[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for spne4:ACF56666.1

[Show Plain Result]


## Summary of Sequence Search
    1::480
    1::465       0.0 100%  480 aa  GATB_STRP4 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::465       0.0  99%  480 aa  GATB_STRR6 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::465       0.0  99%  480 aa  GATB_STRP2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::465       0.0  99%  480 aa  GATB_STRZT RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::465       0.0  99%  480 aa  GATB_STRZJ RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::465       0.0  99%  480 aa  GATB_STRPN RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::465       0.0  99%  480 aa  GATB_STRPI RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::465       0.0  99%  480 aa  GATB_STRPS RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::465       0.0  98%  480 aa  GATB_STRP7 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::465       0.0  98%  480 aa  GATB_STRPJ RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::465       0.0  98%  480 aa  GATB_STRZP RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::465       0.0  94%  480 aa  GATB_STRT2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::465       0.0  94%  480 aa  GATB_STRT1 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::465       0.0  94%  480 aa  GATB_STRTD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::463       0.0  89%  479 aa  GATB_STRP8 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::463       0.0  89%  479 aa  GATB_STRPD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::463       0.0  89%  479 aa  GATB_STRP3 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::463       0.0  89%  479 aa  GATB_STRP1 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::463       0.0  89%  479 aa  GATB_STRPZ RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::463       0.0  89%  479 aa  GATB_STRPM RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::463       0.0  89%  479 aa  GATB_STRPC RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::463       0.0  89%  479 aa  GATB_STRPB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::463       0.0  88%  479 aa  GATB_STRPG RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::463       0.0  88%  479 aa  GATB_STRP6 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::463       0.0  88%  479 aa  GATB_STRPF RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::465       0.0  88%  479 aa  GATB_STRSY RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::465       0.0  88%  479 aa  GATB_STRS2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::463       0.0  88%  479 aa  GATB_STRS7 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::463       0.0  88%  479 aa  GATB_STREM RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::463       0.0  87%  479 aa  GATB_STRU0 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::463       0.0  88%  479 aa  GATB_STRE4 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::465       0.0  87%  480 aa  GATB_STRA3 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::465       0.0  86%  480 aa  GATB_STRA5 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::465       0.0  86%  480 aa  GATB_STRA1 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::465       0.0  82%  477 aa  GATB_STRGC RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::465       0.0  82%  477 aa  GATB_STRSV RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::465       0.0  80%  479 aa  GATB_STRMU RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::465       0.0  77%  477 aa  GATB_LACLM RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::465       0.0  77%  477 aa  GATB_LACLS RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::465       0.0  77%  477 aa  GATB_LACLA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::464       0.0  67%  476 aa  GATB_ENTFA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::462     e-176  66%  476 aa  GATB_OCEIH RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::461     e-169  64%  475 aa  GATB_LYSSC RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::462     e-168  64%  476 aa  GATB_BACA2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::462     e-166  63%  476 aa  GATB_BACP2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::462     e-166  63%  476 aa  GATB_BACLD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::464     e-166  64%  476 aa  GATB_BACSK RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::462     e-165  63%  476 aa  GATB_BACSU RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::465     e-165  60%  477 aa  GATB_LACS1 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::462     e-165  63%  476 aa  GATB_BACCN RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::462     e-164  64%  476 aa  GATB_LISMF RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::462     e-164  64%  476 aa  GATB_LISMC RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::463     e-164  62%  475 aa  GATB_MACCJ RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::462     e-164  62%  473 aa  GATB_LACBA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::462     e-164  63%  476 aa  GATB_LISMH RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::462     e-164  63%  476 aa  GATB_BACHD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::462     e-164  63%  476 aa  GATB_GEOKA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::462     e-163  63%  476 aa  GATB_LISMO RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::461     e-163  63%  475 aa  GATB_BACWK RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::461     e-163  64%  475 aa  GATB_BACC4 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::462     e-163  63%  476 aa  GATB_LISIN RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::464     e-163  60%  476 aa  GATB_LACSS RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::462     e-163  62%  474 aa  GATB_LACRJ RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::462     e-163  62%  474 aa  GATB_LACRD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::461     e-163  63%  475 aa  GATB_BACC7 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::461     e-163  63%  475 aa  GATB_BACC1 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::461     e-163  63%  475 aa  GATB_BACC3 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::461     e-163  63%  475 aa  GATB_BACC0 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::461     e-163  63%  475 aa  GATB_BACAN RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::461     e-163  63%  475 aa  GATB_BACAH RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::461     e-163  63%  475 aa  GATB_BACAC RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::461     e-163  63%  475 aa  GATB_BACAA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::462     e-163  63%  476 aa  GATB_GEOTN RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::461     e-163  63%  475 aa  GATB_BACHK RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::461     e-163  63%  475 aa  GATB_BACCZ RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::461     e-163  63%  475 aa  GATB_BACCR RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::461     e-163  63%  475 aa  GATB_BACCQ RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::462     e-162  62%  475 aa  GATB_STAHJ RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::464     e-162  59%  476 aa  GATB_LACCB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::462     e-162  63%  476 aa  GATB_LISW6 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::461     e-162  63%  475 aa  GATB_BACC2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::464     e-162  59%  476 aa  GATB_LACC3 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::463     e-162  62%  475 aa  GATB_STAAU RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::463     e-162  62%  475 aa  GATB_STAAR RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::463     e-161  61%  475 aa  GATB_STAS1 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::462     e-161  61%  475 aa  GATB_STAES RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::462     e-161  61%  475 aa  GATB_STAEQ RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::463     e-161  62%  475 aa  GATB_STAAW RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::463     e-161  62%  475 aa  GATB_STAAT RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::463     e-161  62%  475 aa  GATB_STAAS RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::463     e-161  62%  475 aa  GATB_STAAN RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::463     e-161  62%  475 aa  GATB_STAAM RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::463     e-161  62%  475 aa  GATB_STAAE RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::463     e-161  62%  475 aa  GATB_STAAC RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::463     e-161  62%  475 aa  GATB_STAA9 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::463     e-161  62%  475 aa  GATB_STAA8 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::463     e-161  62%  475 aa  GATB_STAA3 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::463     e-161  62%  475 aa  GATB_STAA2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::463     e-161  62%  475 aa  GATB_STAA1 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::462     e-160  61%  474 aa  GATB_LACPL RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::462     e-160  62%  476 aa  GATB_BACST RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::463     e-160  61%  475 aa  GATB_STAAB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::462     e-160  61%  475 aa  GATB_STASP RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::463     e-160  60%  475 aa  GATB_STACT RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::462     e-160  61%  474 aa  GATB_LACF3 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::463     e-160  60%  475 aa  GATB_PEDPA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::464     e-155  57%  476 aa  GATB_LACJO RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::464     e-155  58%  476 aa  GATB_LACGA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::464     e-151  56%  476 aa  GATB_LACAC RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::464     e-150  56%  476 aa  GATB_LACH4 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    4::464     e-149  57%  478 aa  GATB_BREBN RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    3::465     e-146  54%  477 aa  GATB_OENOB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::464     e-141  53%  476 aa  GATB_LACDB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::464     e-141  53%  476 aa  GATB_LACDA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::464     e-133  52%  475 aa  GATB_THEP3 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::464     e-133  52%  475 aa  GATB_THEPX RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::464     e-132  52%  475 aa  GATB_THETN RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   11::483     e-130  50%  494 aa  GATB_TRIEI RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    4::468     e-130  51%  481 aa  GATB_CARHZ RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::464     