[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for spne4:ACF56614.1

[Show Plain Result]


## Summary of Sequence Search
    1::195
  158::203     9e-07  48%  297 aa  XLYA_BACSU RecName: Full=N-acetylmuramoyl-L-alanine amidase xlyA;  
   19::71      3e-06  38%  334 aa  LYTE_BACSU RecName: Full=Probable endopeptidase lytE;       
  412::458     5e-06  38%  508 aa  SPA_STAAU RecName: Full=Immunoglobulin G-binding protein A;        
  354::400     5e-06  38%  450 aa  SPA_STAAN RecName: Full=Immunoglobulin G-binding protein A;        
  354::400     5e-06  38%  450 aa  SPA_STAAM RecName: Full=Immunoglobulin G-binding protein A;        
  420::466     5e-06  38%  516 aa  SPA_STAA8 RecName: Full=Immunoglobulin G-binding protein A;        
   40::86      1e-05  47%  251 aa  YGER_ECOLI RecName: Full=Uncharacterized lipoprotein ygeR;Flags:
  312::357     2e-05  50%  524 aa  P60_LISIV RecName: Full=Protein p60;AltName:
   69::123     3e-05  42%  287 aa  YOCH_BACSU RecName: Full=Cell wall-binding protein yocH;Flags:
  619::664     3e-05  39%  666 aa  MUR2_ENTHR RecName: Full=Muramidase-2;         EC=3.2.1.17;AltName:
  161::210     3e-05  45%  263 aa  LYS_BPB03 RecName: Full=Lysozyme;         EC=3.2.1.17;AltName:
   86::127     7e-05  45%  324 aa  SLE1_STAES RecName: Full=N-acetylmuramoyl-L-alanine amidase sle1;  
   86::127     7e-05  45%  324 aa  SLE1_STAEQ RecName: Full=N-acetylmuramoyl-L-alanine amidase sle1;  
  314::349     7e-05  50%  524 aa  P60_LISWE RecName: Full=Protein p60;AltName:
  147::208     7e-05  46%  258 aa  LYS_BPPH2 RecName: Full=Lysozyme;         EC=3.2.1.17;AltName:
   88::129     9e-05  48%  327 aa  SLE1_STAS1 RecName: Full=N-acetylmuramoyl-L-alanine amidase sle1;  
   21::70      9e-05  38%  488 aa  LYTF_BACSU RecName: Full=Endopeptidase lytF;       
  156::208     1e-04  40%  258 aa  LYS_BPPZA RecName: Full=Lysozyme;         EC=3.2.1.17;AltName:
  153::197     1e-04  42%  329 aa  SLE1_STAHJ RecName: Full=N-acetylmuramoyl-L-alanine amidase sle1;  
  393::426     2e-04  53%  447 aa  TAGH_ENTFA RecName: Full=Teichoic acids export ATP-binding protein
  204::253     2e-04  47%  253 aa  Y888_DEIRA RecName: Full=Uncharacterized protein DR_0888;
  160::203     2e-04  43%  335 aa  SLE1_STAAB RecName: Full=N-acetylmuramoyl-L-alanine amidase sle1;  
  179::217     3e-04  46%  317 aa  XLYB_BACSU RecName: Full=N-acetylmuramoyl-L-alanine amidase xlyB;  
  319::353     4e-04  49%  523 aa  P60_LISSE RecName: Full=Protein p60;AltName:
  363::404     4e-04  45%  737 aa  ALYS_ENTFA RecName: Full=Autolysin;         EC=3.2.1.-;AltName:
  167::219     6e-04  36%  383 aa  LYTN_STAAW RecName: Full=Probable cell wall hydrolase lytN;        
  167::219     6e-04  36%  383 aa  LYTN_STAAS RecName: Full=Probable cell wall hydrolase lytN;        
  167::219     6e-04  36%  383 aa  LYTN_STAAR RecName: Full=Probable cell wall hydrolase lytN;        
  167::219     6e-04  36%  383 aa  LYTN_STAAN RecName: Full=Probable cell wall hydrolase lytN;        
  167::219     6e-04  36%  383 aa  LYTN_STAAM RecName: Full=Probable cell wall hydrolase lytN;        
  167::219     6e-04  36%  383 aa  LYTN_STAAC RecName: Full=Probable cell wall hydrolase lytN;        
  167::219     6e-04  36%  383 aa  LYTN_STAA8 RecName: Full=Probable cell wall hydrolase lytN;        
  160::201     0.001  43%  334 aa  SLE1_STAAW RecName: Full=N-acetylmuramoyl-L-alanine amidase sle1;  
  160::201     0.001  43%  334 aa  SLE1_STAAU RecName: Full=N-acetylmuramoyl-L-alanine amidase sle1;  
  160::201     0.001  43%  334 aa  SLE1_STAAS RecName: Full=N-acetylmuramoyl-L-alanine amidase sle1;  
