[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for spne4:ACF56657.1

[Show Plain Result]


## Summary of Sequence Search
    1::189
    1::189     e-102 100%  189 aa  SCPB_STRZT RecName: Full=Segregation and condensation protein B;
    1::189     e-102 100%  189 aa  SCPB_STRZP RecName: Full=Segregation and condensation protein B;
    1::189     e-102 100%  189 aa  SCPB_STRZJ RecName: Full=Segregation and condensation protein B;
    1::189     e-102 100%  189 aa  SCPB_STRR6 RecName: Full=Segregation and condensation protein B;
    1::189     e-102 100%  189 aa  SCPB_STRPS RecName: Full=Segregation and condensation protein B;
    1::189     e-102 100%  189 aa  SCPB_STRPN RecName: Full=Segregation and condensation protein B;
    1::189     e-102 100%  189 aa  SCPB_STRPJ RecName: Full=Segregation and condensation protein B;
    1::189     e-102 100%  189 aa  SCPB_STRPI RecName: Full=Segregation and condensation protein B;
    1::189     e-102 100%  189 aa  SCPB_STRP7 RecName: Full=Segregation and condensation protein B;
    1::189     e-102 100%  189 aa  SCPB_STRP4 RecName: Full=Segregation and condensation protein B;
    1::189     e-102 100%  189 aa  SCPB_STRP2 RecName: Full=Segregation and condensation protein B;
    1::189     3e-96  95%  189 aa  SCPB_STRMT RecName: Full=Segregation and condensation protein B;
    1::189     8e-83  78%  189 aa  SCPB_STRSV RecName: Full=Segregation and condensation protein B;
    1::186     5e-79  76%  188 aa  SCPB_STRGC RecName: Full=Segregation and condensation protein B;
    1::187     2e-68  66%  198 aa  SCPB_STRMU RecName: Full=Segregation and condensation protein B;
    3::187     7e-68  66%  193 aa  SCPB_STRT2 RecName: Full=Segregation and condensation protein B;
    3::187     2e-67  65%  193 aa  SCPB_STRT1 RecName: Full=Segregation and condensation protein B;
    1::179     5e-66  69%  183 aa  SCPB_STRPZ RecName: Full=Segregation and condensation protein B;
    1::179     5e-66  69%  183 aa  SCPB_STRPM RecName: Full=Segregation and condensation protein B;
    1::179     5e-66  69%  183 aa  SCPB_STRPG RecName: Full=Segregation and condensation protein B;
    1::179     5e-66  69%  183 aa  SCPB_STRPF RecName: Full=Segregation and condensation protein B;
    1::179     5e-66  69%  183 aa  SCPB_STRPD RecName: Full=Segregation and condensation protein B;
    1::179     5e-66  69%  183 aa  SCPB_STRP8 RecName: Full=Segregation and condensation protein B;
    1::179     5e-66  69%  183 aa  SCPB_STRP6 RecName: Full=Segregation and condensation protein B;
    1::179     5e-66  69%  183 aa  SCPB_STRP3 RecName: Full=Segregation and condensation protein B;
    1::179     5e-66  69%  183 aa  SCPB_STRP1 RecName: Full=Segregation and condensation protein B;
    1::179     3e-65  68%  183 aa  SCPB_STRPC RecName: Full=Segregation and condensation protein B;
    1::179     3e-65  68%  183 aa  SCPB_STRPB RecName: Full=Segregation and condensation protein B;
    1::179     5e-61  64%  179 aa  SCPB_STRS7 RecName: Full=Segregation and condensation protein B;
    1::179     5e-61  64%  179 aa  SCPB_STREM RecName: Full=Segregation and condensation protein B;
    1::179     5e-61  64%  179 aa  SCPB_STRE4 RecName: Full=Segregation and condensation protein B;
    1::188     8e-58  57%  188 aa  SCPB_LACLA RecName: Full=Segregation and condensation protein B;
    1::179     4e-57  62%  194 aa  SCPB_STRA5 RecName: Full=Segregation and condensation protein B;
    1::179     4e-57  62%  194 aa  SCPB_STRA3 RecName: Full=Segregation and condensation protein B;
    1::179     4e-57  62%  194 aa  SCPB_STRA1 RecName: Full=Segregation and condensation protein B;
    1::188     1e-53  55%  188 aa  SCPB_LACLS RecName: Full=Segregation and condensation protein B;
    1::188     1e-53  55%  188 aa  SCPB_LACLM RecName: Full=Segregation and condensation protein B;
    1::171     1e-45  50%  207 aa  SCPB_LACSS RecName: Full=Segregation and condensation protein B;
    1::181     1e-42  46%  199 aa  SCPB_LEUMM RecName: Full=Segregation and condensation protein B;
    9::185     4e-41  45%  199 aa  SCPB_LACGA RecName: Full=Segregation and condensation protein B;
    2::158     1e-40  51%  196 aa  SCPB_LACS1 RecName: Full=Segregation and condensation protein B;
    3::192     1e-39  45%  200 aa  SCPB_LACDA RecName: Full=Segregation and condensation protein B;
    1::157     3e-38  48%  199 aa  SCPB_LACPL RecName: Full=Segregation and condensation protein B;
    6::192     1e-37  46%  193 aa  SCPB_BACSK RecName: Full=Segregation and condensation protein B;
    1::169     1e-37  47%  196 aa  SCPB_PEDPA RecName: Full=Segregation and condensation protein B;
   25::182     2e-36  46%  196 aa  SCPB_LACJO RecName: Full=Segregation and condensation protein B;
    7::195     3e-35  40%  198 aa  SCPB_LISMO RecName: Full=Segregation and condensation protein B;
    7::195     3e-35  39%  198 aa  SCPB_LISIN RecName: Full=Segregation and condensation protein B;
   10::195     6e-35  40%  198 aa  SCPB_LISW6 RecName: Full=Segregation and condensation protein B;
    7::195     1e-34  40%  198 aa  SCPB_LISMF RecName: Full=Segregation and condensation protein B;
    7::195     1e-34  40%  198 aa  SCPB_LISMC RecName: Full=Segregation and condensation protein B;
    7::195     2e-34  39%  198 aa  SCPB_LISMH RecName: Full=Segregation and condensation protein B;
   10::191     4e-33  39%  192 aa  SCPB_OCEIH RecName: Full=Segregation and condensation protein B;