e-128  49%  476 aa  GATB_CLOBK RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::464     e-128  49%  476 aa  GATB_CLOBH RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::464     e-128  49%  476 aa  GATB_CLOB1 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::464     e-128  49%  476 aa  GATB_CLOBM RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::464     e-128  49%  476 aa  GATB_CLOB6 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::468     e-128  49%  480 aa  GATB_CALS8 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::464     e-128  49%  476 aa  GATB_CLOBL RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::464     e-128  49%  476 aa  GATB_CLOBJ RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::468     e-127  48%  480 aa  GATB_ANATD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    9::479     e-126  49%  490 aa  GATB_SYNJB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::465     e-126  50%  476 aa  GATB_MOOTA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::464     e-126  47%  477 aa  GATB_CLOTE RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::464     e-125  47%  476 aa  GATB1_CLOAB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::464     e-125  49%  474 aa  GATB_PERMH RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    4::469     e-125  50%  478 aa  GATB_PELTS RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    6::480     e-125  49%  492 aa  GATB_PROMA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   11::484     e-124  49%  495 aa  GATB_CYAP7 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    6::475     e-124  50%  490 aa  GATB_SYMTH RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::465     e-124  49%  476 aa  GATB2_SYNAS RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::464     e-124  47%  475 aa  GATB_THEYD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::466     e-123  49%  479 aa  GATB_GEOUR RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::468     e-123  49%  479 aa  GATB_GEOSM RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::468     e-123  48%  479 aa  GATB_GEOSF RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::464     e-123  47%  476 aa  GATB_CLOBA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    9::479     e-122  47%  490 aa  GATB_SYNJA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::464     e-122  47%  476 aa  GATB_CLOBB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   11::480     e-122  48%  491 aa  GATB_ANASP RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    4::470     e-122  47%  486 aa  GATB_LEPIN RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    9::483     e-122  49%  495 aa  GATB_SYNY3 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    4::470     e-122  47%  486 aa  GATB_LEPIC RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::477     e-122  49%  488 aa  GATB_GEOBB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    5::464     e-122  47%  478 aa  GATB_PELCD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::469     e-121  48%  481 aa  GATB_PSEU2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    4::470     e-121  46%  486 aa  GATB_LEPBL RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    4::470     e-121  46%  486 aa  GATB_LEPBJ RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::469     e-121  48%  481 aa  GATB_PSESM RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   11::484     e-121  49%  495 aa  GATB_CYAA5 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::469     e-120  48%  481 aa  GATB_PSE14 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   11::483     e-120  48%  494 aa  GATB_SYNPW RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   11::480     e-120  48%  491 aa  GATB_ANAVT RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    8::480     e-120  48%  491 aa  GATB_SYNPX RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::468     e-120  49%  481 aa  GATB_PSEU5 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    6::480     e-120  47%  491 aa  GATB_PROM1 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::468     e-120  48%  479 aa  GATB_PELPD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::464     e-120  48%  476 aa  GATB_NEIMA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    4::464     e-120  50%  476 aa  GATB_DESMR RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    6::480     e-119  47%  491 aa  GATB_PROMT RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::467     e-119  48%  477 aa  GATB_COXB2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::464     e-119  46%  475 aa  GATB_CLONN RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::470     e-119  46%  483 aa  GATB_HERA2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    6::477     e-119  47%  490 aa  GATB_PROM9 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::464     e-119  48%  476 aa  GATB_NEIMB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::467     e-119  48%  477 aa  GATB_COXBR RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::467     e-119  48%  477 aa  GATB_COXBN RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::467     e-119  48%  477 aa  GATB_COXB1 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::468     e-119  48%  481 aa  GATB_PSEMY RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::461     e-119  49%  474 aa  GATB_DESPS RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    4::466     e-119  47%  476 aa  GATB_DESDG RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::464     e-119  47%  476 aa  GATB_NEIG2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::464     e-119  47%  476 aa  GATB_NEIG1 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   11::483     e-119  47%  494 aa  GATB_SYNE7 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::465     e-118  49%  477 aa  GATB_THISH RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    3::471     e-118  47%  483 aa  GATB_EUBE2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::464     e-118  47%  475 aa  GATB_GEOLS RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::467     e-118  48%  477 aa  GATB_COXBU RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::464     e-118  47%  476 aa  GATB_CHLT3 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   11::484     e-118  48%  495 aa  GATB_CYAP8 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    4::466     e-118  48%  478 aa  GATB_CLOPH RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::464     e-118  48%  476 aa  GATB_NEIM0 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   10::482     e-118  47%  494 aa  GATB_SYNS9 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::469     e-118  47%  481 aa  GATB_PSEFS RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::469     e-118  48%  481 aa  GATB_PSEAB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   11::483     e-118  47%  494 aa  GATB_SYNP6 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::469     e-118  48%  481 aa  GATB_PSEAE RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::469     e-118  48%  481 aa  GATB_PSEA8 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   11::480     e-118  47%  491 aa  GATB_NOSP7 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::464     e-117  45%  481 aa  GATB_PROA2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::469     e-117  47%  481 aa  GATB_PSEPF RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::464     e-117  46%  475 aa  GATB_CHLPB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   11::485     e-117  47%  496 aa  GATB_SYNP2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::472     e-117  48%  483 aa  GATB_BRAHW RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::469     e-117  47%  481 aa  GATB_PSEF5 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    7::477     e-117  46%  490 aa  GATB_PROM5 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    3::464     e-116  47%  476 aa  GATB_DESVV RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    3::464     e-116  47%  476 aa  GATB_DESVH RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::465     e-116  47%  478 aa  GATB_NITEU RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::465     e-116  48%  478 aa  GATB_ALHEH RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::469     e-116  48%  481 aa  GATB_PSEA7 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::464     e-116  47%  476 aa  GATB_DESAA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    7::479     e-116  46%  490 aa  GATB_PROMP RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    3::482     e-116  45%  494 aa  GATB_UNCTG RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   11::483     e-116  46%  494 aa  GATB_SYNSC RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   13::487     e-115  46%  500 aa  GATB_THEEB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::464     e-115  48%  477 aa  GATB_METFK RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::468     e-115  47%  479 aa  GATB_GEOSL RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::468     e-115  47%  479 aa  GATB_GEOMG RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    4::464     e-115  47%  476 aa  GATB_DESVM RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::464     e-115  47%  476 aa  GATB_NEIMF RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    3::466     e-115  48%  475 aa  GATB_EUBR3 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   12::484     e-115  46%  495 aa  GATB_PROMM RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::469     e-115  45%  487 aa  GATB_LEPBP RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::469     e-115  45%  487 aa  GATB_LEPBA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::468     e-115  47%  481 aa  GATB_PSEPW RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::466     e-115  47%  479 aa  GATB_HALHL RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::464     e-115  46%  475 aa  GATB_CHLCH RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::463     e-115  48%  475 aa  GATB_THICR RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   12::484     e-115  46%  496 aa  GATB_PROM3 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::464     e-115  45%  476 aa  GATB_CLOK5 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::464     e-115  45%  476 aa  GATB_CLOK1 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    6::467     e-115  46%  477 aa  GATB_BDEBA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::464     e-115  47%  476 aa  GATB_METCA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::483     e-115  49%  496 aa  GATB_NITMU RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    9::481     e-114  47%  554 aa  GATB_GLOVI RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::469     e-114  48%  481 aa  GATB_CELJU RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   12::471     e-114  46%  484 aa  GATB_RHOCS RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::466     e-114  47%  477 aa  GATB_NITOC RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::464     e-114  44%  475 aa  GATB_CHLL2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::468     e-113  46%  481 aa  GATB_PSEPK RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::468     e-113  46%  481 aa  GATB_PSEP1 