  160::201     0.001  43%  334 aa  SLE1_STAAN RecName: Full=N-acetylmuramoyl-L-alanine amidase sle1;  
  160::201     0.001  43%  334 aa  SLE1_STAAC RecName: Full=N-acetylmuramoyl-L-alanine amidase sle1;  
  160::201     0.001  43%  334 aa  SLE1_STAA8 RecName: Full=N-acetylmuramoyl-L-alanine amidase sle1;  
  160::201     0.001  43%  334 aa  SLE1_STAA3 RecName: Full=N-acetylmuramoyl-L-alanine amidase sle1;  
  175::238     0.001  37%  238 aa  ISAA_STAHJ RecName: Full=Probable transglycosylase isaA;       
    1::195

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxPSFVSAQESSTYTVKEGDTLSEIAETHNTTVEKLAENNHIDNIHLIY
XLYA_BACSU      -------------------------------SQTYVVKQGDTLTSIARAFGVTVAQLQEWNNIEDPNLIR
LYTE_BACSU      -------------------------FAGAASAQSIKVKKGDTLWDLSRKYDTTISKIKSENHLRS-DIIY
SPA_STAAU       -------------------------------NGVHVVKPGDTVNDIAKANGTTADKIAADNKLADKNMIK
SPA_STAAN       -------------------------------NGVHVVKPGDTVNDIAKANGTTADKIAADNKLADKNMIK
SPA_STAAM       -------------------------------NGVHVVKPGDTVNDIAKANGTTADKIAADNKLADKNMIK
SPA_STAA8       -------------------------------NGVHVVKPGDTVNDIAKANGTTADKIAADNKLADKNMIK
YGER_ECOLI      --------------------------------SVYTVKRGDTLYRISRTTGTSVKELARLNGISPPYTIE
P60_LISIV       --------------------------------SSYTVKSGDTLSKIATTFGTTVSKIKALNGLNSDNL-Q
YOCH_BACSU      --------------------------ISSEETTTYTIKAGDTLSKIAQKFGTTVNNLKVWNNLSS-DMIY
MUR2_ENTHR      ------------------------------DEKTYTVKAGESVWGVADSHGITMNQLIEWNNIKN-NFIY
LYS_BPB03       ------------------------------KTNTHVVKKGDTLSEIAKKIKTSTKTLLENPTIKNPNKIY
SLE1_STAES      ----------------------------------YTVKAGDSLSSIAAKYGTTYQKIMQLNGLNN-YLIF
SLE1_STAEQ      ----------------------------------YTVKAGDSLSSIAAKYGTTYQKIMQLNGLNN-YLIF
P60_LISWE       --------------------------------STYTVKSGDSLSKIANTFGTSVSKIKALNNLTSDNL--
LYS_BPPH2       -----------------------PKNVSRGTSSTYKVKSGDNLTKIAKKHNTTVATLLKNPSIKDPNMIR
SLE1_STAS1      ----------------------------------YTVKSGDTLSGIAAKYGTTYQKIMSLNGLSNFN-IY
LYTF_BACSU      --------------------------VTPAEAATIKVKSGDSLWKLAQTYNTSVAALTSANHLSTT-VLS
LYS_BPPZA       ---------------------------SSKVTPKYKVKSGDNLTKIAKKHNTTVATLLKNPSIKDPNMIR
SLE1_STAHJ      ---------------------------------TYTVRYGDSLSSIASRYGTTYQHIMRLNGLNNF-FIY
TAGH_ENTFA      ---------------------------SEQAVSTYTVEVGDSVSLIAENHGLTIEQLQTLN---------
Y888_DEIRA      --------------------------------TVYTVKPGDSLSKIAEHYQMEYKKIAHYNNISNPDLIQ
SLE1_STAAB      ----------------------------------YTVQAGDSLSLIASKYGTTYQKIMSLNGLNNF-FIY
XLYB_BACSU      ----------------------------------YHVKKGDTLSGIAASHGASVKTLQSINHITDPNHIK
P60_LISSE       ---------------------------------SYTVKSGDTLGKIASTFGTTVSKIKALNGLTSDNL--
ALYS_ENTFA      ----------------------------------YTVKSGDTLNKIAAQYGVSVANLRSWNGISG-DLIF
LYTN_STAAW      ------------------------SFREAPKTQIYTVKKGDTLSAIALKYKTTVSXXXXXXXXXXXXXXF
LYTN_STAAS      ------------------------SFREAPKTQIYTVKKGDTLSAIALKYKTTVSXXXXXXXXXXXXXXF
LYTN_STAAR      ------------------------SFREAPKTQIYTVKKGDTLSAIALKYKTTVSXXXXXXXXXXXXXXF
LYTN_STAAN      ------------------------SFREAPKTQIYTVKKGDTLSAIALKYKTTVSXXXXXXXXXXXXXXF
LYTN_STAAM      ------------------------SFREAPKTQIYTVKKGDTLSAIALKYKTTVSXXXXXXXXXXXXXXF
LYTN_STAAC      ------------------------SFREAPKTQIYTVKKGDTLSAIALKYKTTVSXXXXXXXXXXXXXXF
LYTN_STAA8      ------------------------SFREAPKTQIYTVKKGDTLSAIALKYKTTVSXXXXXXXXXXXXXXF
SLE1_STAAW      ----------------------------------YTVQAGDSLSLIASKYGTTYQKIMSLNGLNNF-FIY