   20::203     6e-32  43%  209 aa  SCPB_GEOTN RecName: Full=Segregation and condensation protein B;
    1::170     1e-31  39%  187 aa  SCPB_EUBR3 RecName: Full=Segregation and condensation protein B;
    7::187     1e-31  41%  190 aa  SCPB_BACCN RecName: Full=Segregation and condensation protein B;
   10::187     2e-31  41%  190 aa  SCPB_BACC2 RecName: Full=Segregation and condensation protein B;
   24::190     2e-31  43%  202 aa  SCPB_CLOAB RecName: Full=Segregation and condensation protein B;
    8::190     5e-31  42%  197 aa  SCPB_BACHD RecName: Full=Segregation and condensation protein B;
   10::187     1e-30  41%  190 aa  SCPB_BACHK RecName: Full=Segregation and condensation protein B;
   10::187     1e-30  41%  190 aa  SCPB_BACC4 RecName: Full=Segregation and condensation protein B;
   10::187     1e-30  41%  190 aa  SCPB_BACC3 RecName: Full=Segregation and condensation protein B;
   10::187     1e-30  41%  190 aa  SCPB_BACC0 RecName: Full=Segregation and condensation protein B;
   10::187     1e-30  41%  190 aa  SCPB_BACAN RecName: Full=Segregation and condensation protein B;
   10::187     1e-30  41%  190 aa  SCPB_BACAH RecName: Full=Segregation and condensation protein B;
   10::187     1e-30  41%  190 aa  SCPB_BACAC RecName: Full=Segregation and condensation protein B;
   10::187     1e-30  41%  190 aa  SCPB_BACAA RecName: Full=Segregation and condensation protein B;
    8::187     1e-30  41%  190 aa  SCPB_BACWK RecName: Full=Segregation and condensation protein B;
   10::187     1e-30  41%  190 aa  SCPB_BACCQ RecName: Full=Segregation and condensation protein B;
   10::187     1e-30  41%  190 aa  SCPB_BACC7 RecName: Full=Segregation and condensation protein B;
   10::187     1e-30  41%  190 aa  SCPB_BACC1 RecName: Full=Segregation and condensation protein B;
   10::187     2e-30  41%  190 aa  SCPB_BACCZ RecName: Full=Segregation and condensation protein B;
   10::187     2e-30  41%  190 aa  SCPB_BACCR RecName: Full=Segregation and condensation protein B;
   16::202     3e-30  43%  217 aa  SCPB_GEOKA RecName: Full=Segregation and condensation protein B;
   24::184     1e-29  43%  193 aa  SCPB_CLOBJ RecName: Full=Segregation and condensation protein B;
   24::184     1e-29  42%  193 aa  SCPB_CLOB6 RecName: Full=Segregation and condensation protein B;
   11::185     2e-29  40%  195 aa  SCPB_MOOTA RecName: Full=Segregation and condensation protein B;
   24::184     2e-29  42%  193 aa  SCPB_CLOBM RecName: Full=Segregation and condensation protein B;
   24::184     2e-29  42%  193 aa  SCPB_CLOBL RecName: Full=Segregation and condensation protein B;
   24::184     2e-29  42%  193 aa  SCPB_CLOBK RecName: Full=Segregation and condensation protein B;
   24::184     2e-29  42%  193 aa  SCPB_CLOBH RecName: Full=Segregation and condensation protein B;
   24::184     2e-29  42%  193 aa  SCPB_CLOB1 RecName: Full=Segregation and condensation protein B;
    1::168     6e-29  40%  201 aa  SCPB_ENTFA RecName: Full=Segregation and condensation protein B;
   20::167     2e-28  45%  189 aa  SCPB_CLOTE RecName: Full=Segregation and condensation protein B;
   10::191     2e-28  39%  197 aa  SCPB_BACP2 RecName: Full=Segregation and condensation protein B;
   10::191     7e-28  40%  197 aa  SCPB_BACSU RecName: Full=Segregation and condensation protein B;
   11::169     6e-27  35%  198 aa  SCPB_CLOTH RecName: Full=Segregation and condensation protein B;
   10::190     1e-26  37%  194 aa  SCPB_BREBN RecName: Full=Segregation and condensation protein B;
    8::167     4e-26  39%  189 aa  SCPB_CLOPH RecName: Full=Segregation and condensation protein B;
   10::160     4e-26  42%  197 aa  SCPB_BACLD RecName: Full=Segregation and condensation protein B;
   23::167     6e-26  43%  219 aa  SCPB_SYMTH RecName: Full=Segregation and condensation protein B;
   22::195     1e-25  36%  195 aa  SCPB_CLOPS RecName: Full=Segregation and condensation protein B;
   22::195     1e-25  36%  195 aa  SCPB_CLOPE RecName: Full=Segregation and condensation protein B;
   22::195     1e-25  36%  195 aa  SCPB_CLOP1 RecName: Full=Segregation and condensation protein B;
    8::178     1e-25  37%  190 aa  SCPB_ALKMQ RecName: Full=Segregation and condensation protein B;
   10::179     4e-25  36%  185 aa  SCPB_ALKOO RecName: Full=Segregation and condensation protein B;
    9::177     2e-24  37%  181 aa  SCPB_DESRM RecName: Full=Segregation and condensation protein B;
   10::191     2e-24  36%  197 aa  SCPB_BACA2 RecName: Full=Segregation and condensation protein B;
    1::165     5e-24  38%  168 aa  SCPB_THETN RecName: Full=Segregation and condensation protein B;
   23::191     1e-23  35%  208 aa  SCPB_MYCPN RecName: Full=Segregation and condensation protein B;
    9::168     1e-23  36%  197 aa  SCPB_MYCPE RecName: Full=Segregation and condensation protein B;
   11::180     2e-23  39%  200 aa  SCPB_PELCD RecName: Full=Segregation and condensation protein B;
  102::291     2e-23  30%  291 aa  SCPB_MYCGA RecName: Full=Segregation and condensation protein B;
   10::161     2e-23  38%  190 aa  SCPB_CLOCE RecName: Full=Segregation and condensation protein B;
   13::164     4e-23  39%  185 aa  SCPB_CARHZ RecName: Full=Segregation and condensation protein B;
  190::351     4e-22  35%  364 aa  SCPB_UREPA RecName: Full=Segregation and condensation protein B;
   10::173     2e-21  36%  179 aa  SCPB_CLOD6 RecName: Full=Segregation and condensation protein B;
    1::180     1e-20  34%  180 aa  SCPB_STAES RecName: Full=Segregation and condensation protein B;