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    6::479     e-113  45%  490 aa  GATB_PROMS RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::468     e-113  46%  481 aa  GATB_PSEPG RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::468     e-113  46%  481 aa  GATB_PSEE4 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::464     e-113  44%  475 aa  GATB_PELPB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::464     e-113  45%  475 aa  GATB_CHLTE RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::469     e-113  47%  482 aa  GATB_AZOVD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::468     e-112  44%  481 aa  GATB_MARMS RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::469     e-112  46%  480 aa  GATB_HAHCH RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::463     e-112  45%  475 aa  GATB_CHRVO RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::465     e-112  47%  478 aa  GATB_NITEC RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::464     e-112  45%  475 aa  GATB_CHLPD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::464     e-112  45%  475 aa  GATB_CHLP8 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::472     e-112  47%  484 aa  GATB_RALME RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   12::472     e-111  43%  485 aa  GATB_GLUOX RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   11::472     e-110  44%  485 aa  GATB_MAGSA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::473     e-110  47%  486 aa  GATB_HERAR RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    5::480     e-110  46%  491 aa  GATB_BURS3 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    5::479     e-110  45%  491 aa  GATB_BURPP RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   11::477     e-110  45%  490 aa  GATB_MORCA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::463     e-110  45%  475 aa  GATB_THIDA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::468     e-110  46%  480 aa  GATB_SACD2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::467     e-110  46%  479 aa  GATB_CLOB8 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    4::479     e-110  46%  490 aa  GATB_BURP6 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    4::479     e-110  46%  490 aa  GATB_BURP1 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    4::479     e-110  46%  490 aa  GATB_BURP0 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    4::479     e-109  45%  490 aa  GATB_BURPS RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    4::479     e-109  45%  490 aa  GATB_BURMS RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    4::479     e-109  45%  490 aa  GATB_BURMA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    4::479     e-109  45%  490 aa  GATB_BURM9 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    4::479     e-109  45%  490 aa  GATB_BURM7 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    5::473     e-109  45%  486 aa  GATB_AZOSB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::465     e-109  45%  476 aa  GATB_RUTMC RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::473     e-109  47%  485 aa  GATB_RALEJ RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   18::489     e-109  44%  501 aa  GATB_CORDI RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    4::472     e-109  46%  484 aa  GATB_DECAR RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    5::480     e-109  46%  491 aa  GATB_BURP8 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::473     e-109  45%  484 aa  GATB_BORPE RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   26::498     e-109  45%  509 aa  GATB_PSYCK RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    5::479     e-109  45%  491 aa  GATB_BURXL RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    5::480     e-108  45%  491 aa  GATB_BURCH RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    5::480     e-108  45%  491 aa  GATB_BURCC RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    5::480     e-108  45%  491 aa  GATB_BURCA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   11::482     e-108  44%  494 aa  GATB_ACAM1 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::465     e-108  45%  478 aa  GATB2_CLOAB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    4::466     e-108  46%  478 aa  GATB_DESDA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   16::486     e-108  45%  502 aa  GATB_ARTAT RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::464     e-108  44%  475 aa  GATB_PELLD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   17::476     e-108  46%  490 aa  GATB_METS4 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::473     e-108  46%  485 aa  GATB_BORA1 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::473     e-108  45%  485 aa  GATB_BORPD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::473     e-108  46%  486 aa  GATB_JANMA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    5::466     e-108  41%  478 aa  GATB_AQUAE RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    4::479     e-108  45%  490 aa  GATB_BURTA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    2::464     e-107  45%  477 aa  GATB_SULNB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    3::466     e-107  43%  479 aa  GATB_MYCMS RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    3::466     e-107  43%  479 aa  GATB_MYCCT RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    4::480     e-107  44%  492 aa  GATB_DEHSC RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    4::480     e-107  44%  492 aa  GATB_DEHE1 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    5::480     e-107  46%  493 aa  GATB_AZOSE RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    2::462     e-107  46%  473 aa  GATB_CAMHC RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   16::486     e-107  44%  502 aa  GATB_ARTCA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    4::479     e-107  45%  490 aa  GATB_BURVG RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   21::486     e-106  46%  499 aa  GATB_RHILO RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    5::480     e-106  45%  491 aa  GATB_BURM1 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    5::480     e-106  45%  491 aa  GATB_BURCJ RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::472     e-106  45%  483 aa  GATB_MARAV RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   21::486     e-106  46%  500 aa  GATB_RHIME RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    4::479     e-106  45%  490 aa  GATB_BURA4 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::473     e-106  44%  484 aa  GATB_BORPA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::473     e-106  44%  484 aa  GATB_BORBR RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   20::480     e-105  43%  492 aa  GATB_AZOC5 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    5::480     e-105  45%  491 aa  GATB_BURCM RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   26::498     e-105  44%  509 aa  GATB_PSYA2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::463     e-105  43%  476 aa  GATB_LARHH RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   21::486     e-105  45%  500 aa  GATB_RHIEC RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   21::486     e-105  45%  500 aa  GATB_OCHA4 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    4::462     e-105  47%  474 aa  GATB_HELHP RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   16::486     e-105  44%  502 aa  GATB_ARTS2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   18::489     e-105  44%  501 aa  GATB_COREF RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   11::470     e-105  42%  483 aa  GATB_RICBR RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   21::486     e-105  45%  500 aa  GATB_RHIL3 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::474     e-105  46%  488 aa  GATB_RALPJ RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::477     e-105  45%  489 aa  GATB_POLSQ RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   21::486     e-105  44%  499 aa  GATB_MESSB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   18::489     e-105  43%  501 aa  GATB_CORGB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   18::482     e-104  43%  494 aa  GATB_NITWN RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   10::481     e-104  43%  493 aa  GATB_CORGL RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   21::486     e-104  45%  500 aa  GATB_BRUSU RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   21::488     e-104  45%  502 aa  GATB_BRUSI RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   21::486     e-104  45%  500 aa  GATB_BRUME RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   21::486     e-104  45%  500 aa  GATB_BRUMB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   21::486     e-104  45%  500 aa  GATB_BRUC2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   21::486     e-104  45%  500 aa  GATB_BRUAB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   21::486     e-104  45%  500 aa  GATB_BRUA2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   21::486     e-104  45%  500 aa  GATB_BRUA1 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   21::486     e-104  46%  500 aa  GATB_RHISN RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   21::486     e-104  45%  500 aa  GATB_RHIE6 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   21::486     e-104  44%  499 aa  GATB_BART1 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    5::471     e-104  44%  481 aa  GATB_FUSNN RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   21::486     e-104  44%  499 aa  GATB_BARHE RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    4::464     e-104  44%  476 aa  GATB_VARPS RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::465     e-104  42%  478 aa  GATB_DICNV RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   14::484     e-104  45%  498 aa  GATB_CAUCR RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   15::485     e-104  44%  499 aa  GATB_BIFLO RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   15::485     e-104  44%  499 aa  GATB_BIFLI RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   15::485     e-104  44%  499 aa  GATB_BIFLD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   20::484     e-104  44%  496 aa  GATB_XANP2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   11::470     e-104  42%  483 aa  GATB_RICB8 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   21::486     e-104  45%  500 aa  GATB_RHILW RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   17::476     e-104  44%  490 aa  GATB_METEP RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   21::486     e-104  44%  499 aa  GATB_BARQU RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   11::472     e-104  41%  483 aa  GATB_ANAPZ RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   17::476     e-104  44%  490 aa  GATB_METC4 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   21::486     e-103  45%  500 aa  GATB_SINMW RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   17::482     e-103  42%  494 aa  GATB_RHOPS RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   21::486     e-103  46%  501 aa  GATB_AGRT5 