SLE1_STAAU      ----------------------------------YTVQAGDSLSLIASKYGTTYQKIMSLNGLNNF-FIY
SLE1_STAAS      ----------------------------------YTVQAGDSLSLIASKYGTTYQKIMSLNGLNNF-FIY
SLE1_STAAN      ----------------------------------YTVQAGDSLSLIASKYGTTYQKIMSLNGLNNF-FIY
SLE1_STAAC      ----------------------------------YTVQAGDSLSLIASKYGTTYQKIMSLNGLNNF-FIY
SLE1_STAA8      ----------------------------------YTVQAGDSLSLIASKYGTTYQKIMSLNGLNNF-FIY
SLE1_STAA3      ----------------------------------YTVQAGDSLSLIASKYGTTYQKIMSLNGLNNF-FIY
ISAA_STAHJ      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VDQELVIDGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIAQKESGGSY
XLYA_BACSU      VGQVLIV---------------------------------------------------------------
LYTE_BACSU      VGQTLSING-------------------------------------------------------------
SPA_STAAU       PGQELVVD--------------------------------------------------------------
SPA_STAAN       PGQELVVD--------------------------------------------------------------
SPA_STAAM       PGQELVVD--------------------------------------------------------------
SPA_STAA8       PGQELVVD--------------------------------------------------------------
YGER_ECOLI      VGQKLKLGG-------------------------------------------------------------
P60_LISIV       VGQVLKVKG-------------------------------------------------------------
YOCH_BACSU      AGSTLSVKG-------------------------------------------------------------
MUR2_ENTHR      PGQQLIV---------------------------------------------------------------
LYS_BPB03       VGQRINVGG-------------------------------------------------------------
SLE1_STAES      PGQKLKV---------------------------------------------------------------
SLE1_STAEQ      PGQKLKV---------------------------------------------------------------
P60_LISWE       ----------------------------------------------------------------------
LYS_BPPH2       VGQTINVTG-------------------------------------------------------------
SLE1_STAS1      PGQKLKV---------------------------------------------------------------
LYTF_BACSU      IGQTLTI---------------------------------------------------------------
LYS_BPPZA       VGQTINVTG-------------------------------------------------------------
SLE1_STAHJ      PGQKLRVSG-------------------------------------------------------------
TAGH_ENTFA      ----------------------------------------------------------------------
Y888_DEIRA      PGQKLRIPG-------------------------------------------------------------
SLE1_STAAB      PGQKLKVTG-------------------------------------------------------------
XLYB_BACSU      IGQ-------------------------------------------------------------------
P60_LISSE       ----------------------------------------------------------------------
ALYS_ENTFA      VGQKLIV---------------------------------------------------------------
LYTN_STAAW      IGQKLKV---------------------------------------------------------------
LYTN_STAAS      IGQKLKV---------------------------------------------------------------
LYTN_STAAR      IGQKLKV---------------------------------------------------------------
LYTN_STAAN      IGQKLKV---------------------------------------------------------------
LYTN_STAAM      IGQKLKV---------------------------------------------------------------
LYTN_STAAC      IGQKLKV---------------------------------------------------------------
LYTN_STAA8      IGQKLKV---------------------------------------------------------------
SLE1_STAAW      PGQKLKV---------------------------------------------------------------
SLE1_STAAU      PGQKLKV---------------------------------------------------------------