    1::180     1e-20  34%  180 aa  SCPB_STAEQ RecName: Full=Segregation and condensation protein B;
    7::151     2e-20  39%  179 aa  SCPB_STAHJ RecName: Full=Segregation and condensation protein B;
    6::169     2e-19  32%  192 aa  SCPB_MYCMO RecName: Full=Segregation and condensation protein B;
   10::186     3e-19  38%  209 aa  SCPBL_COXBU RecName: Full=Segregation and condensation protein B
    7::151     5e-19  37%  180 aa  SCPB_STAAW RecName: Full=Segregation and condensation protein B;
    7::151     5e-19  37%  180 aa  SCPB_STAAS RecName: Full=Segregation and condensation protein B;
    7::151     6e-19  37%  180 aa  SCPB_STAAN RecName: Full=Segregation and condensation protein B;
    7::151     6e-19  37%  180 aa  SCPB_STAAM RecName: Full=Segregation and condensation protein B;
    7::151     6e-19  37%  180 aa  SCPB_STAA9 RecName: Full=Segregation and condensation protein B;
    7::151     6e-19  37%  180 aa  SCPB_STAA2 RecName: Full=Segregation and condensation protein B;
    7::151     6e-19  37%  180 aa  SCPB_STAA1 RecName: Full=Segregation and condensation protein B;
    7::151     8e-19  37%  180 aa  SCPB_STAAE RecName: Full=Segregation and condensation protein B;
    7::151     8e-19  37%  180 aa  SCPB_STAAC RecName: Full=Segregation and condensation protein B;
    7::151     8e-19  37%  180 aa  SCPB_STAA8 RecName: Full=Segregation and condensation protein B;
    7::151     8e-19  37%  180 aa  SCPB_STAA3 RecName: Full=Segregation and condensation protein B;
    7::151     2e-18  36%  180 aa  SCPB_STAAR RecName: Full=Segregation and condensation protein B;
   17::180     5e-18  34%  207 aa  SCPB_MYCPU RecName: Full=Segregation and condensation protein B;
   22::190     5e-18  34%  207 aa  SCPB_MYCGE RecName: Full=Segregation and condensation protein B;
   49::150     2e-14  38%  182 aa  SCPB_STAS1 RecName: Full=Segregation and condensation protein B;
    1::189

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSTLAKIEALLFVAGEDGIRVRQLAELLSLPPTGIQQSLGKLAQKYEKDPDSSLALIETSGAYRLVTKPQ
SCPB_STRZT      MSTLAKIEALLFVAGEDGIRVRQLAELLSLPPTGIQQSLGKLAQKYEKDPDSSLALIETSGAYRLVTKPQ
SCPB_STRZP      MSTLAKIEALLFVAGEDGIRVRQLAELLSLPPTGIQQSLGKLAQKYEKDPDSSLALIETSGAYRLVTKPQ
SCPB_STRZJ      MSTLAKIEALLFVAGEDGIRVRQLAELLSLPPTGIQQSLGKLAQKYEKDPDSSLALIETSGAYRLVTKPQ
SCPB_STRR6      MSTLAKIEALLFVAGEDGIRVRQLAELLSLPPTGIQQSLGKLAQKYEKDPDSSLALIETSGAYRLVTKPQ
SCPB_STRPS      MSTLAKIEALLFVAGEDGIRVRQLAELLSLPPTGIQQSLGKLAQKYEKDPDSSLALIETSGAYRLVTKPQ
SCPB_STRPN      MSTLAKIEALLFVAGEDGIRVRQLAELLSLPPTGIQQSLGKLAQKYEKDPDSSLALIETSGAYRLVTKPQ
SCPB_STRPJ      MSTLAKIEALLFVAGEDGIRVRQLAELLSLPPTGIQQSLGKLAQKYEKDPDSSLALIETSGAYRLVTKPQ
SCPB_STRPI      MSTLAKIEALLFVAGEDGIRVRQLAELLSLPPTGIQQSLGKLAQKYEKDPDSSLALIETSGAYRLVTKPQ
SCPB_STRP7      MSTLAKIEALLFVAGEDGIRVRQLAELLSLPPTGIQQSLGKLAQKYEKDPDSSLALIETSGAYRLVTKPQ
SCPB_STRP4      MSTLAKIEALLFVAGEDGIRVRQLAELLSLPPTGIQQSLGKLAQKYEKDPDSSLALIETSGAYRLVTKPQ
SCPB_STRP2      MSTLAKIEALLFVAGEDGIRVRQLAELLSLPPTGIQQSLGKLAQKYEKDPDSSLALIETSGAYRLVTKPQ
SCPB_STRMT      MSTLAKIEALLFVRGEDWIRVRQLAELLSLPPTGIQQSLEKLSQKYEKDLDSSLDLIETGGAYRLVTKPQ
SCPB_STRSV      MSKLAEIEALLFVAGEDGLKVHQLAEILSLPPTGVIQSLEKLAEQYEVNPDSSLTLLETSKTYKLVTKPE
SCPB_STRGC      MSKLSEIEALLFVAGEDGLKVRQIAEILSIPPTGVSQSLEKLTAKYEADADCSLALLETSNTYKLVTKQA
SCPB_STRMU      MTPLSKIEALLFVAGEDGLSLRQLATLLDIPVTALLQQLEKMAQKYERDDNSALSLLESSKTYKLVTKKD
SCPB_STRT2      -SHLARLEALLFVAGEDGLSLRTMAQLLEIPVTGLTQSLEKLQAKYEADEDTALCLLESSNTYKIVTKPD
SCPB_STRT1      -SHLARLEALLFVAGEDGLSLRTMAQLLEIPVTGLTQSLEKLQAKYKADEDTALCLLESSNTYKIVTKPD
SCPB_STRPZ      MTYLSQIEALLFVAGEEGLSLRHLASMLSLTPTALQQQLEKLSQKYEKDQHSSLCLIETANTYRLVTKEG
SCPB_STRPM      MTYLSQIEALLFVAGEEGLSLRHLASMLSLTPTALQQQLEKLSQKYEKDQHSSLCLIETANTYRLVTKEG
SCPB_STRPG      MTYLSQIEALLFVAGEEGLSLRHLASMLSLTPTALQQQLEKLSQKYEKDQHSSLCLIETANTYRLVTKEG
SCPB_STRPF      MTYLSQIEALLFVAGEEGLSLRHLASMLSLTPTALQQQLEKLSQKYEKDQHSSLCLIETANTYRLVTKEG
SCPB_STRPD      MTYLSQIEALLFVAGEEGLSLRHLASMLSLTPTALQQQLEKLSQKYEKDQHSSLCLIETANTYRLVTKEG
SCPB_STRP8      MTYLSQIEALLFVAGEEGLSLRHLASMLSLTPTALQQQLEKLSQKYEKDQHSSLCLIETANTYRLVTKEG
SCPB_STRP6      MTYLSQIEALLFVAGEEGLSLRHLASMLSLTPTALQQQLEKLSQKYEKDQHSSLCLIETANTYRLVTKEG
SCPB_STRP3      MTYLSQIEALLFVAGEEGLSLRHLASMLSLTPTALQQQLEKLSQKYEKDQHSSLCLIETANTYRLVTKEG
SCPB_STRP1      MTYLSQIEALLFVAGEEGLSLRHLASMLSLTPTALQQQLEKLSQKYEKDQHSSLCLIETANTYRLVTKEG
SCPB_STRPC      MTYLSQIEALLFVAGEEGLSLRHLASMLSLTPTALQQQLEKLSQKYEKDQHSSLCLIETANTYRLVTKEG
SCPB_STRPB      MTYLSQIEALLFVAGEEGLSLRHLASMLSLTPTALQQQLEKLSQKYEKDQHSSLCLIETANTYRLVTKEG
SCPB_STRS7      MTYLSQLEALLFVAGEEGXXXXXXXXXXXXTPTALQQQLDKLSQKYKEDKESGLCLIESSRTYKLVTKEC
SCPB_STREM      MTYLSQLEALLFVAGEEGXXXXXXXXXXXXTPTALQQQLDKLSQKYKEDKESGLCLIESSRTYKLVTKEC
SCPB_STRE4      MTYLSQLEALLFVAGEEGXXXXXXXXXXXXTPTALQQQLDKLSQKYKEDKESGLCLIESSRTYKLVTKEC
SCPB_LACLA      MNKTASCELLLFVSGEAGLTLAELSALTEMSKQACQQQIDYLKEKYHSDEESALTIIETAGKYRMATKEE
SCPB_STRA5      MTYLGSIEALLFVAGEDGLSLRQMAELLSLTPSALIQQLEKLAKRYXXXXXXXXXXXXTAQTYKLVTKDS
SCPB_STRA3      MTYLGSIEALLFVAGEDGLSLRQMAELLSLTPSALIQQLEKLAKRYXXXXXXXXXXXXTAQTYKLVTKDS
SCPB_STRA1      MTYLGSIEALLFVAGEDGLSLRQMAELLSLTPSALIQQLEKLAKRYXXXXXXXXXXXXTAQTYKLVTKDS
SCPB_LACLS      MNKTATCELLLFVSGEAGXXXXXXXXXXXMSKQACQQQIDYLKEKYHSDRESALTIIETAGKYRMATKED
SCPB_LACLM      MNKTATCELLLFVSGEAGXXXXXXXXXXXMSKQACQQQIDYLKEKYHSDRESALTIIETAGKYRMATKED
SCPB_LACSS      MNHLAEIESLLYVAGDEGITLQHIARLIMLDEAAVRQLLTKLAKRYQEDEQSGLNLIQAADCYKLVTKKA
SCPB_LEUMM      MNNLSQIEALLFVSGDEGISVKNMSIITGFDRSAIQGLLEELVLKYDTDLSSALQIRESDDVYRLVTKPE
SCPB_LACGA      ----AQLEALLYAAGDDGLETDNLLQLLEISPSALRELANHLKDRLKNDENSGLQLICINHTYKLTTSAE