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::473     e-103  45%  485 aa  GATB_RALEH RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   21::486     e-103  45%  500 aa  GATB_BRUO2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::469     e-103  42%  487 aa  GATB_ROSS1 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::469     e-103  42%  483 aa  GATB_ROSCS RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    5::463     e-103  42%  474 aa  GATB_WOLPM RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   17::476     e-103  43%  490 aa  GATB_METPB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   17::476     e-103  43%  490 aa  GATB_METRJ RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::461     e-103  43%  473 aa  GATB_FRATN RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   12::471     e-103  45%  487 aa  GATB_ACICJ RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   20::483     e-102  45%  495 aa  GATB_ACIAD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   20::490     e-102  43%  503 aa  GATB_RHOS5 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    5::463     e-102  42%  473 aa  GATB_WOLWR RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   17::482     e-102  42%  494 aa  GATB_RHOPA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    5::466     e-102  41%  479 aa  GATB_MYXXD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   12::471     e-102  43%  483 aa  GATB_GRABC RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::473     e-102  45%  485 aa  GATB_CUPTR RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   21::493     e-102  43%  505 aa  GATB_CORJK RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    2::460     e-102  46%  472 aa  GATB_WOLSU RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   20::492     e-102  43%  503 aa  GATB_SILPO RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    2::463     e-102  45%  474 aa  GATB_SULDN RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   17::482     e-102  41%  492 aa  GATB_PELUB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   21::486     e-102  43%  499 aa  GATB_BARBK RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    6::488     e-102  43%  508 aa  GATB_SALRD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   15::480     e-102  42%  492 aa  GATB_BRAJA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   10::470     e-101  43%  481 aa  GATB_EHRCR RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   17::482     e-101  41%  494 aa  GATB_RHOP2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    2::465     e-101  46%  475 aa  GATB_HELPH RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::461     e-101  43%  473 aa  GATB_FRATW RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::461     e-101  43%  473 aa  GATB_FRATT RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::461     e-101  43%  473 aa  GATB_FRATO RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::461     e-101  43%  473 aa  GATB_FRATH RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::461     e-101  43%  473 aa  GATB_FRATF RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::461     e-101  43%  473 aa  GATB_FRAT1 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   20::492     e-101  42%  505 aa  GATB_DINSH RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::461     e-101  43%  473 aa  GATB_FRATM RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    2::460     e-101  46%  472 aa  GATB_CAMJ8 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   20::491     e-101  42%  502 aa  GATB_SILST RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    2::460     e-101  46%  472 aa  GATB_CAMJR RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    2::461     e-101  46%  472 aa  GATB_CAMFF RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::470     e-101  41%  482 aa  GATB_THESQ RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::470     e-101  41%  482 aa  GATB_THEP1 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::470     e-101  41%  482 aa  GATB_THEMA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   17::482     e-101  42%  494 aa  GATB_RHOP5 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::467     e-101  44%  479 aa  GATB_ALCBS RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    2::460     e-101  46%  472 aa  GATB_CAMJJ RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   20::490     e-101  42%  503 aa  GATB_RHOS4 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    3::464     e-101  44%  477 aa  GATB_LAWIP RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    2::462     e-101  45%  474 aa  GATB_CAMC5 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   20::490     e-100  42%  503 aa  GATB_RHOSK RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   20::490     e-100  42%  503 aa  GATB_RHOS1 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::474     e-100  45%  488 aa  GATB_RALSO RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    5::463     e-100  42%  473 aa  GATB_WOLPP RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   17::482     e-100  42%  494 aa  GATB_OLICO RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    4::460     e-100  43%  472 aa  GATB_ELUMP RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   15::480     e-100  42%  492 aa  GATB_BRASB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   17::483     e-100  42%  495 aa  GATB_METSB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    3::464     e-100  40%  479 aa  GATB_MESFL RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::464     e-100  45%  474 aa  GATB_HELPJ RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    2::460     e-100  46%  472 aa  GATB_CAMJE RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   11::470     e-100  43%  483 aa  GATB_RICTY RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    3::457     e-100  42%  472 aa  GATB_MYCAP RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   10::470     e-100  41%  482 aa  GATB_EHRCJ RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   17::483     e-100  43%  495 aa  GATB_BEII9 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::464     e-100  45%  474 aa  GATB_HELPY RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    2::460     e-100  45%  472 aa  GATB_CAMJD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   15::485     1e-99  42%  499 aa  GATB_BIFA0 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   15::471     2e-99  41%  485 aa  GATB_ANAMM RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   17::476     2e-99  43%  490 aa  GATB_METNO RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::472     2e-99  41%  485 aa  GATB_METI4 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   16::485     2e-99  44%  500 aa  GATB_CLAMS RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::465     3e-99  43%  476 aa  GATB_VESOH RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   17::482     3e-99  41%  494 aa  GATB_NITHX RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   15::471     3e-99  41%  485 aa  GATB_ANAMF RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   12::481     5e-99  42%  494 aa  GATB_PARUW RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   20::492     7e-99  42%  503 aa  GATB_ROSDO RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    2::465     7e-99  42%  476 aa  GATB_RHOFD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::469     9e-99  44%  481 aa  GATB_TERTT RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::468     1e-98  44%  478 aa  GATB_THELT RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   12::472     1e-98  41%  485 aa  GATB_RHORT RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   28::501     1e-98  41%  517 aa  GATB_THEFY RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   19::490     2e-98  42%  503 aa  GATB_RHOE4 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::465     2e-98  42%  485 aa  GATB_CLOCE RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    5::463     4e-98  41%  474 aa  GATB_WOLTR RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   10::470     4e-98  41%  481 aa  GATB_EHRRW RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    5::473     4e-98  42%  484 aa  GATB_ANASK RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   11::470     6e-98  42%  483 aa  GATB_RICRS RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    5::473     6e-98  42%  484 aa  GATB_ANADE RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   11::470     7e-98  42%  483 aa  GATB_RICRO RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   11::470     7e-98  42%  483 aa  GATB_RICAE RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   11::470     9e-98  42%  483 aa  GATB_RICCN RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   19::491     9e-98  42%  504 aa  GATB_RHOOB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   20::490     9e-98  42%  503 aa  GATB_NOCFA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   19::488     1e-97  43%  501 aa  GATB_MYCSJ RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   10::470     1e-97  41%  481 aa  GATB_EHRRG RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   19::488     2e-97  43%  501 aa  GATB_MYCSS RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   19::488     2e-97  43%  501 aa  GATB_MYCSK RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   11::470     2e-97  42%  483 aa  GATB_RICPU RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   11::470     6e-97  41%  483 aa  GATB_RICFE RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::473     8e-97  42%  485 aa  GATB_OPITP RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   13::484     2e-96  42%  494 aa  GATB_SPHWW RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   11::470     2e-96  41%  486 aa  GATB_ORITI RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   11::472     3e-96  41%  486 aa  GATB_ORITB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   11::470     4e-96  41%  483 aa  GATB_RICCK RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   14::484     4e-96  41%  497 aa  GATB_PROAC RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::469     5e-96  42%  483 aa  GATB_THERP RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   17::488     5e-96  42%  505 aa  GATB_STRAW RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   17::482     7e-96  41%  494 aa  GATB_RHOPB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    5::473     9e-96  41%  484 aa  GATB_ANAD2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   21::486     9e-96  44%  500 aa  GATB_AGRVS RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   19::491     1e-95  42%  503 aa  GATB_RHOSR RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    8::475     1e-95  42%  488 aa  GATB_CHLTB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    8::475     1e-95  42%  488 aa  GATB_CHLT2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    8::475     2e-95  42%  488 aa  GATB_CHLTA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    8::475     2e-95  42%  488 aa  GATB_CHLMU RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   16::487     2e-95  41%  504 aa  GATB_STRCO RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    8::475     2e-95  42%  488 aa  GATB_CHLTR RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   13::487     3e-95  44%  497 aa  GATB_NOVAD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::470     8e-95  40%  482 aa  GATB_THENN RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   19::488     2e-94  41%  503 aa  GATB_MYCS2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::466     8e-94  40%  477 aa  GATB_LEGPL RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::466     1e-93  40%  477 aa  GATB_LEGPH RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::468     1e-93  42%  479 aa  GATB_DEIRA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   26::495     2e-93  38%  509 aa  GATB_TREPS RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   26::495     2e-93  38%  509 aa  GATB_TREPA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   16::485     4e-93  41%  499 aa  GATB_LEIXX RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::464     4e-93  41%  475 aa  GATB_DEIDV RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::466     2e-92  39%  477 aa  GATB_LEGPC RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    7::474     5e-92  40%  487 aa  GATB_CHLFF RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   20::491     6e-92  40%  503 aa  GATB_JANSC RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   19::488     8e-92  41%  503 aa  GATB_MYCPA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   19::488     8e-92  41%  503 aa  GATB_MYCA1 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   13::488     2e-91  42%  498 aa  GATB_ERYLH RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::471     2e-91  40%  485 aa  GATB_BORBZ RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::471     2e-91  40%  485 aa  GATB_BORBU RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   11::471     3e-91  38%  488 aa  GATB_NEOSM RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   15::492     3e-91  41%  505 aa  GATB_KINRD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::471     7e-91  40%  485 aa  GATB_BORGA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::465     9e-91  38%  478 aa  GATB1_SYNAS RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   25::463     1e-90  42%  509 aa  GATB_MYCTU RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   25::463     1e-90  42%  509 aa  GATB_MYCTA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   25::463     1e-90  42%  509 aa  GATB_MYCBT RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   25::463     1e-90  42%  509 aa  GATB_MYCBP RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   25::463     1e-90  42%  509 aa  GATB_MYCBO RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    7::474     1e-90  40%  487 aa  GATB_CHLCV RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    7::474     2e-90  40%  487 aa  GATB_CHLAB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   16::485     3e-90  41%  500 aa  GATB_CLAM3 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   20::488     6e-90  40%  505 aa  GATB_FRASC RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    5::472     9e-90  39%  483 aa  GATB_ANADF RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    7::475     2e-89  40%  488 aa  GATB_CHLPN RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    2::457     5e-89  40%  469 aa  GATB_THET8 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    2::457     6e-89  40%  469 aa  GATB_THET2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   11::470     6e-89  41%  483 aa  GATB_RICPR RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::471     6e-89  39%  485 aa  GATB_BORAP RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::465     8e-89  39%  476 aa  GATB_THEAB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   25::494     8e-89  39%  509 aa  GATB_MYCLE RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   25::494     8e-89  39%  509 aa  GATB_MYCLB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::463     8e-89  39%  473 aa  GATB_FINM2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   12::479     1e-88  39%  490 aa  GATB_ZYMMO RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    7::481     5e-88  38%  493 aa  GATB_TREDE RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    3::459     1e-87  38%  473 aa  GATB_MYCPU RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::471     2e-87  40%  485 aa  GATB_BORDL RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   14::484     2e-87  39%  497 aa  GATB_NOCSJ RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::466     6e-87  38%  477 aa  GATB_LEGPA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::471     8e-87  40%  485 aa  GATB_BORRA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::462     2e-86  40%  476 aa  GATB_THEM4 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    2::459     4e-86  38%  473 aa  GATB_MYCS5 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::471     2e-85  39%  485 aa  GATB_BORT9 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::471     2e-84  39%  485 aa  GATB_BORHD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    5::466     1e-83  41%  482 aa  GATB_METB6 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    3::466     2e-83  37%  477 aa  GATB_UREU1 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   15::483     4e-83  39%  499 aa  GATB_SALAI RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   15::483     1e-82  39%  499 aa  GATB_SALTO RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    4::457     1e-82  37%  475 aa  GATB_MYCMO RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   10::459     1e-81  39%  473 aa  GATB_METBU RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   13::489     5e-81  39%  504 aa  GATB_TROWT RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   13::489     5e-81  39%  504 aa  GATB_TROW8 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   16::484     6e-81  39%  497 aa  GATB_RHOBA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    3::466     7e-80  37%  477 aa  GATB_UREPA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    3::466     7e-80  37%  477 aa  GATB_UREP2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   10::481     1e-79  39%  496 aa  GATB_HALWD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    4::461     2e-79  38%  472 aa  GATB_SULAC RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   11::473     2e-79  40%  495 aa  GATB_METMA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    3::459     3e-79  40%  474 aa  GATB_METHJ RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   10::467     8e-78  38%  479 aa  GATB_SULTO RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    3::459     8e-78  39%  471 aa  GATB_ARCFU RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   10::468     1e-77  36%  481 aa  GATB_MYCGA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   11::439     1e-77  42%  495 aa  GATB_METBF RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   11::409     3e-77  44%  495 aa  GATB_METAC RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   45::524     8e-76  35%  538 aa  GATB_DICDI RecName: Full=Probable glutamyl-tRNA(Gln)
   10::456     1e-75  41%  469 aa  GATB_METMP RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    2::459     2e-75  37%  477 aa  GATB_MYCPN RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    8::468     9e-75  37%  481 aa  GATB_MYCPE RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   66::544     9e-75  37%  557 aa  GATB_MOUSE RecName: Full=Probable glutamyl-tRNA(Gln)
   13::460     3e-74  38%  472 aa  GATB_METJA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    4::439     2e-73  38%  449 aa  GATB_METTH RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   10::456     3e-72  39%  469 aa  GATB_META3 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   10::456     2e-71  39%  469 aa  GATB_METM7 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   14::492     3e-71  36%  505 aa  GATB_HALMA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    4::460     3e-71  35%  472 aa  GATB_SULSO RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   10::456     3e-71  39%  469 aa  GATB_METM5 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    6::448     1e-70  36%  461 aa  GATB_METKA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   10::456     2e-70  39%  469 aa  GATB_METM6 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   14::483     3e-70  37%  496 aa  GATB_NATPD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   10::456     3e-70  39%  469 aa  GATB_METVS RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   13::481     6e-70  37%  495 aa  GATB_HALSA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   66::544     2e-68  35%  557 aa  GATB_HUMAN RecName: Full=Probable glutamyl-tRNA(Gln)
    4::438     4e-67  36%  450 aa  GATB_METS3 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::458     2e-66  36%  474 aa  GATB_COPPD RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    4::437     4e-66  38%  452 aa  GATB_METST RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    2::459     7e-61  32%  477 aa  GATB_MYCGE RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   91::514     3e-57  34%  602 aa  GATB_EMENI RecName: Full=Probable glutamyl-tRNA(Gln)
   32::523     1e-51  32%  541 aa  GATB_YEAST RecName: Full=Glutamyl-tRNA(Gln) amidotransferase
   10::512     1e-48  30%  526 aa  GATB_SCHPO RecName: Full=Probable glutamyl-tRNA(Gln)
   10::464     5e-48  33%  486 aa  GATB_AERPE RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
   92::277     1e-20  33%  613 aa  GATE_ARCFU RecName: Full=Glutamyl-tRNA(Gln) amidotransferase
   13::269     3e-15  33%  638 aa  GATE_DESK1 RecName: Full=Glutamyl-tRNA(Gln) amidotransferase
   13::271     3e-15  30%  642 aa  GATE_AERPE RecName: Full=Glutamyl-tRNA(Gln) amidotransferase
   12::290     5e-15  32%  631 aa  GATE_METM6 RecName: Full=Glutamyl-tRNA(Gln) amidotransferase
   12::290     5e-15  32%  631 aa  GATE_METM5 RecName: Full=Glutamyl-tRNA(Gln) amidotransferase
    3::271     5e-15  31%  630 aa  GATE_METJA RecName: Full=Glutamyl-tRNA(Gln) amidotransferase
   87::262     8e-15  34%  598 aa  GATE_THEVO RecName: Full=Glutamyl-tRNA(Gln) amidotransferase
   12::290     8e-15  32%  631 aa  GATE_METMP RecName: Full=Glutamyl-tRNA(Gln) amidotransferase
   13::285     2e-14  31%  634 aa  GATE_SULAC RecName: Full=Glutamyl-tRNA(Gln) amidotransferase
   91::268     2e-14  30%  621 aa  GATE_METS3 RecName: Full=Glutamyl-tRNA(Gln) amidotransferase
   12::290     2e-14  31%  631 aa  GATE_METM7 RecName: Full=Glutamyl-tRNA(Gln) amidotransferase
  102::579     4e-14  30%  640 aa  GATE_METKA RecName: Full=Glutamyl-tRNA(Gln) amidotransferase
   12::585     7e-14  31%  633 aa  GATE_METVS RecName: Full=Glutamyl-tRNA(Gln) amidotransferase
   11::269     8e-14  31%  607 aa  GATE_THENV RecName: Full=Glutamyl-tRNA(Gln) amidotransferase
   10::269     8e-14  32%  607 aa  GATE_PYRIL RecName: Full=Glutamyl-tRNA(Gln) amidotransferase
   94::269     2e-13  34%  633 aa  GATE_METAC RecName: Full=Glutamyl-tRNA(Gln) amidotransferase
    1::260     4e-13  32%  619 aa  GATE_METTH RecName: Full=Glutamyl-tRNA(Gln) amidotransferase
   12::284     1e-12  28%  623 aa  GATE_HALMA RecName: Full=Glutamyl-tRNA(Gln) amidotransferase