SLE1_STAAS      PGQKLKV---------------------------------------------------------------
SLE1_STAAN      PGQKLKV---------------------------------------------------------------
SLE1_STAAC      PGQKLKV---------------------------------------------------------------
SLE1_STAA8      PGQKLKV---------------------------------------------------------------
SLE1_STAA3      PGQKLKV---------------------------------------------------------------
ISAA_STAHJ      ------------------------------------------------------------IVMPESGGNP


                         +         .         .         .         .         *         .:210
query           TATNGRYIGRYQLTDSYLNGDYSAENQERVADAYVAGRYGSWTAAKNFWLNNGWY
XLYA_BACSU      -------------------------------------------------------
LYTE_BACSU      -------------------------------------------------------
SPA_STAAU       -------------------------------------------------------
SPA_STAAN       -------------------------------------------------------
SPA_STAAM       -------------------------------------------------------
SPA_STAA8       -------------------------------------------------------
YGER_ECOLI      -------------------------------------------------------
P60_LISIV       -------------------------------------------------------
YOCH_BACSU      -------------------------------------------------------
MUR2_ENTHR      -------------------------------------------------------
LYS_BPB03       -------------------------------------------------------
SLE1_STAES      -------------------------------------------------------
SLE1_STAEQ      -------------------------------------------------------
P60_LISWE       -------------------------------------------------------
LYS_BPPH2       -------------------------------------------------------
SLE1_STAS1      -------------------------------------------------------
LYTF_BACSU      -------------------------------------------------------
LYS_BPPZA       -------------------------------------------------------
SLE1_STAHJ      -------------------------------------------------------
TAGH_ENTFA      -------------------------------------------------------
Y888_DEIRA      -------------------------------------------------------
SLE1_STAAB      -------------------------------------------------------
XLYB_BACSU      -------------------------------------------------------
P60_LISSE       -------------------------------------------------------
ALYS_ENTFA      -------------------------------------------------------
LYTN_STAAW      -------------------------------------------------------
LYTN_STAAS      -------------------------------------------------------
LYTN_STAAR      -------------------------------------------------------
LYTN_STAAN      -------------------------------------------------------
LYTN_STAAM      -------------------------------------------------------
LYTN_STAAC      -------------------------------------------------------
LYTN_STAA8      -------------------------------------------------------
SLE1_STAAW      -------------------------------------------------------
SLE1_STAAU      -------------------------------------------------------
SLE1_STAAS      -------------------------------------------------------
SLE1_STAAN      -------------------------------------------------------
SLE1_STAAC      -------------------------------------------------------
SLE1_STAA8      -------------------------------------------------------
SLE1_STAA3      -------------------------------------------------------
ISAA_STAHJ      NAVNAGYRGLGQTKESWGTGSVASQTKGMIN--YANSRYGSLDAAIAFRDNHGWW