SCPB_LACS1      LSNQAKIESLLFISGNEGITLTELSQITGILKPALHEQLDKLADKYKQDRSSSLQLIHAEERYKLVTKPA
SCPB_LACDA      -SKIAQLQALLYVAGDGGIKKEQLRDLLQLADPEIESLAKRLQEKLASDLDCGLQLLEINDEYKLTTSGE
SCPB_LACPL      MTNIEQIEGLLFVAGDEGITVAEIEHATGFAKPAITTMLTQLATKYQADPDSALMILSTANTYRLATKAA
SCPB_BACSK      -SKLAKIEGLLFVTGDDGISPTEMAELVEISEDEVIQLLEVLSEQMAKE-ERGIRLARLANRYRLTTKVE
SCPB_PEDPA      MNNEQKVEALLFVAGAEGISVEELSNFTGYAKPAILTMLDNLEKNYEVNSKTALKLIQTGGTYKLVTKPE
SCPB_LACJO      -----------------------LLQLLEISPAALRELANHLKDRLKNDENSGLQLICINQTYKLTTSPK
SCPB_LISMO      ---LGVLESLLFAAGDAGLSTEQLTEVMEITHIEALNLLELLSERYNESADRGLILLELAGTFQLATKKA
SCPB_LISIN      ---LGVLESLLFAAGDAGLSTEQLTEVMEITHIEALNLLELLSERYNGNEDRGLILLELAGTFQLATKKA
SCPB_LISW6      ------LESLLFAAGDAGLSTEQLTEVMEITHIEALNLLELLSERYNGNADRGLILLELAGTFQLATKKA
SCPB_LISMF      ---LGVLESLLFAAGDAGLSTEQLTEVMEITHIEALNLLELLSDRYNGSADRGLILLELAGTFQLATKKA
SCPB_LISMC      ---LGVLESLLFAAGDAGLSTEQLTEVMEITHIEALNLLELLSDRYNGSADRGLILLELAGTFQLATKKA
SCPB_LISMH      ---LGILESLLFAAGDAGLSTEQLTEVMEITHIEALNLLELLSERYNGSADRGLILLELAGTFQLATKKA
SCPB_OCEIH      ------IEGLLFASGDEGVTAKQLSKILDIGLDTVEHILEELRFEYERE-DRGLMIIQSNNIFHLATKPE
SCPB_GEOTN      ----AIVEALLFAAGDEGLSLAQIAAVLDVDESEAKAVIAALQEDYSRE-ERGIQLMELAGVFLLATKKE
SCPB_EUBR3      MNYKAAIEAILFTMGES-VELGRIADAIQLNEKETKKLLDELIKEYRSSSNIGMNIIELDGAYQMCTKPQ
SCPB_BACCN      ---MAITEGLLFVAGDEGIYPEQIAKXXXXXXXXXXXXXXXMQEKWEGE-GRGLQIVQFAKAYRLATKKE
SCPB_BACC2      ------IEGLLFVSGDEGIYPEQIAKVLEIEMNEVMNILEEMQQECE-GANRGLQIVQYAKVYRFATKKE
SCPB_CLOAB      ------IESLLFVSGEP-LKLKQISAILECTTKRAQEVLNNMMLKYN-DNCRGVKLININDSYQLVTKNE
SCPB_BACHD      ----AAIEGILFVRGDEGVTLEELCDLLELSTDVVYAALEELRLSYT-DEARGLRIEEVAHAFRLSTKPE
SCPB_BACHK      ------IEGLLFVSGDEGIYPEQIAKVLEIEGNEVIDILEEM-QKECEGAHRGLQIVQYAKVYRFATKKE
SCPB_BACC4      ------IEGLLFVSGDEGIYPEQIAKVLEIEMNEAINILEEMQQECE-GANRGLQIVQYAKVYRFATKKE
SCPB_BACC3      ------IEGLLFVSGDEGIYPEQIAKVLEIEGNEVIDILEEM-QKECEGAHRGLQIVQYAKVYRFATKKE
SCPB_BACC0      ------IEGLLFVSGDEGIYPEQIAKVLEIEGNEVIDILEEM-QKECEGAHRGLQIVQYAKVYRFATKKE
SCPB_BACAN      ------IEGLLFVSGDEGIYPEQIAKVLEIEGNEVIDILEEM-QKECEGAHRGLQIVQYAKVYRFATKKE
SCPB_BACAH      ------IEGLLFVSGDEGIYPEQIAKVLEIEGNEVIDILEEM-QKECEGAHRGLQIVQYAKVYRFATKKE
SCPB_BACAC      ------IEGLLFVSGDEGIYPEQIAKVLEIEGNEVIDILEEM-QKECEGAHRGLQIVQYAKVYRFATKKE
SCPB_BACAA      ------IEGLLFVSGDEGIYPEQIAKVLEIEGNEVIDILEEM-QKECEGAHRGLQIVQYAKVYRFATKKE
SCPB_BACWK      ----AIIEGLLFVAGDEGIYPEQIAKXXXXXXXXXXNSIEEM-QKECEGSNRGLQIVQYAKVYRFATKKE
SCPB_BACCQ      ------IEGLLFVSGDEGISPEQIAKVLEIEGNEVINILEEM-QKECEGAHRGLQIVQYAKVYRFATKKE
SCPB_BACC7      ------IEGLLFVSGDEGISPEQIAKVLEIEGNEVINILEEM-QKECEGAHRGLQIVQYAKVYRFATKKE
SCPB_BACC1      ------IEGLLFVSGDEGISPEQIAKVLEIEGNEVIDILEEM-QKECEGAHRGLQIVQYAKVYRFATKKE
SCPB_BACCZ      ------IEGLLFVSGDEGIYPEQIAKVLEIEGNEVIDILEEM-QKECEGAHRGLQIVQYAKVYRFATKKE
SCPB_BACCR      ------IEGLLFVSGDEGIYPEQIAKVLEIEMNEAINILEEMQQECE-GANRGLQIVQYAKVYRFATKKE
SCPB_GEOKA      -SAKAIVEALLFAAGDEGLSLSQIAAVLEVSELEAKAVIEELQQDCRRE-ERGIQLVELGGVFLLATKKE
SCPB_CLOBJ      ------IESLLFMSGEP-INIKDLATILNCKQDKVSSLLNEMKNSYV-GKDRGIKILIHNRAVQLVTKPE
SCPB_CLOB6      ------IESLLFMSGEP-INIKDLATILNCKQDKVSSLLNEMKNSYV-GKDRGIKILIHNRAVQLVTKPE
SCPB_MOOTA      ----AALECLLFVAGGP-VSVDSLAACLGVKPGDVDELAAELQELYARE-ERGLQIRAVAGGYQMCTRPE
SCPB_CLOBM      ------IESLLFMSGEP-INIKDLATILNCKQDKVSSLLNEMNNSYV-GKDRGIKILIHNRAVQLVTKPE
SCPB_CLOBL      ------IESLLFMSGEP-INIKDLATILNCKQDKVSSLLNEMNNSYV-GKDRGIKILIHNRAVQLVTKPE
SCPB_CLOBK      ------IESLLFMSGEP-INIKDLATILNCKQDKVSSLLNEMNNSYV-GKDRGIKILIHNRAVQLVTKPE
SCPB_CLOBH      ------IESLLFMSGEP-INIKDLATILNCKQDKVSSLLNEMNNSYV-GKDRGIKILIHNRAVQLVTKPE
SCPB_CLOB1      ------IESLLFMSGEP-INIKDLATILNCKQDKVSSLLNEMNNSYV-GKDRGIKILIHNRAVQLVTKPE
SCPB_ENTFA      MTLVSQIEAILFVVXXXXXXXXXXXXXXXKSTAKTYEELTKLKEHYASDNKSALNILEVGNHFVLXXXXX
SCPB_CLOTE      ------IESLLFASGEP-LGLKDISEIIELNTLDTKEILQKMIREYEIEK-RGIKLIEIEKKYQLVTKEE
SCPB_BACP2      ----AIIEALLYAAGDEGLTKKQLMSVLEVEEVALLDMMSAVKEEYQKQ-ERGIELIEYADSYMLLTKKE
SCPB_BACSU      ----AIVEALLYAAGDEGLTKKQLLTVLEIEEPELNTIMADVADEYRGDT-RGIELIEYADTYMLSTKKD
SCPB_CLOTH      -------EGMLFASG-DKVSIEKLSSITGIDKKTVKLVINNMIVKYNNDPSRGITIREINNGYQLCSKPE
SCPB_BREBN      ------IEGLLFISGDEGIDAKXXXXXXXXXXXXXXXXXXXMKADFRR-AGRGIQIVEVAKAYQLTTLPE
SCPB_CLOPH      ----AMIEAILFTMGE-AVEVERIASALDHDVDTIRKIIHNMMDRYEGD-ERGIKIIELDNSFQMCTKAQ
SCPB_BACLD      ----AIVEALLYAAGDEGLTKKQLLSVLEVDEAELLDIMLDVKETYEKE-DRGIELVEYADTYMLSTKKE
SCPB_SYMTH      --------------------IKRIAEVIGLDERDAALLMADLQKDYEA-PHRGLAIREMAGGYVLTTRPE
SCPB_CLOPS      ------IESLLFVSGEP-LALKDICRIVEEDFKYVEDLMRELMNIYNGDSSRGIKIISLNGTYQLVTKTK
SCPB_CLOPE      ------IESLLFVSGEP-LALKDICRIVEEDFKYVEDLMRELMNIYNGDSSRGIKIISLNGTYQLVTKTK
SCPB_CLOP1      ------IESLLFVSGEP-LALKDICRIVEEDFKYVEDLMRELMNIYNGDSSRGIKIISLNGTYQLVTKTK
SCPB_ALKMQ      ----AAIEAILF-AWSDPISSSELSNILDIKVTETKEIMKEMIDEFNFHK-RGIQIIQMNDHYQMSTRAE
SCPB_ALKOO      ------IEAILF-AWSDPLSIKDLSEVLDIGTKEIEGVLAEMINEFNYSK-RGIQIIKMNDYYQLSTRPE
SCPB_DESRM      --TKSALEALLFVASEP-LTVQALARIVEIDVADXXXXXXXXXKEYQDRP-GGLKIVQVSDTWQICTRPE
SCPB_BACA2      ----AIVEALLYAAGDEGLTKKQLVTVLEIEEAELAGIMEEVAAQYKED-DRGIELTEYADTYMLGTKKE
SCPB_THETN      MTQEGKIEAILFAAGQ-AVKIRXXXXXXXXXXXXXXXXXXXXXXXYVKN-HRGIDIVIFEDKVEMCTNDS
SCPB_MYCPN      ---VAAIYGLLFVSGEKGLTLAELNRVLKVGLEKIKAALVQLERKLSLDDESGIEIKKFGHSFRLVTKME
SCPB_MYCPE      ------IEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPD
SCPB_PELCD      ----AIIEALLFAA-PGPVRLEQXXXXXXXXXXXXXXXXXELETEYLR-AGRGFVLVELAEGYQLRTRPE
SCPB_MYCGA      LSAKAIIQAALYVAGRNGMTLQELNKILKIHQDQLFKELEEMIYSYDQNLNFGLTIKNYGGRYKILTKAA
