[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for spne4:ACF56555.1

[Show Plain Result]


## Summary of Sequence Search
    1::408
   78::163     5e-04  30%  328 aa  CCSA_MICAN RecName: Full=Cytochrome c biogenesis protein ccsA;
    1::408

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
CCSA_MICAN      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
CCSA_MICAN      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
CCSA_MICAN      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxLIWNMNKVLLVLFIISTSQAVINVTVPVSTLFLRNQPFLNLQTGQSLALLSTFELSALI
CCSA_MICAN      -----------LAWGVTAVHLIAEYTSRSRLVGVVTTPVA---------MGITAFATLSLPGEMQTSAPL


                         .         *         .         .         .         .         +:350
query           VGSLVSGYLQHTISIKTALYASLVIQLLLLVGFATVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
CCSA_MICAN      VPALKSNWLMMHVSVMMLSYAALMVGSLMAIAFLIV----------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
CCSA_MICAN      ----------------------------------------------------------