      EDWDLSNVGWGPDFADPSTYLDIIKPSVGESTKYLGFDSGEDNVAAKKVGLYDYEKLVTEAGDETTDVAK
ALIB_STRR6      KDYDLYHGGWGPDYQDPSTYLDIFNTNSGGFLQNLGLEPGEANDKAKAVGLDVYTQMLEEANKE-QDPAK
ALIB_STRPN      KDYDLYHGGWGPDYQDPSTYLDIFNTNSGGFLQNLGLEPGEANDKAKAVGLDVYTQMLEEANKE-QDPAK
AMIA_STRPN      EDWDVSGVSWGPDYQDPSTYLDILKTTSSETTKYLGFDNPNSPSVV-QVGLKEYDKLVDEAARETSDLNV
OPPA_SALTY      GTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAH-----------YKSPAFD---KLIADTLKVADDTQ-
GLNH_BACSU      --------------------------KKGSKIKSVE-NLGKGSKVLAVKGSTSSQNIREKA-PEASVLE-
Y213_HAEIN      GDFQLIRSGWCADFNDPAAFLNLFYSKSPD-------NKNGYKNA-------EFDRLFESAM--TTISEK
OPPA_BACSU      QDYQIGRMGWLGDFNDPINFLELFRDKNG----------GNNDTGWENP---EFKKLLNQSQTE-TDKTK


                         +         .         .         .         .         *         .:210
query           RYEKYAKAQAWSTDSSLLMPTAXXXXXXXXXXXXXFSKPYSQVGIKGEPYIFKGMKLQKDIVTTKEYNEV
SARA_STRGC      RYEKYATAQAWLTDSALLIPTTSRTGRPVLTKIVPFTAPFAWSGAKGRDMAYKYLKLQDKAVTAKEYQKA
ALIA_STRPN      RYDKYAAAQAWLTDSALIIPTTSRTGRPILSKMVPFTIPFALSGNKGEPVLYKYLELQDKAVTVDEYQKA
ALIB_STRR6      RYEKYADIQAWLIDSSLVLPSVSRGGTPSLRRTVPFAAAYGLTGTKGVE-SYKYLKVQDKIVTTDEYAKA
ALIB_STRPN      RYEKYADIQAWLIDSSLVLPSVSRGGTPSLRRTVPFAAAYGLTGTKGVE-SYKYLKVQDKIVTTDEYAKA
AMIA_STRPN      RYEKYAAAQAWLTDSSLFIPAASSGAAPVLSRIVPFTGASAQTGSKGSDVYFKYLKSQDKVVTKEEYEKA
OPPA_SALTY      RSELYAKAEQQLDKDSAIVP--------------------------------------------------
GLNH_BACSU      -FENYAEADALTTDNAILYGMADENKNYQLTGKPFTDEPYGIAVKKGQSALAKEINASKKMKSDGRYDEI
Y213_HAEIN      RLENYAKLKGIVQQEHLVLP--------------------------------------------------
OPPA_BACSU      RAELLKKAEGIFIDEMPVAP--------------------------------------------------


                         .         .         .         +         .         .         .:280
query           FKKWQKEKLESNSKYQKELEKYIK
SARA_STRGC      QEKWNKERAESNKKAQEELEKHVK
ALIA_STRPN      QEKWMKEKEESNKKAQEDLAKHVK
ALIB_STRR6      REKWLKEKEESNKKAQEELAKHVK
ALIB_STRPN      REKWLKEKEESNKKAQEELAKHVK
AMIA_STRPN      REKWLKEKAESNEKAQKELASHVK
OPPA_SALTY      ------------------------
GLNH_BACSU      YKKWIKE-----------------
Y213_HAEIN      ------------------------
OPPA_BACSU      ------------------------