SCPB_CLOCE      ------IESLIFSYG-DPLPLDKICEILELDKKTARSILKNMMDSYNNS-NRGIIIREINEKYQMCSKPE
SCPB_CARHZ      ------LEALLFVSPEP-LSLKKIAQTLELSVEEAKEIVLRLQEKLEQD-QRGIMLHFSGEEVWLTTRPD
SCPB_UREPA      ------IDSTLFLAGEEGVSLQDLKRTTGLNESSLKTILNQLQKDYDVD-DSGLVLVQFGEKFKLLTQSK
SCPB_CLOD6      ------IESVMFAYGEP-ISIKELNYIINLSSKXXXXXXXXXXXXY-REQNRGIQIIKLENKYQMCTNKD
SCPB_STAES      MDNIAILEALLYTSGDEGLEQKXXXXXXXXXXXXXXXXVSKYHSH-------GLTIQRYGSTYVLTTKKE
SCPB_STAEQ      MDNIAILEALLYTSGDEGLEQKXXXXXXXXXXXXXXXXVSKYHSH-------GLTIQRYGSTYVLTTKKE
SCPB_STAHJ      ------IESLLYTAGDEGLDEKQLLEILEIN----QAKLSELISSYTS---SGLIIQKFGSTYILTSKKE
SCPB_MYCMO      ------IEALIYIQGEEGLSSEQLQKVLKSESISSARALLKVFKEKWNNEQHGIKVEEFNDVYKFATIKD
SCPBL_COXBU     ------IEAALFASAEPLTRLQQLFDEQN--PISLSEIKNLLSELKEDYRERGVDLQEVASGYRFQARPD
SCPB_STAAW      ------LESLLFTAGDEGLDEKQLLEILDM-------SKNQLVELIENYSSHGLMIQRFGTTYVLTTKKE
SCPB_STAAS      ------LESLLFTAGDEGLDEKQLLEILDM-------SKNQLVELIENYSSHGLMIQRFGTTYVLTTKKE
SCPB_STAAN      ------LESLLFTAGDEGLDEKQLLEILDM-------SKDQLVELIENYSSHGLMIQRFGTTYVLTTKKE
SCPB_STAAM      ------LESLLFTAGDEGLDEKQLLEILDM-------SKDQLVELIENYSSHGLMIQRFGTTYVLTTKKE
SCPB_STAA9      ------LESLLFTAGDEGLDEKQLLEILDM-------SKDQLVELIENYSSHGLMIQRFGTTYVLTTKKE
SCPB_STAA2      ------LESLLFTAGDEGLDEKQLLEILDM-------SKDQLVELIENYSSHGLMIQRFGTTYVLTTKKE
SCPB_STAA1      ------LESLLFTAGDEGLDEKQLLEILDM-------SKDQLVELIENYSSHGLMIQRFGTTYVLTTKKE
SCPB_STAAE      ------LESLLFTAGDEGLDEKQLLEILDM-------SKDQLVELIENYSSHGLMIQRFGMTYVLTTKKE
SCPB_STAAC      ------LESLLFTAGDEGLDEKQLLEILDM-------SKDQLVELIENYSSHGLMIQRFGMTYVLTTKKE
SCPB_STAA8      ------LESLLFTAGDEGLDEKQLLEILDM-------SKDQLVELIENYSSHGLMIQRFGMTYVLTTKKE
SCPB_STAA3      ------LESLLFTAGDEGLDEKQLLEILDM-------SKDQLVELIENYSSHGLMIQRFGMTYVLTTKKE
SCPB_STAAR      ------LESLLFTAGDEGLDEKQLLEILDI-------SKDQLVELIENYSSHGLIIQRFGTTYVLTTKKE
SCPB_MYCPU      ------IEALMYFQGDQGLSPEQVKEVFDLEKDQEGKKLLNDFMEFYNAREGGTKVFVFGEIYKIAT---
SCPB_MYCGE      ---VASIYGLLFVCGAKGITLRELIRIFK--KAGIXXXXXXXXXXXXXXXQSGVELKKFGNSFSLVTKPI
SCPB_STAS1      -----------------------------------------------------LTIQHYGNTYVLTTKKE


                         .         .         *         .         .         .         .:140
query           FAEILKEYSKAPINQSLSRAALETLSIIAYKQPITRIEIDAIRGVNSSGALAKLQAFDLIKEDGKKEVLG
SCPB_STRZT      FAEILKEYSKAPINQSLSRAALETLSIIAYKQPITRIEIDAIRGVNSSGALAKLQAFDLIKEDGKKEVLG
SCPB_STRZP      FAEILKEYSKAPINQSLSRAALETLSIIAYKQPITRIEIDAIRGVNSSGALAKLQAFDLIKEDGKKEVLG
SCPB_STRZJ      FAEILKEYSKAPINQSLSRAALETLSIIAYKQPITRIEIDAIRGVNSSGALAKLQAFDLIKEDGKKEVLG
SCPB_STRR6      FAEILKEYSKAPINQSLSRAALETLSIIAYKQPITRIEIDAIRGVNSSGALAKLQAFDLIKEDGKKEVLG
SCPB_STRPS      FAEILKEYSKAPINQSLSRAALETLSIIAYKQPITRIEIDAIRGVNSSGALAKLQAFDLIKEDGKKEVLG
SCPB_STRPN      FAEILKEYSKAPINQSLSRAALETLSIIAYKQPITRIEIDAIRGVNSSGALAKLQAFDLIKEDGKKEVLG
SCPB_STRPJ      FAEILKEYSKAPINQSLSRAALETLSIIAYKQPITRIEIDAIRGVNSSGALAKLQAFDLIKEDGKKEVLG
SCPB_STRPI      FAEILKEYSKAPINQSLSRAALETLSIIAYKQPITRIEIDAIRGVNSSGALAKLQAFDLIKEDGKKEVLG
SCPB_STRP7      FAEILKEYSKAPINQSLSRAALETLSIIAYKQPITRIEIDAIRGVNSSGALAKLQAFDLIKEDGKKEVLG
SCPB_STRP4      FAEILKEYSKAPINQSLSRAALETLSIIAYKQPITRIEIDAIRGVNSSGALAKLQAFDLIKEDGKKEVLG
SCPB_STRP2      FAEILKEYSKAPINQSLSRAALETLSIIAYKQPITRIEIDAIRGVNSSGALAKLQAFDLIKEDGKKEVLG
SCPB_STRMT      FSEILKEYSKAPINQSLSRPALETLSIIAYKQPITRIEIDAIRGVNSSGALAKLQAFDLIREDGKKEVLG
SCPB_STRSV      FAEILRAYSRAPINQSLSRAALETLSIIAYKQPITRVEIDDIRGVNSSGALAKLLAFELVREDGKKEVIG
SCPB_STRGC      FAELLRAYSKSPINQSLSRAALETLSIIAYKQPITRVEIDDIRGVNSSGALAKLLAFELVREDGKKEVLG
SCPB_STRMU      YADLLRQYSKTPINQSLSRASLEVLSIIAYKQPITRIEVDNIRGVNSSSAISKLQAFDLIQEAGKKEVLG
SCPB_STRT2      FACLLRDYSKTPINQSLSRASLEVLSIVAYKQPITRAEVDDIRGVNSSGAIAKLQAFGLIREAGKKDAVG
SCPB_STRT1      FACLLRDYSKTPINQSLSRASLEVLSIVAYKQPITRAEVDDIRGVNSSGAIAKLQAFGLIREAGKKDAVG
SCPB_STRPZ      FAELLRAYAKTPMNQSLSRASLEVLSIVAYKQPITRIEIDDIRGVNSSGALSKLLAFDLIREAGKKDVVG
SCPB_STRPM      FAELLRAYAKTPMNQSLSRASLEVLSIVAYKQPITRIEIDDIRGVNSSGALSKLLAFDLIREAGKKDVVG
SCPB_STRPG      FAELLRAYAKTPMNQSLSRASLEVLSIVAYKQPITRIEIDDIRGVNSSGALSKLLAFDLIREAGKKDVVG
SCPB_STRPF      FAELLRAYAKTPMNQSLSRASLEVLSIVAYKQPITRIEIDDIRGVNSSGALSKLLAFDLIREAGKKDVVG
SCPB_STRPD      FAELLRAYAKTPMNQSLSRASLEVLSIVAYKQPITRIEIDDIRGVNSSGALSKLLAFDLIREAGKKDVVG
SCPB_STRP8      FAELLRAYAKTPMNQSLSRASLEVLSIVAYKQPITRIEIDDIRGVNSSGALSKLLAFDLIREAGKKDVVG
SCPB_STRP6      FAELLRAYAKTPMNQSLSRASLEVLSIVAYKQPITRIEIDDIRGVNSSGALSKLLAFDLIREAGKKDVVG
SCPB_STRP3      FAELLRAYAKTPMNQSLSRASLEVLSIVAYKQPITRIEIDDIRGVNSSGALSKLLAFDLIREAGKKDVVG
SCPB_STRP1      FAELLRAYAKTPMNQSLSRASLEVLSIVAYKQPITRIEIDDIRGVNSSGALSKLLAFDLIREAGKKDVVG
SCPB_STRPC      FAGLLRAYAKTPMNQSLSRASLEVLSIVAYKQPITRIEIDDIRGVNSSGALSKLLAFDLIREAGKKDVVG
SCPB_STRPB      FAGLLRAYAKTPMNQSLSRASLEVLSIVAYKQPITRIEIDDIRGVNSSGALSKLLAFDLIREAGKKDVVG
SCPB_STRS7      LAPLLKDYAKAPINQTLSRASLEVLSIVAYKQPITRIEIDEIRGVNSSGALSKLVAFGLVQEAGKKEVIG
SCPB_STREM      LAPLLKDYAKAPINQTLSRASLEVLSIVAYKQPITRIEIDEIRGVNSSGALSKLVAFGLVQEAGKKEVIG
SCPB_STRE4      LAPLLKDYAKAPINQTLSRASLEVLSIVAYKQPITRIEIDEIRGVNSSGALSKLVAFGLVQEAGKKEVIG
SCPB_LACLA      FAEILKNYAKTPLNQSLSKSALEVLSIIAYKQPLTRLEIDHLRGVNSSGVLSTLRAFDLVEKVGQVEAPG
SCPB_STRA5      YMTLLRDYAKAPINQSLSRASLEVLSIIAYKQPITRIEIDDIRGVNSSGAITRLIAFGLIKEAGKKEVLG
SCPB_STRA3      YMTLLRDYAKAPINQSLSRASLEVLSIIAYKQPITRIEIDDIRGVNSSGAITRLIAFGLIKEAGKKEVLG
SCPB_STRA1      YMTLLRDYAKAPINQSLSRASLEVLSIIAYKQPITRIEIDDIRGVNSSGAITRLIAFGLIKEAGKKEVLG
SCPB_LACLS      FSEILKNYAKTPLNQSLSKSALEVLSIIAYKQPLTRIEIDQLRGVNSSGVLSTLRAFDLVEKVGQVEAPG