  137::276     2e-12  32%  628 aa  GATE_SULTO RecName: Full=Glutamyl-tRNA(Gln) amidotransferase
   10::269     2e-12  30%  608 aa  GATE_PYRCJ RecName: Full=Glutamyl-tRNA(Gln) amidotransferase
  147::552     2e-12  33%  633 aa  GATE_SULSO RecName: Full=Glutamyl-tRNA(Gln) amidotransferase
   11::269     2e-12  29%  608 aa  GATE_PYRAE RecName: Full=Glutamyl-tRNA(Gln) amidotransferase
  149::262     3e-12  38%  633 aa  GATE_SULIA RecName: Full=Glutamyl-tRNA(Gln) amidotransferase
    4::270     3e-12  31%  628 aa  GATE_PYRFU RecName: Full=Glutamyl-tRNA(Gln) amidotransferase
   11::269     3e-12  29%  608 aa  GATE_PYRAR RecName: Full=Glutamyl-tRNA(Gln) amidotransferase
   14::271     1e-11  31%  629 aa  GATE_PYRKO RecName: Full=Glutamyl-tRNA(Gln) amidotransferase
   94::269     1e-11  30%  633 aa  GATE_METBF RecName: Full=Glutamyl-tRNA(Gln) amidotransferase
   94::269     2e-11  32%  633 aa  GATE_METMA RecName: Full=Glutamyl-tRNA(Gln) amidotransferase
   14::278     2e-11  30%  628 aa  GATE_THEGJ RecName: Full=Glutamyl-tRNA(Gln) amidotransferase
  149::262     2e-11  37%  633 aa  GATE_SULIY RecName: Full=Glutamyl-tRNA(Gln) amidotransferase
  149::262     2e-11  37%  633 aa  GATE_SULIN RecName: Full=Glutamyl-tRNA(Gln) amidotransferase
  149::262     2e-11  37%  633 aa  GATE_SULIM RecName: Full=Glutamyl-tRNA(Gln) amidotransferase
  149::262     2e-11  37%  633 aa  GATE_SULIL RecName: Full=Glutamyl-tRNA(Gln) amidotransferase
  149::262     2e-11  37%  633 aa  GATE_SULIK RecName: Full=Glutamyl-tRNA(Gln) amidotransferase
   17::274     2e-11  33%  635 aa  GATE_PYRHO RecName: Full=Glutamyl-tRNA(Gln) amidotransferase
  115::264     7e-11  31%  629 aa  GATE_THESM RecName: Full=Glutamyl-tRNA(Gln) amidotransferase
  109::264     1e-10  30%  622 aa  GATE_HALSA RecName: Full=Glutamyl-tRNA(Gln) amidotransferase
  109::264     1e-10  30%  622 aa  GATE_HALS3 RecName: Full=Glutamyl-tRNA(Gln) amidotransferase
  143::283     2e-10  30%  617 aa  GATE_NATPD RecName: Full=Glutamyl-tRNA(Gln) amidotransferase
   97::274     3e-10  28%  633 aa  GATE_PYRAB RecName: Full=Glutamyl-tRNA(Gln) amidotransferase
   88::251     2e-09  28%  603 aa  GATE_THEAC RecName: Full=Glutamyl-tRNA(Gln) amidotransferase
  149::274     2e-09  33%  614 aa  GATE_METHJ RecName: Full=Glutamyl-tRNA(Gln) amidotransferase
   13::265     8e-09  30%  625 aa  GATE_CALMQ RecName: Full=Glutamyl-tRNA(Gln) amidotransferase
  155::270     3e-04  27%  332 aa  MRAW_RHOPA RecName: Full=S-adenosyl-L-methionine-dependent
    9::186     8e-04  26%  253 aa  BIN3_MOUSE RecName: Full=Bridging integrator 3;
    1::480

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MNFETVIGLEVHVELNTNSKIFSPTSAHFGNDQNANTNVIDWSFPGVLPVLNKGVVDAGIKAALALNMDI
GATB_STRP4      MNFETVIGLEVHVELNTNSKIFSPTSAHFGNDQNANTNVIDWSFPGVLPVLNKGVVDAGIKAALALNMDI
GATB_STRR6      MNFETVIGLEVHVELNTNSKIFSPTSAHFGNDQNANTNVIDWSFPGVLPVLNKGVVDAGIKAALALNMDI
GATB_STRP2      MNFETVIGLEVHVELNTNSKIFSPTSAHFGNDQNANTNVIDWSFPGVLPVLNKGVVDAGIKAALALNMDI
GATB_STRZT      MNFETVIGLEVHVELNTNSKIFSPTSAHFGNDQNANTNVIDWSFPGVLPVLNKGVVDAGIKAALALNMDI
GATB_STRZJ      MNFETVIGLEVHVELNTNSKIFSPTSAHFGNDQNANTNVIDWSFPGVLPVLNKGVVDAGIKAALALNMDI
GATB_STRPN      MNFETVIGLEVHVELNTNSKIFSPTSAHFGNDQNANTNVIDWSFPGVLPVLNKGVVDAGIKAALALNMDI
GATB_STRPI      MNFETVIGLEVHVELNTNSKIFSPTSAHFGNDQNANTNVIDWSFPGVLPVLNKGVVDAGIKAALALNMDI
GATB_STRPS      MNFETVIGLEVHVELNTNSKIFSPTSAHFGNDQNANTNVIDWSFPGVLPVLNKGVVDAGIKAALALNMDL
GATB_STRP7      MNFETVIGLEVHVELNTNSKIFSPTSAHFGNDQNANTNVIDWSFPGVLPVLNKGVVDAGIKAALALNMDL
GATB_STRPJ      MNFETVIGLEVHVELNTNSKIFSPTSAHFGNDQNANTNVIDWSFPGVLPVLNKGVVDAGIKAALALNMDI
GATB_STRZP      MNFETVIGLEVHVELNTNSKIFSPTSAHFGNDQNANTNVIDWSFPGVLPVLNKGVVDAGIKAALALNMDI
GATB_STRT2      MNFETVIGLEVHVELNTNSKIFSPTSAHFGNEQNTNTNVIDWSFPGVLPVLNKGVVDAGIKAALALNMDI
GATB_STRT1      MNFETVIGLEVHVELNTNSKIFSPTSAHFGNEQNTNTNVIDWSFPGVLPVLNKGVVDAGIKAALALNMDI
GATB_STRTD      MNFETVIGLEVHVELNTNSKIFSPTSAHFGNEQNTNTNVIDWSFPGVLPVLNKGVVDAGIKAALALNMDI
GATB_STRP8      MNFETIIGLEVHVELNTNSKIFSPSSAHFGEDPNANTNVIDWSFPGVLPVMNKGVIDAGIKAALALNMDI
GATB_STRPD      MNFETIIGLEVHVELNTNSKIFSPSSAHFGEDPNANTNVIDWSFPGVLPVMNKGVIDAGIKAALALNMDI
GATB_STRP3      MNFETIIGLEVHVELNTNSKIFSPSSAHFGEDPNANTNVIDWSFPGVLPVMNKGVIDAGIKAALALNMDI
GATB_STRP1      MNFETIIGLEVHVELNTNSKIFSPSSAHFGEDPNANTNVIDWSFPGVLPVMNKGVIDAGIKAALALNMDI
GATB_STRPZ      MNFETIIGLEVHVELNTNSKIFSPSSAHFGEDPNANTNVIDWSFPGVLPVMNKGVIDAGIKAALALNMDI
GATB_STRPM      MNFETIIGLEVHVELNTNSKIFSPSSAHFGEDPNANTNVIDWSFPGVLPVMNKGVIDAGIKAALALNMDI
GATB_STRPC      MNFETIIGLEVHVELNTNSKIFSPSSAHFGEDPNANTNVIDWSFPGVLPVMNKGVIDAGIKAALALNMDI
GATB_STRPB      MNFETIIGLEVHVELNTNSKIFSPSSAHFGEDPNANTNVIDWSFPGVLPVMNKGVIDAGIKAALALNMDI
GATB_STRPG      MNFETIIGLEVHVELNTNSKIFSPSSAHFGEDPNANTNVIDWSFPGVLPVMNKGVIDAGIKAALALNMDI
GATB_STRP6      MNFETIIGLEVHAELNTNSKIFSPSSAHFGEDPNANTNVIDWSFPGVLPVMNKGVIDASIKAALALNMDI
GATB_STRPF      MNFETIIGLEVHVELNTNSKIFSPSSAHFGEDPNANTNVIDWSFPGVLPVMNKGVIDAGIQAALALNMDI
GATB_STRSY      MNFETIIGLEVHVELNTNSKIFSPSSAHFGEDPNANTNVIDWSFPGVLPVLNKGVVDAGIKAALALNMDI
GATB_STRS2      MNFETIIGLEVHVELNTNSKIFSPSSAHFGEDPNANTNVIDWSFPGVLPVLNKGVVDAGIKAALALNMDI
GATB_STRS7      MNFETIIGLEVHVELNTNSKIFSPSSAHFGEDPNASTNVIDWSFPGVLPVMNKGVIDAGIKAALALNMSI
GATB_STREM      MNFETIIGLEVHVELNTNSKIFSPSSAHFGEDPNASTNVIDWSFPGVLPVMNKGVIDAGIKAALALNMSI
GATB_STRU0      MNFETIIGLEVHVELNTNSKIFSPSSAHFGQEANANTNVIDWSFPGVLPVINKGVIDAGIKAALALNMDI
GATB_STRE4      MNFETIIGLEVHVELNTNSKIFSPSSAHFGEDPNASTNVIDWSFPGVLPVMNKGVIDAGIKAALALNMSI
GATB_STRA3      MNFETVIGLEVHVELNTNSKIFSPSSAHFGQEQNANTNVIDWSFPGVLPVMNKGVVDAGIKAALALNMDI
GATB_STRA5      MNFETVIGLEVHVELNTNSKIFSPSSAHFGQEQNANTNVIDWSFPGVLPVMNKGVIDAGIKAALALNMDI
GATB_STRA1      MNFETVIGLEVHVELNTNSKIFSPSSAHFGQEQNANTNVIDWSFPGVLPVMNKGVIDAGIKAALALNMDI
GATB_STRGC      MNFETVIGLEVHVELKTNSKIFSPAPAHFGEDPNANTNIIDWSFPGVLPVMNKGVIDYGIKAALALNMDI
GATB_STRSV      MNFETVIGLEVHVELKTNSKIFSPAPAHFGEDPNANTNIIDWSFPGVLPVMNKGVIDYGIKAALALNMDI
GATB_STRMU      MNFETIIGLEVHVELKTNSKIFSPAPAHFGEDPNANTNIVDWSFPGVLPVMNKGVIDYGIKAALALNMDI
GATB_LACLM      MNFETVIGLEVHVELSTNSKIFSPASTKFGGDPNSNTNVIDWSLPGVLPVMNKGVIDSGIKAALALNMDI
GATB_LACLS      MNFETVIGLEVHVELSTNSKIFSPASTKFGGDPNSNTNVIDWSLPGVLPVMNKGVIDSGIKAALALNMDI
GATB_LACLA      MNFETVIGLEVHVELSTNSKIFSPASTKFGGDPNTNTNVIDWSLPGVLPVMNKGVIDSGIKAALALNMDI
GATB_ENTFA      MNFETVIGLEVHVELKTNSKIFSSAPAHFGAEPNSNTNVVDWSYPGVLPVMNKGALEFGMKAALALNCEI
GATB_OCEIH      MNFETIIGLEVHVELKTNSKIFSPSTNEFGSDPNTNVNPIDLGYPGTLPVLNEEAVNFAMKAAMALNCEI
GATB_LYSSC      MNFETVIGLEVHVELKTNSKIFSPAPAHFGAEPNTNTTVIDLGYPGVLPVLNKNVVDFAMRAALALNMEI
GATB_BACA2      MNFETVIGLEVHVELKTKSKIFSSSPTPFGAEANTQTSVIDLGYPGVLPVLNKEAVEFAMKAAMALNCEI
GATB_BACP2      MNFETVIGLEVHVELKTQSKIFSSSPTPFGAAANTQTSVIDLGYPGVLPVLNKEAVNFAMKAAMALNCEI
GATB_BACLD      MNFETVIGLEVHVELKTKSKIFSSSPTPFGAAANTQTSVIDLGYPGVLPVLNKEAVNFAMKAAMALNCEI
GATB_BACSK      MNFETIIGLEVHVELKTDSKIFSSSPNHFGAEPNTNTSVIDLGYPGVLPVLNKRAVDFAMKAAMALNCQI
GATB_BACSU      MNFETVIGLEVHVELKTKSKIFSSSPTPFGAEANTQTSVIDLGYPGVLPVLNKEAVEFAMKAAMALNCEI
GATB_LACS1      MNFETTVGLEVHIEMQTNSKAYSPSPVQYGAEQNTNTNVIDWGYPGVLPEINKGALEFGMRAALALHCDI
GATB_BACCN      MNFETIIGLEVHVELKTNSKIFSASPTEFGADPNTQTSVIDLGYPGVLPTLNKEAVNFAMKAAMALNCEI
GATB_LISMF      MNFETVIGLEVHVELKTNSKIFSSAPAHFGAEPNTNTTVVDLGMPGVLPVLNKRAVEFGMKAAMAINCEI
GATB_LISMC      MNFETVIGLEVHVELKTNSKIFSSAPAHFGAEPNTNTTVVDLGMPGVLPVLNKRAVEFGMKAAMAINCEI
GATB_MACCJ      MHFETVIGLEVHVELKTESKMFSASPAHFGAEPNTNVNVVDLGYPGVLPVVNKTAVDWAMRAAMALNMDI
GATB_LACBA      MNFETTIGLEVHIELKTHSKIFSPSPVAYGADPNANTNVIDWGYPGVLPTTNKGVVADGIIAALALHATV
GATB_LISMH      MNFETVIGLEVHVELKTNSKIFSSAPAHFGAEPNTNTTVVDLGMPGVLPVLNKRAVEFGMKAAMAINCEI
GATB_BACHD      MNFETVIGLEVHVELKTESKIFSASPNHFGAEPNANTSVIDLGYPGVLPVLNXXXXXXXXXXXXXLNCEV
GATB_GEOKA      MNFETVIGLEVHVELKTKSKIFSSSPNAFGAPPNTQTNVIDLGYPGVLPVLNRQAVEFAMKAAMALNCEI
GATB_LISMO      MNFETVIGLEVHVELKTNSKIFSSAPAHFGAEPNTNTTVVDLGMPGVLPVLNKRAVEFGMKAAMAINCEI
GATB_BACWK      MNLETIIGLEVHVELKTNSKIFSASPTEFGAEPNTQTSVIDLGYPGVLPTLNKEAVNFAMKAAMALNCEI
GATB_BACC4      MNLETIIGLEVHVELKTNSKIFSASPTEFGAEPNTQTSVIDLGYPGVLPTLNKEAVNFAMKAAMALNCDI
GATB_LISIN      MNFETVIGLEVHVELKTNSKIFSSAPAHFGAEPNTNTTVVDLGMPGVLPVLNKRAVEYGMKAAMAINCEI
GATB_LACSS      MNFETTIGLEVHIELKTNSKMYSPSPVNYGAEPNTNTNVIDWGYPGTLPTLNKGAYTLGMMVATALHADI
GATB_LACRJ      MNFQTTIGLEVHVELKTNSKIYSPSPVEYGDQPNANTNVIDWGYPGVLPSLNKGVVRDGIMAGLALHAQI
GATB_LACRD      MNFQTTIGLEVHVELKTNSKIYSPSPVEYGDQPNANTNVIDWGYPGVLPSLNKGVVRDGIMAGLALHAQI
GATB_BACC7      MNLETIIGLEVHVELKTNSKIFSASPTEFGAEPNTQTSVIDLGYPGVLPTLNKEAVNFAMKAAMALNCEI
GATB_BACC1      MNLETIIGLEVHVELKTNSKIFSASPTEFGAEPNTQTSVIDLGYPGVLPTLNKEAVNFAMKAAMALNCEI
GATB_BACC3      MNLETIIGLEVHVELKTNSKIFSASPTEFGAEPNTQTSVIDLGYPGVLPTLNKEAVNFAMKAAMALNCEI
GATB_BACC0      MNLETIIGLEVHVELKTNSKIFSASPTEFGAEPNTQTSVIDLGYPGVLPTLNKEAVNFAMKAAMALNCEI
GATB_BACAN      MNLETIIGLEVHVELKTNSKIFSASPTEFGAEPNTQTSVIDLGYPGVLPTLNKEAVNFAMKAAMALNCEI
GATB_BACAH      MNLETIIGLEVHVELKTNSKIFSASPTEFGAEPNTQTSVIDLGYPGVLPTLNKEAVNFAMKAAMALNCEI
GATB_BACAC      MNLETIIGLEVHVELKTNSKIFSASPTEFGAEPNTQTSVIDLGYPGVLPTLNKEAVNFAMKAAMALNCEI
GATB_BACAA      MNLETIIGLEVHVELKTNSKIFSASPTEFGAEPNTQTSVIDLGYPGVLPTLNKEAVNFAMKAAMALNCEI
GATB_GEOTN      MNFETVIGLEVHVELKTKSKIFSSSPNAFGAPPNTQTNVIDLGYPGVLPVLNRQAVEFAMKAAMALNCEI
GATB_BACHK      MNLETIIGLEVHVELKTNSKIFSASPTEFGAEPNTQTSVIDLGYPGVLPTLNKEAVNFAMKAAMALNCEI
GATB_BACCZ      MNLETIIGLEVHVELKTNSKIFSASPTEFGAEPNTQTSVIDLGYPGVLPTLNKEAVNFAMKAAMALNCEI
GATB_BACCR      MNLETIIGLEVHVELKTNSKIFSASPTEFGAEPNTQTSVIDLGYPGVLPTLNKEAVNFAMKAAMALNCEI
GATB_BACCQ      MNLETIIGLEVHVELKTNSKIFSASPTEFGAEPNTQTSVIDLGYPGVLPTLNKEAVNFAMKAAMALNCEI
GATB_STAHJ      MHFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNRRAVDWAMRASMALNMDI
GATB_LACCB      MNFETTIGLEVHVELKTKSKMFSPSPVTYGQEPNTQTNVIDWGFPGVLPSINRGAYQLGIMVGLALHADI
GATB_LISW6      MNFETVIGLEVHVELKTNSKIFSSAPAHFGAEPNTNTTVVDLGMPGVLPVLNKRAVEYGMKAAMAINCEI
GATB_BACC2      MNLETIIGLEVHVELKTNSKIFSASPTEFGAEPNTQTSVIDLGYPGVLPTLNKEAVNFAMKAAMALNCEI
GATB_LACC3      MNFETTIGLEVHVELKTKSKMFSPSPVTYGQEPNTQTNVIDWGFPGVLPSINRGAYQLGIMVGLALHADI
GATB_STAAU      MHFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRAAMALNMEI
GATB_STAAR      MHFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRAAMALNMEI
GATB_STAS1      MHFETVIGLEVHVELKTDSKMFSPAPAHFGAKPNSNTNVIDLAYPGVLPVVNRRAVDWAMRASMALNMEI
GATB_STAES      MHFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNRRAVDWAMRASMALNMDI
GATB_STAEQ      MHFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNRRAVDWAMRASMALNMDI
GATB_STAAW      MHFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRAAMALNMEI
GATB_STAAT      MHFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRAAMALNMEI
GATB_STAAS      MHFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRAAMALNMEI
GATB_STAAN      MHFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRAAMALNMEI
GATB_STAAM      MHFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRAAMALNMEI
GATB_STAAE      MHFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRAAMALNMEI
GATB_STAAC      MHFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRAAMALNMEI
GATB_STAA9      MHFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRAAMALNMEI
GATB_STAA8      MHFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRAAMALNMEI
GATB_STAA3      MHFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRAAMALNMEI
GATB_STAA2      MHFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRAAMALNMEI
GATB_STAA1      MHFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRAAMALNMEI
GATB_LACPL      MNFVTTIGLEVHVELKTNSKIFSPSPVQFGSEPNANTNVIDWGYPGVLPTPNKGVVEAGIKAATALHAEI
GATB_BACST      MNYETVIGLEVHVELKTKSKIFSSSPNAFGAPPNTQTNVIDLGYPGVLPVLNRQAVEFAMKAAMALNCEI