SCPB_LACLM      FSEILKNYAKTPLNQSLSKSALEVLSIIAYKQPLTRIEIDQLRGVNSSGVLSTLRAFDLVEKVGQVEAPG
SCPB_LACSS      YAGLLKAYFDGPVSTSISQAALEVLAIIVYRQPLTRIEIDEVRGVQSSGAIQTLLARQLIVEKGRKDAPG
SCPB_LEUMM      LGGTVKQYFDSPVNATLSQAQLETLVIVAYKQPITRVEIDTIRGVQSSGTLQKLALRQLVHEVGRKDEPG
SCPB_LACGA      CGDVISKFFQKDLSKNLSQSALEILSIIAYRQPITRVEIDDLRGVNSSGALQTLVWRGLIKVNGKKDVPG
SCPB_LACS1      LAELVKKYLNSNNITELTGAALETLAIIAYKQPITRIGVDEIRGVQSSSMIQRLQLLELIKENGRLDAPG
SCPB_LACDA      VSDLVEAYFNKDLTKNISQSALEILAIVAYRQPITRIEIDEIRGVNSSGALQTLVWRGLVKAQGVKDAPG
SCPB_LACPL      VAPVLKRYFEAPLTTSLSQASLEVLAIIAYRQPLTRIEIDEIRGVHSGSTIQKLVLRQLVTETGRLSEPG
SCPB_BACSK      HADMYKKLASSPIHGGLSRAALETLAIVAYKQPITRAEIDEVRGVKSEKALQSLVSKLLIEECGRASGTG
SCPB_PEDPA      LASILEKYFDRNSRSGLSPAALEILSIVAYRQPITRIEIDQIRGVQSGTTLQNLVLRNLVKVVGRLEEPG
SCPB_LACJO      CGDIISKFFQKDLSKNLSQSALEILSIIAYRQPITRVEIDDLRGVNSAGALQTLVWRGLIKVDGKKDVPG
SCPB_LISMO      HAEFLRKLVEVPSNTVLSQASLETLAIIAYRQPVTRMEVDEVRGVQTDGPIRTLVAKGLVTDKGRVDGAG
SCPB_LISIN      HAEFLRKLVEVPSNTVLSQASLETLAIIAYRQPVTRMEVDEVRGVQTDGPIRTLVAKGLVTDKGRVDGAG
SCPB_LISW6      HAEYLRKLVEVPSNTVLSQASLETLAIIAYRQPVTRMEVDEVRGVQTDGPIRTLVAKGLVTDKGRVDGAG
SCPB_LISMF      HAEFLRKLVEVPSNTVLSQASLETLAIIAYRQPVTRMEVDEVRGVQTDGPIRTLVAKGLVTDKGRVDGAG
SCPB_LISMC      HAEFLRKLVEVPSNTVLSQASLETLAIIAYRQPVTRMEVDEVRGVQTDGPIRTLVAKGLVTDKGRVDGAG
SCPB_LISMH      HADYLRKLVEVPSNTVLSQASLETLAIIAYRQPVTRMEVDEVRGVQTDGPIRTLVAKGLVTDKGRVDGAG
SCPB_OCEIH      HSSYFKRLIDSPRTSKMSQAALETLAIIAYRQPITRAEIDEIRGVRSERPVQTLITRNLIEETGRKDTVG
SCPB_GEOTN      HASYLKKLVEAPGASSLSQAALETLAIIAYRQPITRAEIEEIRGVKSDKPLQTLMARALIKEVGRAEGTG
SCPB_EUBR3      MYEYLIRIAKQPKKRVLTDVLLETLSIIAYKQPVTKAEIEKIRGVSSEHAVSKLVEYNLVQELGRLDAPG
SCPB_BACCN      HAPYYQKLMDTPTAASLSQAALETLAIVAYRQPITRMEMEEIRGVKTERALQTLVSHLLIKEVGRAEGPG
SCPB_BACC2      HASYYQKLIDTPTAASLSQAALETLAIVAYRQPITRTEMEEIRGVKTDKALQTLVSHLLIKEMGRAEGPG
SCPB_CLOAB      NSDYVRKLLKTNTRQALSQAALETLAIIAYKQPITRIDVDEIRGVKSDRAILTLQEKKLIQECGRLDVPG
SCPB_BACHD      LAPYFKKLALSTLQSGLSQAALETLAIIAYRQPITRIEVDEVRGVKSEKAIQTLTSRLLIKEVGRAQGTG
SCPB_BACHK      HASYYQKLIEIPTAASLSQAALETLAIVAYRQPITRTEMEEIRGVKTDKALQTLVSHLLIKEMGRAEGPG
SCPB_BACC4      HASYYQKLIDTPTAASLSQAALETLAIVAYRQPITRTEMEEIRGVKTDKALQTLVSHLLIKEMGRAEGPG
SCPB_BACC3      HASYYQKLIEIPTAASLSQAALETLAIVAYRQPITRTEMEEIRGVKTDKALQTLVSHLLIKEMGRAEGPG
SCPB_BACC0      HASYYQKLIEIPTAASLSQAALETLAIVAYRQPITRTEMEEIRGVKTDKALQTLVSHLLIKEMGRAEGPG
SCPB_BACAN      HASYYQKLIEIPTAASLSQAALETLAIVAYRQPITRTEMEEIRGVKTDKALQTLVSHLLIKEMGRAEGPG
SCPB_BACAH      HASYYQKLIEIPTAASLSQAALETLAIVAYRQPITRTEMEEIRGVKTDKALQTLVSHLLIKEMGRAEGPG
SCPB_BACAC      HASYYQKLIEIPTAASLSQAALETLAIVAYRQPITRTEMEEIRGVKTDKALQTLVSHLLIKEMGRAEGPG
SCPB_BACAA      HASYYQKLIEIPTAASLSQAALETLAIVAYRQPITRTEMEEIRGVKTDKALQTLVSHLLIKEMGRAEGPG
SCPB_BACWK      HASYYQKLIDTPTAASLSQAALETLAIVAYRQPITRTEMEEIRGVKTDKALQTLVSHLLIKETGRAEGPG
SCPB_BACCQ      HASYYQKLIDIPTAASLSQAALETLAIVAYRQPITRTEMEEIRGVKTDKALQTLVSHLLIKEMGRAEGPG
SCPB_BACC7      HASYYQKLIDIPTAASLSQAALETLAIVAYRQPITRTEMEEIRGVKTDKALQTLVSHLLIKEMGRAEGPG
SCPB_BACC1      HASYYQKLIDIPTAASLSQAALETLAIVAYRQPITRTEMEEIRGVKTDKALQTLVSHLLIKEMGRAEGPG
SCPB_BACCZ      HASYYQKLIDIPTAASLSQAALETLAIVAYRQPITRTEMEEIRGVKTDKALQTLVSHLLIKEMGRAEGPG
SCPB_BACCR      HASYYQKLIDTPTAASLSQAALETLAIVAYRQPITRTEMEEIRGVKTDKALQTLVSHLLIKEMGRAEGPG
SCPB_GEOKA      HAPYLKKLVEAPGASPLSQAALETLAIIAYRQPITRAEIEEIRGVKSDKPLQTLMARALIKEVGRAEGTG
SCPB_CLOBJ      NSIYVEKLLKTNIRQSLSQAALETLSIIAYKQPITRVAIDEIRGVKSDRAIYTLLEKNIIKECGRLDVPG
SCPB_CLOB6      NSIYVEKLLKTNVRQSLSQAALETLSIIAYKQPITRVAIDEIRGVKSDRAIYTLLEKNIIKECGRLDVPG
SCPB_MOOTA      FASYCEALLR-PELPALSRAALETLAIIAYRQPVTRTEMEYIRGVKVDGVLNTLISRGLVQEVGRKEAPG
SCPB_CLOBM      NSIYVEKLLKTNVRQSLSQAALETLSIIAYKQPITRVAIDEIRGVKSDRAIYTLLEKNIIKECGRLDVPG
SCPB_CLOBL      NSIYVEKLLKTNVRQSLSQAALETLSIIAYKQPITRVAIDEIRGVKSDRAIYTLLEKNIIKECGRLDVPG
SCPB_CLOBK      NSIYVEKLLKTNVRQSLSQAALETLSIIAYKQPITRVAIDEIRGVKSDRAIYTLLEKNIIKECGRLDVPG
SCPB_CLOBH      NSIYVEKLLKTNVRQSLSQAALETLSIIAYKQPITRVAIDEIRGVKSDRAIYTLLEKNIIKECGRLDVPG
SCPB_CLOB1      NSIYVEKLLKTNVRQSLSQAALETLSIIAYKQPITRVAIDEIRGVKSDRAIYTLLEKNIIKECGRLDVPG
SCPB_ENTFA      XXXXXXXXXQSPMSNALSQAALETLSIIAYKQPISRIEIDEIRGVQTSGSIQKLVARQLIEEKGRVDGPG
SCPB_CLOTE      NSCFIEQLLKTNSSQSLSQAALETLSIVAYKQPVTRVDVDEIRGVKSDRALQTLLQKSLIKETGRLDVPG
SCPB_BACP2      YSIYLKKLVETP-SKGLSQAALEVLAIVSYKQPITRSEVEEIRGVKSERVLHSLVAKALLCEVGRADGPG
SCPB_BACSU      FAPYLKKLIEVP-SKGLSQASLEVLAIVSYKQPITRAEIEEIRGVKSERILHSLVAKALLCEVGRADGPG
SCPB_CLOTH      YYDYIKQLFEPKQRSGLSQAALETLAIIAYNRPITKAKIEQIRGVNSDSAITKLLEKNLIREAGRLDAPG
SCPB_BREBN      HVPYFERLATSPGQSTLSQAALETLAIVAYKQPLTRSEIEEIRGVKCEKALNTLLSKQLIREAGRAEGIG
SCPB_CLOPH      MYEAIVKIAHVPKKHILTDVLLESLSIIAYKQPITKQQIESIRGVKSDHAVNKLVEYNLVCEVGRMDAPG
SCPB_BACLD      FAVYLKKLIEAP-SKGLSQAALEVLAIVSYKQPITRAEVEEIRGVKSERILQSLVAKALLCEVGRADGPG
SCPB_SYMTH      AAEYVERLLQ-PKSRGLSHAALETLAIIAYRQPITKAEIENVRGVKVDRALETLLERGLIEDKGRKEAPG
SCPB_CLOPS      NSEYIQKLLKKNVRXXXXXXXXXXXXIICYKQPITRVEIDEIRGVKSESAIQRLVEKNLVEETGRLEVPG
SCPB_CLOPE      NSEYVQKLLKKNVRXXXXXXXXXXXXIICYKQPITRVEIDEIRGVKSESAIQRLVEKNLVEETGRLEVPG
SCPB_CLOP1      NSEYVQKLLKKNVRXXXXXXXXXXXXIICYKQPITRVEIDEIRGVKSESAIQRLVEKNLVEETGRLEVPG
SCPB_ALKMQ      YHEILQKLFEPKQNKGLTQASLETLAIIAYRQPITKTEIESVRGVKCDKAISTLFEKNLIEDRGRLEKTG
SCPB_ALKOO      HYEYLQKLFAPKQNRGITQAALETLAIIAYKQPITKTEIEEIRGVKCDKAISTLLEKELIEEQGRLEKTG
SCPB_DESRM      CAPYIERYRKS--GTGLSKAAIETLAIIAYRQPITRSEVEMIRGVKVDSPINTLLERNLIEEKGRREGPG
SCPB_BACA2      FVPYLKKLIEVP-SKGLSQASLEVLAIVSYKQPITRAEIEDIRGVKSERILHSLVSKALLCEVGRADGPG
SCPB_THETN      YGDIVRKALKMEITQGLSQAALEVLAIIAYNQPITKAEIERIRGVRSDKPINTLLEYNLIKESGRASSPG
SCPB_MYCPN      IKDFIHRYLPNKIKNPLNSKTMEVLAIIAYNQPCTRPRINEIRGADSFQIVDDLLEKELIVELGRKDTPG
SCPB_MYCPE      ISKIVASKQKNPLNQGM----IETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVG
SCPB_PELCD      HAEWVRRHSSRPTR--LSRAALEALAIIAYQQPVTRADIDYLRGVDSGGVVKSLLDKRLVRIVGKKDVPG
SCPB_MYCGA      VKKDMQRYVSERFKNPLNKSLMEVLAIVAYNQPCTRVRINEIRGVDSLSLVDNLLEKGLIVEVGRADTPG
SCPB_CLOCE      YFDYVSKLYQIRQKQALSQAAYEVLAIIAYNQPITRAKIEQIRGVNSDSAVTRLTERNLIKEAGKLDVPG
SCPB_CARHZ      FSVYIERLFKPPA-QHLTQATLETLAIIAYKQPVTKTEIELIRGVKADSSIATLLEKGLIEEAGRKDAPG
SCPB_UREPA      NKDALSKFVTTSFRTPLSQRNLETLAIIAYNQPTTRAKIQAIRDRDPKPAIDALLKLNLIIEAGRQDTPG
SCPB_CLOD6      YAEYXXXXXXXXXXXSLSQATLETLTIIAYKQPITKVEIEDIRGVKCDKVLQTLFENELIREAGRLNKIG
SCPB_STAES      TSTYIEQLVKEKSKMKLSQAAMETLSIIAYNQPLTRGDIEMIRGINSDGAVKTLIARGLV--EAKDVDHS
SCPB_STAEQ      TSTYIEQLVKEKSKMKLSQAAMETLSIIAYNQPLTRGDIEMIRGINSDGAVKTLIARGLV--EAKDVDHS
SCPB_STAHJ      ASPYIEQLIEQKSNMKLSQAAMETLSIIAYNQPLSRSDIELIRGINSDGAVRTLIARGLI--EAKDVENS
SCPB_MYCMO      VKDYVSELVTIIKKQRLSNAAIEVAGIVAYKQPISKSQINKIRGVASEIVVNTLLIKGIIEEVGIAQTPG
SCPBL_COXBU     FSPWLQRWEKKPARYS--RALLETLALIVYRQPISRGEIEEVRGVASSDIIKKLLDREWISVVAHRDVPG
SCPB_STAAW      AATYIEQLIEQKSQMKLSQAAMEVLSIIAYNQPLSRSDIELIRSINSDGAVKTLIAKGLVEAKVVNE--Q
SCPB_STAAS      AATYIEQLIEQKSQMKLSQAAMEVLSIIAYNQPLSRSDIELIRSINSDGAVKTLIAKGLVEAKVVNE--Q
SCPB_STAAN      AATYIEQLIEQKSQMKLSQAAMEVLSIIAYNQPLSRSDIELIRSINSDGAVKTLIAKGLVEAKVVNE--Q
SCPB_STAAM      AATYIEQLIEQKSQMKLSQAAMEVLSIIAYNQPLSRSDIELIRSINSDGAVKTLIAKGLVEAKVVNE--Q
SCPB_STAA9      AATYIEQLIEQKSQMKLSQAAMEVLSIIAYNQPLSRSDIELIRSINSDGAVKTLIAKGLVEAKVVNE--Q
SCPB_STAA2      AATYIEQLIEQKSQMKLSQAAMEVLSIIAYNQPLSRSDIELIRSINSDGAVKTLIAKGLVEAKVVNE--Q
SCPB_STAA1      AATYIEQLIEQKSQMKLSQAAMEVLSIIAYNQPLSRSDIELIRSINSDGAVKTLIAKGLVEAKVVNE--Q
SCPB_STAAE      AATYIEQLIEQKSQMKLSQAAMEVLSIIAYNQPLSRSDIELIRSINSDGAVKTLIAKGLVEAKVVNE--Q
SCPB_STAAC      AATYIEQLIEQKSQMKLSQAAMEVLSIIAYNQPLSRSDIELIRSINSDGAVKTLIAKGLVEAKVVNE--Q
SCPB_STAA8      AATYIEQLIEQKSQMKLSQAAMEVLSIIAYNQPLSRSDIELIRSINSDGAVKTLIAKGLVEAKVVNE--Q
SCPB_STAA3      AATYIEQLIEQKSQMKLSQAAMEVLSIIAYNQPLSRSDIELIRSINSDGAVKTLIAKGLVEAKVVNE--Q
SCPB_STAAR      ASMYIEQLIEQKSQMKLSQAAMEVLSIIAYNQPLSRSDIELIRSINSDGAVKTLIAKGLVEAKVVNE--Q
SCPB_MYCPU      -IEPLKDYVSKLVSQKLSKAAIEVAGIVAYKQPITKSMINEIRGVASDQVVNTLLVKNLIEEVGISPTPG
SCPB_MYCGE      IKDYLHLLLAHKVKNPLNSKAMEVLAIIAYNQPCTRPRINEIRGVDSFQIVDDLIAKELIVELGRTDKPG
SCPB_STAS1      ASDYIEQLIEQKSKMKLSQAAMESLSIIAYNQPLSRSDIELIRGINSDGAVKTLIARGLV--EAKEEADS


                         +         .         .         .         .         *         .:210
query           RPNLYVTTDYFLDYMGINHLEELPVIDELEIQAQESQLFGERIEEDENQ
SCPB_STRZT      RPNLYVTTDYFLDYMGINHLEELPVIDELEIQAQESQLFGERIEEDENQ
SCPB_STRZP      RPNLYVTTDYFLDYMGINHLEELPVIDELEIQAQESQLFGERIEEDENQ
SCPB_STRZJ      RPNLYVTTDYFLDYMGINHLEELPVIDELEIQAQESQLFGERIEEDENQ
SCPB_STRR6      RPNLYVTTDYFLDYMGINHLEELPVIDELEIQAQESQLFGERIEEDENQ
SCPB_STRPS      RPNLYVTTDYFLDYMGINHLEELPVIDELEIQAQESQLFGERIEEDENQ
SCPB_STRPN      RPNLYVTTDYFLDYMGINHLEELPVIDELEIQAQESQLFGERIEEDENQ
SCPB_STRPJ      RPNLYVTTDYFLDYMGINHLEELPVIDELEIQAQESQLFGERIEEDENQ
SCPB_STRPI      RPNLYVTTDYFLDYMGINHLEELPVIDELEIQAQESQLFGERIEEDENQ
SCPB_STRP7      RPNLYVTTDYFLDYMGINHLEELPVIDELEIQAQESQLFGERIEEDENQ
SCPB_STRP4      RPNLYVTTDYFLDYMGINHLEELPVIDELEIQAQESQLFGERIEEDENQ
SCPB_STRP2      RPNLYVTTDYFLDYMGINHLEELPVIDELEIQAQESQLFGERIEEDENQ
SCPB_STRMT      RPNLYVTTDYFLDYMGINHLEELPVIDELEIQAQESQLFGERIEEDENQ
SCPB_STRSV      RPNLYVTTDYFLDYMGINHLDELPIVEETELVAEESQLFIERTDIDENQ
SCPB_STRGC      RPNLYVTTEYFLDYMGINHLEELPVVTDTELVAEESQLFGQATESE---
SCPB_STRMU      RPNLYVTSDYFLDYMGINSLEELPDASSIELKDEEFTLFDNKENEEQ--
SCPB_STRT2      RPNLYATTDYFLDYIGINSLDELVAIDQLELEEQETSLFREDAPED---
SCPB_STRT1      RPNLYATTDYFLDYIGINSLDELVAIDQLELEEQETSLFREDAPED---
SCPB_STRPZ      RPHLYATTDYFLDYMGINHLDELIEVSAVEPADEEIALF----------
SCPB_STRPM      RPHLYATTDYFLDYMGINHLDELIEVSAVEPADEEIALF----------
SCPB_STRPG      RPHLYATTDYFLDYMGINHLDELIEVSAVEPADEEIALF----------
SCPB_STRPF      RPHLYATTDYFLDYMGINHLDELIEVSAVEPADEEIALF----------
SCPB_STRPD      RPHLYATTDYFLDYMGINHLDELIEVSAVEPADEEIALF----------
SCPB_STRP8      RPHLYATTDYFLDYMGINHLDELIEVSAVEPADEEIALF----------
SCPB_STRP6      RPHLYATTDYFLDYMGINHLDELIEVSAVEPADEEIALF----------
SCPB_STRP3      RPHLYATTDYFLDYMGINHLDELIEVSAVEPADEEIALF----------
SCPB_STRP1      RPHLYATTDYFLDYMGINHLDELIEVSAVEPADEEIALF----------
SCPB_STRPC      RPHLYATTDYFLDYMGINHLDELIEVSAVEPADEEIALF----------
SCPB_STRPB      RPHLYATTDYFLDYMGINHLDELIEVSAVEPADEEIALF----------
SCPB_STRS7      RPNLYATTDYFLDYMGINHLEELVDISSIAVEEQETTLF----------
SCPB_STREM      RPNLYATTDYFLDYMGINHLEELVDISSIAVEEQETTLF----------
SCPB_STRE4      RPNLYATTDYFLDYMGINHLEELVDISSIAVEEQETTLF----------
SCPB_LACLA      RPSLYATTDFFLDYIGINHLDELPEIDESRFIAEEQTLFNES-EENENQ
SCPB_STRA5      RPNLYETTNYFLDYMGINQLDDLIDASSIELVDEEVSLF----------
SCPB_STRA3      RPNLYETTNYFLDYMGINQLDDLIDASSIELVDEEVSLF----------
SCPB_STRA1      RPNLYETTNYFLDYMGINQLDDLIDASSIELVDEEVSLF----------
SCPB_LACLS      RPSLYATTEFFLDYIGINNLEELPEIDESRYVAEQQTLFNES-EENENQ
SCPB_LACLM      RPSLYATTEFFLDYIGINNLEELPEIDESRYVAEQQTLFNES-EENENQ
SCPB_LACSS      RPILYGTSDYFLDYFGLGSLKELPELEQMTL------------------
SCPB_LEUMM      RPIMFGTTDEFLDYFGLKSIEELPPLPDFNMLDLGDDIDGE--------
SCPB_LACGA      HPNLYVTTDYFLQYFNYESLADLPVIEEFEADDNPVNLFDQ--------
SCPB_LACS1      RPILYVTTDKFLDYFGL--------------------------------
SCPB_LACDA      HPKLYVTTDYFLQYFGYKSLADLPVIENFEDSSFDADLFAENGTADE--
SCPB_LACPL      RPILYGTTELFLDYFGL--------------------------------
SCPB_BACSK      RAILYGTTPYFLDHFGLESLADLPDLKELDLEQDETDLFFEKLNAD---