GATB_STAAB      MHFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRAAMALNMEI
GATB_STASP      MHFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNRRAVDWAMRASMALNMDI
GATB_STACT      MHFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNRRAVDWAMRASMALNMEI
GATB_LACF3      MNFETTIGLEVHVELKTNSKIFSPSPVNFGAAPNANTNVIDWGYPGVLPSINKGVVRDGIMAALALHAEV
GATB_PEDPA      MNFKTTIGLEVHIELKTNSKIFSPSPVEFGDQPNANTNVIDWGYPGVLPQTNKGVVEAGMMAAKALHANI
GATB_LACJO      MNFKSTIGLEVHFELKTKSKIFSPSPVSYGAEANTETNVIDWAMPGVLPRLNKDVYRLGIMVALATHSHV
GATB_LACGA      MNFKSTIGLEVHFELKTKSKIFSPSPVTYGAEANTETNVIDWAMPGVLPRLNKDVYRLGIMVALATHSHI
GATB_LACAC      MNFKSTIGLEVHFELKTKSKIFSPSPVTYGAEQNTETNVIDWAMPGTLPMVNKNVYRLGIMVALATHSHI
GATB_LACH4      MNFKSTIGLEVHFELKTKSKIFSPSPVTYGAEQNTETNVIDWAMPGTLPMVNKNVYRLGIMVAIATHAHI
GATB_BREBN      --YETVIGLEVHAELSTNSKIFCGCPTEFGAPPNTHTCPICLGHPGVLPVTNKQAVEFAMKAALALNCEI
GATB_OENOB      -SFETTIGLEVHVELKTKSKAFSLSPVNFGDPANENTNVIDWGYPGVLPSANKGALESGMMAALALNAQI
GATB_LACDB      MNFTSTIGLEVHFELKTKSKIFSPSPVTYGAKPNTETNVIDWGYPGTLPMVNKEVYRLGLMVALATHSHV
GATB_LACDA      MNFTSTIGLEVHFELKTKSKIFSPSPVTYGAKPNTETNVIDWGYPGTLPMVNKEVYRLGLMVALATHSHV
GATB_THEP3      MKYEAVIGLEVHAELLTESKIFCSCTTKFGGEPNTHVCPVCLGLPGTLPVLNKKVVEYAVRAGLALNCTI
GATB_THEPX      MKYEAVIGLEVHAELLTESKIFCGCTTKFGGEPNTHVCPVCLGLPGTLPVLNKKVVEYAVRAGLALNCTI
GATB_THETN      MKYEAVIGLEVHAELLTDSKIFCGCSTKFGSEPNTQVCPVCLGLPGTLPVLNKKVVEYAVRAGLALNCTI
GATB_TRIEI      --YEAIIGLETHCQLSTQTKIFSNSSTEFGATPNTNIDPICMGMPGVLPVLNEKVLEYAVKAGLALNCEI
GATB_CARHZ      --YEAVIGLEVHVELKTNTKIFCNCSTEFGGDPNSHXXXXXXXXXXXXXXXNKKVVDYAIKAALALNCEV
GATB_CLOBK      MDFEAVIGLEVHAELSTNTKIYCGCTTEFGGQPNTHVCPICLGLPGSLPQLNKRVVEYGIKAGLALNCSI
GATB_CLOBH      MDFEAVIGLEVHAELSTNTKIYCGCTTEFGGQPNTHVCPICLGLPGSLPQLNKRVVEYGIKAGLALNCSI
GATB_CLOB1      MDFEAVIGLEVHAELSTNTKIYCGCTTEFGGQPNTHVCPICLGLPGSLPQLNKRVVEYGIKAGLALNCSI
GATB_CLOBM      MDFEAVIGLEVHAELSTNTKIYCGCTTEFGGQPNTHVCPICLGLPGSLPQLNKRVVEYGIKAGLALNCSI
GATB_CLOB6      MDFEAVIGLEVHAELSTNTKIYCGCTTEFGGQPNTHVCPICLGLPGSLPQLNKRVVEYGIKAGLALNCSI
GATB_CALS8      MEYEVVIGLEVHAELATKSKIFCSCTTEFGGEPNTHCCPICTGMPGVLPVLNKKAVEYAIMAGLATNCQI
GATB_CLOBL      MDFEAVIGLEVHAELSTNTKIYCGCTTEFGGQPNTHVCPICLGLPGSLPQLNKRVVEYGIKAGLALNCSI
GATB_CLOBJ      MDFEAVIGLEVHAELSTNTKIYCGCTTEFGGQPNTHVCPICLGLPGSLPQLNKRVVEYGIKAGLALNCSI
GATB_ANATD      MEYEVVIGLEVHAELATKSKIFCSCTTEFGGEPNTHCCPICTGMPGVLPVLNKKAVEYAIMAGLATNCQI
GATB_SYNJB      VQYEAVIGLEVHCQLSTRSKIFSSSATAFGAPPNTQIDPICMGLPGTLPVLNEKVLEYAVKAGLALNCTI
GATB_MOOTA      MEYEAVIGLEVHAELKTASKAFCSCSTAFGGEPNTHVCPVCLGLPGVLPVINRQVVEFGLKTALALNCRV
GATB_CLOTE      MDFESVIGLEVHAELSTKTKIYCGCTTEFGGKPNTHVCPVCLGLPGSLPQLNKKVVDYAIKAGLALNCEI
GATB1_CLOAB     MEYEIVIGLEVHAELATKTKMYCGCTAEFGGQPNTHVCPVCMGLPGALPHINKRAVDYGIKAGLALNCSI
GATB_PERMH      MEFEPVIGLEVHVQMSTNTKCFCSCKIEFGAEPNTNVCPVCLGMPGSLPVLNKKALEYAIKASLALNCEV
GATB_PELTS      --YEAVIGLEVHVELKTRSKIFCDSTTEFGGDPNTHXXXXXXXXXXXXXXXNKKVVEYAIRAALALNCQI
GATB_PROMA      VDWEPVIGLETHVQLGTNSKIFTSASTSFGDDPNTHIDPIVCGLPGTLPVLNKKVLEFAVKASMALNLKI
GATB_CYAP7      --YEAIIGLETHCQLNTHSKIFCNCSTKFDSPPNTNVCPICLGYPGVLPVLNLEVLASAVKMGLAINGKI
GATB_SYMTH      --WETVIGLEVHVELSTETKIWCGCKNEFGAEPNTNVCPVCLALPGALPVLNYKAVEYTIRAGLALNCKI
GATB2_SYNAS     MEYEPVIGLEVHAQLLTESKIFCGCSTKFGAAPNSHTCPVCLGMPGVLPVLNKKVVEFGMKMALATHCRI
GATB_THEYD      MQYEAVIGLEVHAQLLTESKIFCGCSTQFGAEPNTQVCPVCLGMPGVLPVLNKKAVEYTVKTGLAMNCKI
GATB_GEOUR      MKYQVVIGLEVHVQLLTNSKIFCGCSTRFGAEPNSQTCPVCLGMPGALPVLNKKVVEYAIRAGLATNCRI
GATB_GEOSM      MKYQVVIGLEVHTQLTTNTKIFCGCSTRFGAEPNSQTCPVCLGLPGALPVLNRQVVEYAIRAGLATNCSI
GATB_GEOSF      MEYRAVIGLEVHVQLNTNTKIFCGCSTKFGAEPNSQTCPVCLGMPGALPVLNRKVVEYAIKAGLATNCEI
GATB_CLOBA      MEFESVIGLEVHAELLTNTKIYCGCTTEFGGKPNTHVCPVCLGLPGSLPQLNKRVLELGIKAGLALNCEI
GATB_SYNJA      VEYEAVIGLEVHCQLSTRSKIFSSSATAFGAPPNTQIDPVCMGLPGTLPVLNEKVLEYAVKAGLALNCTI
GATB_CLOBB      MEFESVIGLEVHAELLTNTKIYCGCTTEFGGKPNTHVCPVCLGLPGSLPQLNKRVLELGIKAGLALNCKI
GATB_ANASP      --YEAIIGLETHCQLSTNTKIFSSSSTAFGADPNTNIDPVCMGLPGVLPVLNEKVLEYAVKAGLALNCQI
GATB_LEPIN      --FETIIGLEVHAQLNTESKIFSTSATKFGSPPNSQTNPVCLGLPGALPVLNEFALEKAIMAGLAFGCDI
GATB_SYNY3      -DYEAIIGLETHCQLNTASKIFCNCSTDFDSPPNTNVCPVCLGYPGVLPVLNEEVLAAAVKLGLAINGQI
GATB_LEPIC      --FETIIGLEVHAQLNTESKIFSTSATKFGSPPNSQTNPVCLGLPGALPVLNEFALEKAIMAGLAFGCDI
GATB_GEOBB      MKYQVVIGLEVHTQLTTNTKIFCGCSTRFGAEPNSQTCPVCLGLPGALPVLNQQVVEYAIRAGLATNCSI
GATB_PELCD      --YEVVIGLEVHVQLTTQTKIFCNCSIAFGNQPNSQTCPVCLGLPGALPVLNRKVVEYAIKTGLATNCSI
GATB_PSEU2      MQWEVVIGLEIHTQLSTQSKIFSGSATTFGSEPNTQASLVDLGMPGVLPVLNKEAVRMAVKFGLAVNAEI
GATB_LEPBL      --FETIIGLEVHAQLNTESKIFSTSATKFGSPPNSQTNPVCLGLPGALPVLNESALEKAIMAGIAFGCDI
GATB_LEPBJ      --FETIIGLEVHAQLNTESKIFSTSATKFGSPPNSQTNPVCLGLPGALPVLNESALEKAIMAGIAFGCDI
GATB_PSESM      MQWEVVIGLEIHTQLSTQSKIFSGSATTFGSEPNTQACLVDLGMPGVLPVLNKEAVRMAVKFGLAVDAEI
GATB_CYAA5      --YEAIIGLETHCQLNTTSKIFCNCSTEFDSPPNTNVCPICLGYPGVLPVLNEEVLASAVKLGLALNAKI
GATB_PSE14      MQWEVVIGLEIHTQLSTQSKIFSGSATTFGSEPNTQASLVDLGMPGVLPVLNKEAVRMAVKFGLAVDAEI
GATB_SYNPW      --WEAVIGLETHVQLGTNSKIFTAASTAFGDDPNTHIDPVVCGLPGTLPVLNQKVLEYAVKAAMALNLNI
GATB_ANAVT      --YEAIIGLETHCQLSTNTKIFSSSSTAFGADPNTNIDPVCMGLPGVLPVLNEKVLEYAVKAGLALNCQI
GATB_SYNPX      --WEAVIGLETHVQLGTDSKIFTAASTAFGDDPNTHIDPVVCGLPGTLPVLNQKVLEYAVKAAMALNLNI
GATB_PSEU5      MQWETVIGLEIHAQLSTQSKIFSGSATTFGAEPNTQASLVDLGMPGTLPVLNAEAVRMACKFGLAIDAEI
GATB_PROM1      VSWEVVIGLETHVQLGTKSKIFTSASTTFGDDPNTHIDPVVCGLPGTLPVLNKKVLEYAVKAAMALNLNI
GATB_PELPD      MKYQAVIGLEVHVQLKTDSKIFCGCSTSFGSDPNSQTCPVCLGLPGALPVLNKKVVEFAIKAGLATNCSI
GATB_NEIMA      MTWETVIGLEIHVQLNTKSKIFSGASTAFGAEPNAHAGVVECALPGVLPVMNREVVEKAIKLGLALDAKI
GATB_DESMR      --YETVIGVEVHAQLKTKSKIFCSCSTRFGVDPNENVCPVCSGMPGVLPVLNATVVEYAAKMGLATGCVV
GATB_PROMT      VSWEVVIGLETHVQLGTKSKIFTSASTTFGDDPNTHIDPVVCGLPGTLPVLNKKVLEYAVKAAMALNLNI
GATB_COXB2      MEWEPVIGLEVHVQLRTQSKIFSGAATAYGAEPNTQACAIDLGLPGVLPVLNKEAVKLAVCFGLSVNASI
GATB_CLONN      MNYEAIIGLEVHCELLTKTKAFCGCSTEFGAKPNTHVCPICLGLPGALPKLNKKVVEYGMKAGIALNCSI
GATB_HERA2      MKYTATIGLEVHAQILTKSKMFSGCNAAYASPANSCIDEVSIGLPGTLPVVNQEAIRKAALLGLALNCEI
GATB_PROM9      -SWEAVIGLETHVQLNTKSKIFTSASTAFGDAPNTHIDPVVCGLPGTLPVLNETVLEYAVKTSLALNLNV
GATB_NEIMB      MTWETVIGLEIHVQLNTKSKIFSGASTAFGAEPNAHASVVECALPGVLPVMNREVVEKAIKLGLALDAKI
GATB_COXBR      MEWEPVIGLEVHVQLRTQSKIFSGAATAYGAEPNTQACAIDLGLPGVLPVLNKEAVKLAVCFGLSVNASI
GATB_COXBN      MEWEPVIGLEVHVQLRTQSKIFSGAATAYGAEPNTQACAIDLGLPGVLPVLNKEAVKLAVCFGLSVNASI
GATB_COXB1      MEWEPVIGLEVHVQLRTQSKIFSGAATAYGAEPNTQACAIDLGLPGVLPVLNKEAVKLAVCFGLSVNASI
GATB_PSEMY      MQWETVIGLEIHAQLSTQSKIFSASATSFGAEPNTQASLIDLGMPGTLPVLNAEAVRMAVKFGLAIDAHI
GATB_DESPS      MEFETVIGLEIHAQLKTNTKIFCACSTQYGAAPNSHTCPICLGMPGVLPVLNKKVVEYSIKMGLATGSRI
GATB_DESDG      --YEVVIGLEVHAQLRTSSKLFCACSTEFGSEPNTNVCEICSGMPGVLPVVNRKAVEYAVMMGMAVDCTI
GATB_NEIG2      MTWETVIGLEIHVQLNTKSKIFSGASTAFGAEPNAHASVVECALPGVLPVMNREVVEKAIKLGLALDAKI
GATB_NEIG1      MTWETVIGLEIHVQLNTKSKIFSGASTAFGAEPNAHASVVECALPGVLPVMNREVVEKAIKLGLALDAKI
GATB_SYNE7      --YEAVIGLETHVQLGTATKIFSNASTEFGADPNTHIDXXXXXXXXXXXXXNQKVLEYAVKAGLALNCQI
GATB_THISH      MEWETVIGLEVHAQLATKSKIFSGASTAYGAAPNSQACAIDLGLPGVLPVLNREAVRMAVKFGLAIGAEI
GATB_EUBE2      -DYEVVIGLEVHVELATKTKIFCGCSTEFGGAPNSHTCPVCTGMPGSLPVLNKKVVEYAAAVGLATNCTI
GATB_GEOLS      MRFQPVIGLEVHVQLKTDSKIFCGCSTRFGAEPNLNTCPVCLALPGALPVLNQKVVEFAIMAGLATNCSI
GATB_COXBU      MEWEPVIGLEVHVQLRTQSKIFSGAATAYGAEPNTQACAIDLGLPGVLPVLNKEAVKLAVCFGLSVNASI
GATB_CHLT3      MNYEIVIGLEVHCQLNTQTKAFCGCSTAFGAPANTNVCPVCLAMPGTLPVLNQKVLESAIKLGLATNCKI
GATB_CYAP8      --YEAIIGLETHCQLNTNSKIFCACSTNFDSPPNTNICPICLGYPGVLPVLNEEVLASAVKLGLAINGKI
GATB_CLOPH      --YETVIGLEVHVELATKSKIFCGCTTQFGGEVNAHCCPICMGMPGTLPVLNKKVVEFAIAAGLAMNCDI
GATB_NEIM0      MTWETVIGLEIHVQLNTKSKIFSGASTAFGAEPNAHASVVECALPGVLPVMNREVVEKAIKLGLALDAKI
GATB_SYNS9      --WEAVIGLETHVQLGTDSKIFTAASTTFGDEPNTHIDPVVCGLPGTLPVLNQKVLEYAVKAAMALNLNI
GATB_PSEFS      MQWEVVIGLEIHTQLATQSKIFSGSATTFGSEPNTQASLVDLGMPGVLPVLNQEAVRMAVMFGLAIDAEI
GATB_PSEAB      MQWETVIGLEIHAQLATQSKIFSGSSTAFGAAPNTQASLVDLAMPGTLPVLNEEAVRMACLFGLAIDARI
GATB_SYNP6      --YEAVIGLETHVQLGTATKIFSNASTEFGADPNTHIDXXXXXXXXXXXXXNQKVLEYAVKAGLALNCQI
GATB_PSEAE      MQWETVIGLEIHAQLATQSKIFSGSSTAFGAAPNTQASLVDLAMPGTLPVLNEEAVRMACLFGLAIDARI
GATB_PSEA8      MQWETVIGLEIHAQLATQSKIFSGSSTAFGAAPNTQASLVDLAMPGTLPVLNEEAVRMACLFGLAIDARI
GATB_NOSP7      --YEAIIGLETHCQLSTKTKIFSNSSTAFGADPNTNIDPVCMGLPGVLPVLNEKVLEYAVKTGLALNCQI
GATB_PROA2      MSYELVVGLEVHCQLNTNSKAFCGCSTEFGKPANTNVCPVCLALPGALPVLNQRVVDDAIKLGMSTGCSI
GATB_PSEPF      MQWEVVIGLEIHTQLTTRSKIFSGSSTQFGSEPNTQASLIDLGMPGVLPVLNQEAVRMAVMFGLAIDAEI
GATB_CHLPB      MSYELVVGLEVHCQLNTNSKAFCGCSTEFGKPANTNVCPVCLALPGALPVLNRRVVEDAVKLGLATDCTV
GATB_SYNP2      --YEAIIGLETHCQLNTASKIFCHCSTKFDSDPNSNVCPVCLGYPGVLPVLNEKVLESAVKMGLALKAKI
GATB_BRAHW      MEYEAVIGLEVHVQLNTKTKAFCSCPNTFGAPANTLTCPRCQAHPGTLPIVNKEMVHKTIKAGLATNCTI
GATB_PSEF5      MQWEVVIGLEIHTQLTTQSKIFSGSSTAFGAEPNTQASLIDLGMPGVLPVLNQEAVRMAVMFGLAVDAEI
GATB_PROM5      --WEAVIGLETHVQLNTKSKIFTSASTAFGDEPNTHVDPVVCGLPGTLPVLNETVLEYAVKTSLALNLNV
GATB_DESVV      -SYEAVIGLEVHAQLRTRSKLFCSCSTAFGADPNAHVCEVCAGMPGVLPVLNEKAVEFAARMGIAVGCTV
GATB_DESVH      -SYEAVIGLEVHAQLRTRSKLFCSCSTAFGADPNAHVCEVCAGMPGVLPVLNEKAVEFAARMGIAVGCTV
GATB_NITEU      MQWETVIGLEIHAQLSTRSKIFSGASVAYGAEPNSQACAVDIALPGVLPVLNRQAIEYAIRFGLAIDATI
GATB_ALHEH      MEWETVIGLEIHAQLATKSKIFSGAATAYGAEPNRQACAVDLGMPGVLPVLNKGAVRMATKFGLAIGAKI
GATB_PSEA7      MQWETVIGLEIHAQLATQSKIFSGSPTAFGAAPNTQASLVDLAMPGTLPVLNEEAVRMACLFGLAIDARI
GATB_DESAA      MEFEAVIGLEVHAQLKTESKIFCGCSTAFGASPNTHTCPVCLGMPGSLPVLNKKVVDYAMRMALATQCSI
GATB_PROMP      --WEAVIGLETHVQLNTKSKIFTAASTAFGDEPNTHIDPVVCGLPGTLPVLNKTVLEYAVKTSLALNLNV
GATB_UNCTG      -DYETVVGLEVHMQINTKSKVFCECSTRFGAEPNSNTCIICTSQPGAIPILNKKAVEAVVKTGLALNFSI
GATB_SYNSC      --WEAVIGLETHVQLGTDSKIFTAASTTFGDEPNTHIDPVVCGLPGTLPVLNQKVLEYAVKAAMALNLNI
GATB_THEEB      LTYEAVIGLEIHCQLSTQTKIFSSSSTQFGAPPNTNIDPVCLGLPGTLPVLNEKVLEYAVKAGLALNCQI
GATB_METFK      MSWEVVIGLETHVQLNTRSKIFSGSSTAFGAEPNTQANVVDVALPGVLPVLNKEAVQCAIRFGLAVNAEI
GATB_GEOSL      MNYQAVIGLEVHVQLKTDTKIFCGCSTTFGASPNSQTCPVCLGMPGVLPVLNKKVVEFAIRAGLATNCRI
GATB_GEOMG      MNYQAVIGLEVHVQLKTDTKIFCGCSTQFGASPNSQTCPVCLGMPGALPVLNRKVVEFAIKAGLATNCRI
GATB_DESVM      --YEAVIGLEVHAQLRTRSKLFCSCSTAFGSAPNTNVCEVCSGMPGVLPVPNARAVEYAARMGMAVNCTV
GATB_NEIMF      MTWETVIGLEIHVQLNTKSKIFSGASTAFGAEPNAHASVVECALPGVLPVMNREVVEKAIKLGLALDAKI
GATB_EUBR3      -NYETVIGLEVHVELATKTKIFCACSTAFGGAPNTHTCPVCTGQPGSLPVLNKQVVEYAVAVGLATNCTI
GATB_PROMM      --WEAVIGLETHVQLGTNSKIFTCASTTFGDDPNTHIDPVVCGLPGTLPVLNQMVLEYAVKAAMALNLNI
GATB_LEPBP      MEYEVIIGLEVHVQLNTNSKIFSTATNEFGGSPNTHISPLCVALPGTLPVLNEVVLEKAVRAGVALGCEI
GATB_LEPBA      MEYEVIIGLEVHVQLNTNSKIFSTATNEFGGSPNTHISPLCVALPGTLPVLNEVVLEKAVRAGVALGCEI
GATB_PSEPW      MQWEVVIGLEIHTQLATQSKIFSGSATTFGSEPNTQASLVDLGMPGVLPVLNQEAVRMACMFGLAIDAQI
GATB_HALHL      MKWETVIGLEIHAQLATRTKIFSGAPTAYGAEPNTQACPVDXXXXXXXXXXNREVVRMAIKFGLAVDARI
GATB_CHLCH      MDYELVVGLEVHCQLNTVTKAFCGCSAQFGKAANTNVCPVCLALPGALPVLNRQVVEDAVKIGLALDCRI
GATB_THICR      MTWEVVIGLEIHAQLTTKTKIFSGSSIDYGAAPNTQANLLDLGMPGQLPVLNKAVIPKAIKLGLALGAKI
GATB_PROM3      --WEAVIGLETHVQLGTNSKIFTCASTTFGDDPNTHIDPVVCGLPGTLPVLNQMVLEYAVKAAMALNLNI
GATB_CLOK5      MEFEAVIGLEVHVELLTETKIYCGCSTAFGSEPNKHVCPVCLGLPGSLPRLNKKVVEYAIKAGLALNCSI
GATB_CLOK1      MEFEAVIGLEVHVELLTETKIYCGCSTAFGSEPNKHVCPVCLGLPGSLPRLNKKVVEYAIKAGLALNCSI
GATB_BDEBA      --YEAVIGIEIHVQLSTKTKIFSSESTAFEAGDNENTSPVSVGMPGTLPVLNSKVVEYSIKTGLALGCDI
GATB_METCA      MEWETVIGLEIHAQLATRSKIFSGAPTAYGAEPNTQACAIDLGLPGVLPVLNREAVRMAVKFGLAIGAEI
GATB_NITMU      MQWETVIGLEVHAQLSTESKIFSGASTAFGAAPNAEACAVDLALPGVLPVLNRGAVERAIRFGLAVGAKI
GATB_GLOVI      VQYEAVIGLEVHVQLSTETKLFCRCSTRFGNTPNTNICPICTGQPGTLPVLNQQALDYAVLTASALNCQI