SCPB_PEDPA      RPKTYGTTDEFLDYFGLEDIKDLPKLEKV--------------------
SCPB_LACJO      HPNLYVTTDYFLQYFNYESLADLPVIEEFEADDNPVNLFNQ--------
SCPB_LISMO      RAKLYVTTSEFLDAFGLNSLEDLPKLADPEPDQNEMDLFFDRFNQSKEQ
SCPB_LISIN      RAKLYVTTSEFLDAFGLNSLDDLPKLADPEAEQSEMDLFFDRFNQSKEQ
SCPB_LISW6      RAKLYVTTSEFLDAFGLNSLEDLPKLADPEADQNEMDLFFDRFNQSKEQ
SCPB_LISMF      RAKLYVTTSEFLDAFGLNSLEDLPKLADPEPDQNEMDLFFDRFNQSKEQ
SCPB_LISMC      RAKLYVTTSEFLDAFGLNSLEDLPKLADPEPDQNEMDLFFDRFNQSKEQ
SCPB_LISMH      RAKLYVTTSEFLDAFGLNSLEDLPKLADEEPDQNEMDLFFDRFNQSKEQ
SCPB_OCEIH      RPVLFQTSKEFLTFFGLATLDDLPPLPEPDKEEREADLFFERFQDE---
SCPB_GEOTN      RPILYGTTAEFLDYFGLKTXXXXXXADDGELE-READLFFEKLAEN---
SCPB_EUBR3      RPLLFGTTEEFLRSFGVSSIDELPVLSPVQV------------------
SCPB_BACCN      RPILYGTTKEFLDTFGLQTLDDLPALSEENEQMNEADLFFDSLQE----
SCPB_BACC2      RPILYGTTKEFLDTFGLKTLDDLPPLSEENEQMNEADLFFGSLQE----
SCPB_CLOAB      RPILYETTDEFLKNFNLGNIDELPPMEQIASELDE--------------
SCPB_BACHD      RPILYGTTPQFLDHFGXXXXXXXXXIDESSI-GEEADLFFQQMEQ----
SCPB_BACHK      RPILYGTTKEFLDTFGLKTLDDLPPLSEENEQMNEADLFFGSLQE----
SCPB_BACC4      RPILYGTTKEFLDTFGLKTLDDLPPLSEENEQMNEADLFFGSLQE----
SCPB_BACC3      RPILYGTTKEFLDTFGLKTLDDLPPLSEENEQMNEADLFFGSLQE----
SCPB_BACC0      RPILYGTTKEFLDTFGLKTLDDLPPLSEENEQMNEADLFFGSLQE----
SCPB_BACAN      RPILYGTTKEFLDTFGLKTLDDLPPLSEENEQMNEADLFFGSLQE----
SCPB_BACAH      RPILYGTTKEFLDTFGLKTLDDLPPLSEENEQMNEADLFFGSLQE----
SCPB_BACAC      RPILYGTTKEFLDTFGLKTLDDLPPLSEENEQMNEADLFFGSLQE----
SCPB_BACAA      RPILYGTTKEFLDTFGLKTLDDLPPLSEENEQMNEADLFFGSLQE----
SCPB_BACWK      RPILYGTTKEFLDTFGLKTLDDLPPLSEENEQMNEADLFFGSLQE----
SCPB_BACCQ      RPILYGTTKEFLDTFGLKTLDDLPPLSEENEQMNEADLFFGSLQE----
SCPB_BACC7      RPILYGTTKEFLDTFGLKTLDDLPPLSEENEQMNEADLFFGSLQE----
SCPB_BACC1      RPILYGTTKEFLDTFGLKTLDDLPPLSEENEQMNEADLFFGSLQE----
SCPB_BACCZ      RPILYGTTKEFLDTFGLKTLDDLPPLSEENEQMNEADLFFGSLQE----
SCPB_BACCR      RPILYGTTKEFLDTFGLKTLDDLPPLSEENEQMNEADLFFGCLQE----
SCPB_GEOKA      RPILYGTTPEFLDYFGLKTXXXXXXADDGESE-READLFFEKLAEN---
SCPB_CLOBJ      KPILYGTTEEFLKFFGLDSIEAIPNLEDL--------------------
SCPB_CLOB6      KPILYGTTEEFLKFFGLDSIEAIPNLEDL--------------------
SCPB_MOOTA      RPILYGTTPKFLEFFGLKDLKELPPLEDVAASQENSREAGGR-------
SCPB_CLOBM      KPILYGTTEEFLKFFGLDSIEAIPNLEDL--------------------
SCPB_CLOBL      KPILYGTTEEFLKFFGLDSIEAIPNLEDL--------------------
SCPB_CLOBK      KPILYGTTEEFLKFFGLDSIEAIPNLEDL--------------------
SCPB_CLOBH      KPILYGTTEEFLKFFGLDSIEAIPNLEDL--------------------
SCPB_CLOB1      KPILYGTTEEFLKFFGLDSIEAIPNLEDL--------------------
SCPB_ENTFA      RAILYGTTKYFMDYFGLKSLDELPDIQQ---------------------
SCPB_CLOTE      RPILYSTTEEFLKHFG---------------------------------
SCPB_BACP2      RAILYGTTPTFLEQFGLKALDELPPLPE-NVEAEEADLFFENFNQ----
SCPB_BACSU      RAILYGTTPTFLEQFGLKTLDELPPLPEEDVLQEEADLFFENFNQ----
SCPB_CLOTH      KPVLYETTDEFFRSFGFKSDADLPIFE----------------------
SCPB_BREBN      RPILYATTKEFLEHFGLRELGDLPELDIEEARLEASALFGKAEE-----
SCPB_CLOPH      RPILFGTTEDFLRNFGIASLEDLPVV-----------------------
SCPB_BACLD      RAILYGTTETFLEQFGL--------------------------------
SCPB_SYMTH      RPILYGTTAEFLRYFGLRELSELPPVE----------------------
SCPB_CLOPS      RPILYGTTDEFLRHFALNDLGDLPSIELFEENNEVSDMVEE--------
SCPB_CLOPE      RPILYGTTDEFLRHFALNDLGDLPSIELFEENDEVSDMVEE--------
SCPB_CLOP1      RPILYGTTDEFLRHFALNDLGDLPSIELFEENDEVSDMVEE--------
SCPB_ALKMQ      RPILFGTTLHFLKNFGLKSLEDLPKITEID-QANEEEL-----------
SCPB_ALKOO      RPIIYGTTINFLKVFSISSLDNLPNVSDFNISVDSDIL-----------
SCPB_DESRM      RPVLYGTTLEFLKHFGLKDVSELPPLEEFLVEGE---------------
SCPB_BACA2      RAILYGTTPVFLEQFGLKTXXXXXXXXEEDVLQEEADLFFENFNQ----
SCPB_THETN      RPILYSTTEDFLKYFGISSLKELPEIE----------------------
SCPB_MYCPN      RPFIYEVSPKFYDLFGINSLDELPKVENFDL------------------
SCPB_MYCPE      KPYLYQVTPKFYDIFGLDSIKDLPEI-----------------------
SCPB_PELCD      RPLLYGTSREFLEFFGLRSLSDLPTLKEFTELTKESE------------
SCPB_MYCGA      RPFLYNVSEKFFDLFGIESIDDLPQIKHFDPDSYQEGDFFDSNRYDENE
SCPB_CLOCE      RPRLYETTDEFLRCFGFKSI-----------------------------
SCPB_CARHZ      RPIIYRTTAKFLEFFGLKSLD----------------------------
SCPB_UREPA      HPILYTVSQKFYDLFGIRNLTELPRLNK---------------------
SCPB_CLOD6      KPIIYKTTDEFLKLLNIESLEELPPIENYQ-------------------
SCPB_STAES      RSHHLITTDLFLNVFGIENLDALPTTEEDEAEMDESNLVNQKGESNE--
SCPB_STAEQ      RSHHLITTDLFLNVFGIENLDALPTTEEDEAEMDESNLVNQKGESNE--
SCPB_STAHJ      RSHALQTTDLFLNVFGIEKI-----------------------------
SCPB_MYCMO      NPILYGVTAKFYDYFKIKSLHELPNLKEFD-------------------
SCPBL_COXBU     KPALFGTTKTFLDYFNLKSLEELPPLDVVDLEKIEAQ-FGEQL------
SCPB_STAAW      RSQQLITTDLFLNVFGISNI-----------------------------
SCPB_STAAS      RSQQLITTDLFLNVFGISNI-----------------------------
SCPB_STAAN      RSQQLITTDLFLNVFGISNI-----------------------------
SCPB_STAAM      RSQQLITTDLFLNVFGISNI-----------------------------
SCPB_STAA9      RSQQLITTDLFLNVFGISNI-----------------------------
SCPB_STAA2      RSQQLITTDLFLNVFGISNI-----------------------------
SCPB_STAA1      RSQQLITTDLFLNVFGISNI-----------------------------
SCPB_STAAE      RSQQLITTDLFLNVFGISNI-----------------------------
SCPB_STAAC      RSQQLITTDLFLNVFGISNI-----------------------------
SCPB_STAA8      RSQQLITTDLFLNVFGISNI-----------------------------
SCPB_STAA3      RSQQLITTDLFLNVFGISNI-----------------------------
SCPB_STAAR      RSQQLITTDLFLNVFGISNI-----------------------------
SCPB_MYCPU      KPVLYGITNKFYDYFKIKSLQELPNLSEFD-------------------
SCPB_MYCGE      RPFIYEVSAKFYDLFGIDSLDQLPKIEHFDL------------------
SCPB_STAS1      RSHQLYTTELFLNVFGI--------------------------------