GATB_CELJU      MQWETVIGLEVHVQLATKTKIFSGASTAFGAEPNTQACAIDLALPGTLPTPNAEAFRFATMFGLAVNAEI
GATB_RHOCS      --WEIVIGLEVHAQVISNAKLFSGAATAFGAAPNSQVSFVDAAFPGMLPVINEVCVEQAVKTGLGLKAQI
GATB_NITOC      MQWEPVIGLEIHAQLATKSKIFSGAATAYGAPPNTQACAVDXXXXXXXXXXNQAVVRMAVKFGLAIEAKI
GATB_CHLL2      MKYELVVGLEVHCQLNTNSKAFCGCSTRFGNPANTNVCPVCLALPGALPVLNRRVVEDAVKLGLATGCSI
GATB_PSEPK      MQWEVVIGLEIHTQLATQSKIFSGSATTFGSEPNTQASLVDLGMPGVLPVLNEQAVRMACMFGLAIDAEI
GATB_PSEP1      MQWEVVIGLEIHTQLATQSKIFSGSATTFGSEPNTQASLVDLGMPGVLPVLNEEAVRMACMFGLAIDAEI
GATB_PROMS      -SWEAVIGLETHVQLNTKSKIFTSASTAFGDAPNTHIDPVVCGLPGTLPVLNETVLEYAVKTSLALNLNV
GATB_PSEPG      MQWEVVIGLEIHTQLATQSKIFSGSATTFGSEPNTQASLVDLGMPGVLPVLNQEAVRMACMFGLAIDAEI
GATB_PSEE4      MQWEVVIGLEIHTQLATQSKIFSGSATTFGSEPNTQASLVDLGMPGVLPVLNQEAVRMACMFGLAIDAEI
GATB_PELPB      MKYELVVGLEVHCQLNTTSKAFCGCSAKFGKSANTNVCPVCLALPGALPVLNRRVVEDAVKLGLATGCSI
GATB_CHLTE      MNYEIVVGLEVHCQLNTESKAFCGCSAKFGKPANTNVCPVCLALPGALPVLNARVVEDAVKLGLATNCTI
GATB_AZOVD      MQWETVIGLEIHAQLATRSKIFSGSATAFGAEPNTQASLIDLGMPGTLPVLNEETVRMAVRFGLAIEAEI
GATB_MARMS      MNWEVVIGLEIHTQLSTKSKLFSGAAVGFGAEPNTQTTLVDLGMPGALPVFNKEALRMAVMFGHAINAEI
GATB_HAHCH      MEWEAVIGLEVHVQLATKSKIFSGAATTFGAEPNTQACAVDLAMPGMLPVMNEEAVRMAVMFGLAIGAEI
GATB_CHRVO      MKWEVVIGIEVHVQLNTASKIFSGASTAFGAEPNTQASAVELALPGVLPVLNRAVVDKAIRLGLALDANI
GATB_NITEC      MQWETVIGLEIHVQLLTRSKIFSGASVAYGARPNSQACAVDIALPGVLPVLNRQVVEYAIRFGLAINATI
GATB_CHLPD      MKYELVVGLEVHCQLNTNSKAFCGCSALFGKPANTNVCPVCLALPGALPVLNRRVVEDAVKIGLATGCSV
GATB_CHLP8      MNYEIVVGLEVHCQLNTESKAFCGCSATFGKAANTNVCPVCLALPGALPVLNARVVEDAVKLGLATNCTI
GATB_RALME      MQWEVVIGLETHTQLSTASKIFSGTSTAFGAEPNTQASPVDLALPGVLPVLNRGAVERAIQFGLSIGATI
GATB_GLUOX      --WEIVVGLEVHAQVVSEAKLFSGASAEYGGEPNTHVSLVDAGFPGMLPVLNRECVAQAVRTGLGLEAEI
GATB_MAGSA      -DWEIVIGLEVHAQVISKAKLFSGAATEFGAEPNTQVSFIDAGFPGMLPVINEVCVEQAVRTGLGLKAKI
GATB_HERAR      MQWEVVIGLETHTQLTTKTKIFSGSPTRFGAAPNTQTSPVDLALPGALPVMNRSAVERAIQFGLAIGATI
GATB_BURS3      --WEVVIGLETHAQLSTVSKIFSGASTQFGAEPNTQACPVDLALPGVLPVLNRGAVERAIRFGLAIGSTI
GATB_BURPP      --WEVVIGLETHAQLSTQSKIFSGTATQFGAAPNTQASPVDLALPGTLPVMNRGAVERAIQFGLAIGATV
GATB_MORCA      --YEVVIGIEIHCQLNTDSKIFSNAPTVFGQEPNTQATIVDLGFPGVLPVLNAGVIERALKFGMGVNAKL
GATB_THIDA      MKWETVIGLEVHTQLATQSKIFSASSTAFGAAPNTQASAVDIALPGVLPVLNKAAVECAIKFGLAIGATL
GATB_SACD2      MEWETVIGLEVHVQLATKTKIFSGASTAFGAEPNTQACAIDLAMPGTLPSPNAKAFEYAIMFGLAVNAEI
GATB_CLOB8      MNFETVIGLEIHAELKSKTKIFCSCSTKFGAEPNANTCPICTGVPGTLPVLNEEVVNLAIKAGTALGCTI
GATB_BURP6      --WEVVIGLETHAQLSTVSKIFSGASTQFGAQPNTQACPVDLALPGVLPVLNRGAVERAIRFGLAIGATV
GATB_BURP1      --WEVVIGLETHAQLSTVSKIFSGASTQFGAQPNTQACPVDLALPGVLPVLNRGAVERAIRFGLAIGATV
GATB_BURP0      --WEVVIGLETHAQLSTVSKIFSGASTQFGAQPNTQACPVDLALPGVLPVLNRGAVERAIRFGLAIGATV
GATB_BURPS      --WEVVIGLETHAQLSTVSKIFSGASTQFGAQPNTQACPVDLALPGVLPVLNRGAVERAIRFGLAIGATV
GATB_BURMS      --WEVVIGLETHAQLSTVSKIFSGASTQFGAQPNTQACPVDLALPGVLPVLNRGAVERAIRFGLAIGATV
GATB_BURMA      --WEVVIGLETHAQLSTVSKIFSGASTQFGAQPNTQACPVDLALPGVLPVLNRGAVERAIRFGLAIGATV
GATB_BURM9      --WEVVIGLETHAQLSTVSKIFSGASTQFGAQPNTQACPVDLALPGVLPVLNRGAVERAIRFGLAIGATV
GATB_BURM7      --WEVVIGLETHAQLSTVSKIFSGASTQFGAQPNTQACPVDLALPGVLPVLNRGAVERAIRFGLAIGATV
GATB_AZOSB      -DWEVVIGLEVHAQLNTASKIFSGASTAFGAEPNVQASAVDIALPGVLPVLNRGAVERAIRFGLAIGATV
GATB_RUTMC      MEWETVIGLEIHAQLNTKSKIFSAASTQYGQKPNSQACAVDXXXXXXXXXXNVEVINKAIKFGVAINAHI
GATB_RALEJ      MQWEVVIGLETHTQLSTASKIFSGTSTAFGAEPNTQASPVDLALPGVLPVLNKGAVERAIQFGLAIGATI
GATB_CORDI      --FDPVMGLEVHVELATETKMFSAPSAHFGAEPNSNVDPVSLGLPGALPVVNAKGVEWAIKIGLALNCKI
GATB_DECAR      --WEVVIGIETHAQLSTVSKIFSGASTAFGAEPNTQACAVDLALPGVLPVLNKKAVECAIRFGLAIGAEV
GATB_BURP8      --WEVVIGLETHAQLSTVSKIFSGAATQFGAAPNTQACPVDLALPGVLPVMNKGAVERAIQFGLAIDATI
GATB_BORPE      MNWEIVIGLETHTQLSTDSKIFSGSSTRFGAAPNTQANAVDLALPGSLPVMNRGAAERAILFGLAVGGKV
GATB_PSYCK      --YEVVIGIEIHCQLNTESKIFSSAPTDFGHEPNSQASIVDXXXXXXXXXXNAGVVDRALKFGIGVNAEL
GATB_BURXL      --WEVVIGLETHAQLSTHSKIFSGASTQFGAAPNTQACPVDLALPGTLPVMNRGAVERAIQFGLAIGATV
GATB_BURCH      --WEVVIGLETHAQLSTVSKIFSGASTQFGAEPNTQACPVDLALPGVLPVLNRGAVERAIRFGLAIGSTI
GATB_BURCC      --WEVVIGLETHAQLSTVSKIFSGASTQFGAEPNTQACPVDLALPGVLPVLNRGAVERAIRFGLAIGSTI
GATB_BURCA      --WEVVIGLETHAQLSTVSKIFSGASTQFGAEPNTQACPVDLALPGVLPVLNRGAVERAIRFGLAIGSTI
GATB_ACAM1      --YEAVIGLETHCQLSTKTKIFCNCSTAFGADPNHQVCSICMGMPGVLPVLNETVLEYAVKAGRALNCEI
GATB2_CLOAB     MSYETVIGLEVHAELSTKTKIFCNCSTKFGAKPNENTCPICMGLPGTLPVLNEEVVHLAVKAGEALHCKI
GATB_DESDA      --YEAVIGLEVHVQLATASKLFCSCPTTFGQPPNSNVCEVCSGMPGSLPVPNGQAIHFATLVGLATGCTI
GATB_ARTAT      --YDPVLGFEVHVELNTKTKMFSSAPNVFGDEPNTNVNEVDLGMPGVLPVVNKTAVESSIKIGLALNCKI
GATB_PELLD      MKYELVVGLEVHCQLNTASKAFCSCSAQFGKPANSNVCPVCLALPGALPVLNRRVVEDAVKLGLATGCAI
GATB_METS4      -DWEVVIGMEIHAQVTSRSKLFSGASTAFGAEPNAHVSLVDAAMPGMLPVINRECVAQAVRTGLGLKAQI
GATB_BORA1      MEWEIVIGLETHVQLATESKIFSGSSTRFGAAPNTQANEVDLALPGSLPVMNRGAAERAILFGLAIGAKI
GATB_BORPD      MNWEIVIGLETHTQLSTDAKIFSGSSTRFGAAPNTQANVIDLALPGSLPVMNRGAAERAIRFGLAVGGKV
GATB_JANMA      MQWEVVIGLETHTQLTTQTKIFSGSPTQFGAEPNTQTSPVDLALPGALPVMNRGAVERAIQFGLAIGATI
GATB_AQUAE      --YEAVIGLEIHVQMDTKTKMFCGCKVEFGAEPNTNVCPVCLGMPGALPIVNKRAVEYAIRASLALNCEV
GATB_BURTA      --WEVVIGLETHAQLSTVSKIFSGASTQFGAEPNTQACPVDLALPGVLPVLNRGAVERAIRFGLAIGATV
GATB_SULNB      --FETVIGLEVHVQLNTKTKLFCSCPTSFAEHQNKNTCPTCLALPGALPVVNKEAAIKAMRFGYAVNANV
GATB_MYCMS      -NFEIIIGVENHVELKTNSKMFSPSKVSYGQTPNTLANEIDLAYPGTLPSVNKKGVELAILACNALNMQI
GATB_MYCCT      -NFEIIIGVENHVELKTNSKMFSPSKVSYGEVPNTLANEIDLAYPGTLPSVNKKAVELAVLACNALNMQI
GATB_DEHSC      --YETVIGLEVHVQLDTKSKMFCRCSTDYASEPNTHVCPVCLGMPGVLPTINKQAVEYTIMSGLALGCDI
GATB_DEHE1      --YETVIGLEVHVQLNTKSKMFCRCSTDYTSEPNTHVCPVCLGMPGVLPTINKQAVEYTIMSGLALGCDI
GATB_AZOSE      -DWEVVIGLEVHAQLNTASKIFSAASTAFGAEPNVQASAVDIALPGVLPVLNGGAVERAIRFGVAIGATV
GATB_CAMHC      --FETIIGLEVHCQLNTKTKIFCSCPTSFGDKANVHVCPTCLALPGALPVLNKEAVKKAIMFGTAVNATI
GATB_ARTCA      --YDPVLGFEVHVELNTKTKMFSSAPNVFGDEPNTNVNEVDLGMPGVLPVVNKTAIESSIKIGLALNCKI
GATB_BURVG      --WEVVIGLETHAQLSTVSKIFSGAPTQFGAEPNTQACPVDLALPGVLPVLNRGAVERAIRFGLAIGSTI
GATB_RHILO      -DWEIIIGLEVHAQVISEAKLFSGASTAFGAAPNANVSLVDAAMPGMLPVINEECVKQAIRTGLGLKAQI
GATB_BURM1      --WEVVIGLETHAQLSTVSKIFSGASTQFGAEPNTQACPVDLALPGVLPVLNRGAVERAIRFGLAIGATI
GATB_BURCJ      --WEVVIGLETHAQLSTVSKIFSGASTQFGAEPNTQACPVDLALPGVLPVLNRGAVERAIRFGLAIGSTI
GATB_MARAV      MQWDIVIGLEIHVQLATQTKIFSGSSTAYGAEPNTQANAVDLAMPGTLPVPNEQAFRYAVMFGLATNAEI
GATB_RHIME      -DWEVIIGMEVHAQVLSNSKLFSSASTEFGSEPNANVSLVDAAMPGMLPVINEECVKQAVRTGLGLKAKI
GATB_BURA4      --WEVVIGLETHAQLSTVSKIFSGAPTQFGAEPNTQACPVDLALPGVLPVLNRGAVERAIRFGLAIGSTI
GATB_BORPA      MNWEIVIGLETHTQLSTDSKIFSGSSTRFGAAPNTQANAVDLALPGSLPVMNRGAAERAILFGLAVGGKV
GATB_BORBR      MNWEIVIGLETHTQLSTDSKIFSGSSTRFGAAPNTQANAVDLALPGSLPVMNRGAAERAILFGLAVGGKV
GATB_AZOC5      -NWEVVIGMEIHAQVSSNAKLFSGASTAFGGPPNDHVSLVDAAMPGMLPVINKECVAQAVRTGLGLRAQI
GATB_BURCM      --WEVVIGLETHAQLSTVSKIFSGAPTQFGAEPNTQACPVDLALPGVLPVLNRGAVERAIRFGLAIGSTI
GATB_PSYA2      --YEVVIGIEIHCQLNTESKIFSSAPTDFGHEPNTQASIVDXXXXXXXXXXNAGVVDRALKFGIGVNAEL
GATB_LARHH      MKWEVVIGLEVHAQLSTQSKIFSGASTAFGAAPNTQACAVDIALPGVLPVMNRVAMEKAVRFGLAIGATV
GATB_RHIEC      -DWEVIVGMEVHAQVLSNSKLFSGASTEFGKPQNSNVSLVDAAMPGMLPVINEECVKQAVRTGLGLKAEI
GATB_OCHA4      -DWEVVIGMEVHAQVTSESKLFSGASTSFGAEPNSNVSLVDAAMPGMLPVINLECVKQAVRTGIGLNAQI
GATB_HELHP      --YETIIGLEVHVQLNTKTKIFCFCATSFGDEPNKNVCPTCLGLPGALPVLNREAVKKAISFGTAINATI
GATB_ARTS2      --YDPVLGFEVHVELNTKTKMFSSAPNVFGDEPNTNVNEVDLGMPGVLPVVNKTAIESSIKIGLALNCKI
GATB_COREF      --YDPVMGLEVHVELATETKMFSASSAHFGAAPNSNVDPVSLGLPGALPVVNAKGVEWAIKIGLALNCSI
GATB_RICBR      --WEYVIGLEIHAQISSKSKLFSGSGTTFAASPNSQVSYVDAAMPGMLPVLNEYCVHQAIKTGLGLKAKV
GATB_RHIL3      -DWEVIVGMEVHAQVLSNSKLFSGASTEFGKPQNSNVSMVDAAMPGMLPVINEECVKQAVRTGLGLKAQI
GATB_RALPJ      MQWEVVIGLETHTQLSTVSKIFSGASTAFGAAPNTQAAPVDLALPGVLPVLNKGAVERAIVFGLAIGAKI
GATB_POLSQ      MQWEVVIGLETHAQLQTQSKIFSGASTRFGAEPNTQACAVDLALPGVLPVLNREAVEHAIRFGLAVNAKI
GATB_MESSB      -DWEVIIGMEIHAQVTSRAKLFSGASTEFGAEPNANVSLVDAAMPGMLPVINEECVKQAIRTGLGLKAQI
GATB_CORGB      --YDPVMGLEVHVELGTETKMFSASSAHFGAEPNSNVDPVSLGLPGALPVVNAKGVEWAIKIGLALNCSI
GATB_NITWN      --WEMVIGIEVHAQVTSNAKLFSGASTAFGGDPNSHVSLVDAAMPGMLPVINEECVRQAVRTGLGLNARI
GATB_CORGL      --YDPVMGLEVHVELGTETKMFSASSAHFGAEPNSNVDPVSLGLPGALPVVNAKGVEWAIKIGLALNCSI
GATB_BRUSU      -DWEVVIGMEVHAQVTSESKLFSGASTAFGAEPNSNVSLVDAAMPGMLPVINLECVRQAVRTGIGLNAQI
GATB_BRUSI      -DWEVVIGMEVHAQVTSESKLFSGASTAFGAEPNSNVSLVDAAMPGMLPVINLECVRQAVRTGIGLNAQI
GATB_BRUME      -DWEVVIGMEVHAQVTSESKLFSGASTAFGAEPNSNVSLVDAAMPGMLPVINLECVRQAVRTGIGLNAQI
GATB_BRUMB      -DWEVVIGMEVHAQVTSESKLFSGASTAFGAEPNSNVSLVDAAMPGMLPVINLECVRQAVRTGIGLNAQI
GATB_BRUC2      -DWEVVIGMEVHAQVTSESKLFSGASTAFGAEPNSNVSLVDAAMPGMLPVINLECVRQAVRTGIGLNAQI
GATB_BRUAB      -DWEVVIGMEVHAQVTSESKLFSGASTAFGAEPNSNVSLVDAAMPGMLPVINLECVRQAVRTGIGLNAQI
GATB_BRUA2      -DWEVVIGMEVHAQVTSESKLFSGASTAFGAEPNSNVSLVDAAMPGMLPVINLECVRQAVRTGIGLNAQI
GATB_BRUA1      -DWEVVIGMEVHAQVTSESKLFSGASTAFGAEPNSNVSLVDAAMPGMLPVINLECVRQAVRTGIGLNAQI
GATB_RHISN      -DWEVIIGLEVHAQVLSNSKLFSGASTEFGNAPNANVSLVDAAMPGMLPVINEECVKQAVRTGLGLKAKI
GATB_RHIE6      -DWEVIVGMEVHAQVLSNSKLFSGASTEFGKPQNSNVSLVDAAMPGMLPVINEECVKQAVRTGLGLKAQI
GATB_BART1      -DWEVIIGMEVHAQIISNSKLFSGASAKFGAEPNNHVSLIDAAMPGMLPVLNEECVRQAVRTGLGLKARI
GATB_FUSNN      --WESVIGLEVHLQLKTGTKVWCGCKSDYDESGNLHTCPICLGHPGALPKLNKKVVDYAIKAALALNCQI
GATB_BARHE      -DWEVIIGMEVHAQIISNSKLFSGASTKFGAEPNNHVSLIDAAMPGMLPVLNQECVRQAVRTGLGLKARI
GATB_VARPS      --YEVIIGFETHAQLSTASKIFSRASTAFGAEPNTQACAVDLALPGTLPVMNKGAVERAIKLGLALGSHI
GATB_DICNV      MRYEPVIGLELHIQLNTHSKLFSPSSAAFGAEANTHVNEIDLAYPGVLPVLNEQALASAVLFGLALGSRI
GATB_CAUCR      -DWEMVLGLEVHAQVASKSKLFSGAAVGFGAGPNEQVSLVDAAMPGMLPVLNRFCVEQAVKTGLGLRAQI
GATB_BIFLO      --YDVVFGLETHVELSTNTKLFCPAHIEFGGEPNTELTPVSLGLPGSLPVINKTAVDYAIKLGLALHCEI
GATB_BIFLI      --YDVVFGLETHVELSTNTKLFCPAHIEFGGEPNTELTPVSLGLPGSLPVINKTAVDYAIKLGLALHCEI
GATB_BIFLD      --YDVVFGLETHVELSTNTKLFCPAHIEFGGEPNTELTPVSLGLPGSLPVINKTAVDYAIKLGLALHCEI
GATB_XANP2      -DWEVVIGLEVHAQVASNAKLFSGASTAFGGPPNDHVSLVDAAMPGMLPVINQECVAQAVRTGLGLKAQI
GATB_RICB8      --WEYVIGLEIHAQISSKSKLFSGSGTTFAASPNSQVSYVDAAMPGMLPVLNEYCVHQAIKTGLGLKAKV
GATB_RHILW      -DWEVIVGMEVHAQVLSNSKLFSGASTEFGKPQNSNVSLVDAAMPGMLPVINEECVRQAVRTGLGLKAQI
GATB_METEP      -DWEVVIGMEIHAQVTSRSKLFSGASTEFGGEPNDHVSLVDAAMPGMLPVINEECVAQAVRTGLGLKAQI
GATB_BARQU      -DWEVIIGMEVHAQIISNSKLFSGASTKFGAEPNNHVSLIDAAMPGMLPVINQECVRQAVRTGLGLKAHI
GATB_ANAPZ      -DWEVVIGLEVHAQIVSNSKLFSGASTEISVDPNSHVALLDVAMPGVLPVTNEYCIVQAVKTALALSCEV
GATB_METC4      -DWEVVIGMEIHAQVTSRSKLFSGASTEFGGEPNDHVSLVDAAMPGMLPVINEECVAQAVRTGLGLKAQI
GATB_SINMW      -DWEVIIGMEVHAQVLSNSKLFSGASTEFGSEPNANVSLVDAAMPGMLPVINEECVKQAVRTGLGLKAKI
GATB_RHOPS      -DWEVVIGLEIHAQVSSNAKLFSGAATAFGGDPNSHVSLVDAAMPGMLPVINEECVKQAIRSGLGLNAQI
GATB_AGRT5      -DWEIVIGLEVHAQVLSNSKLFSGASTTFGNAPNSNVSLVDAAMPGMLPVINEECVKQAVRTGLGLKAKI
GATB_RALEH      MQWEVVIGLETHAQLSTASKIFSGTSTAFGAEANTQASPVDLALPGVLPVLNKGAVERAIQFGLAIGATI
GATB_BRUO2      -DWEVVIGMEVHAQVTSESKLFSGASTAFGAEPNSNVSLVDAAMPGMLPVINLECVRQAVRTGIGLNAQI
GATB_ROSS1      MDYLVTIGLEIHAQILTRSKMFCGCSADYA-DAPPNTHVVCMGLPGALPTPNRRAIELAALTGLALNCRI
GATB_ROSCS      MDYLVTIGLEIHAQILTRSKMFCGCSADYAHPPNTHVCPVCMGLPGALPVPNRRAIELAALTGLALNCRI
GATB_WOLPM      -DWEAVIGLEVHAQVXXXXXXXXXXXTEFGAEHNTQVSLVDAAMPGTLPILNYYCIEQAIRTGLALSAEI
GATB_METPB      -DWEVVIGMEIHAQVTSRSKLFSGASTAFGGEPNDHVSLVDAAMPGMLPVINEECIAQAVRTGLGLKAQI
GATB_METRJ      -DWEVIVGMEIHAQVSSRAKLFSGASTEFGAEPNDHVSLVDAAMPGMLPVINAECVAQAVRTGLGLKAKI
GATB_FRATN      MNWEMVIGLEVHIQLSTKSKLFSTSATKYGQHQNTQAAFLDLGLPGTLPVVNKEAIRKAVIFGLAVDAKI
GATB_ACICJ      --WELVIGLEVHAQVISRSKLFSGAATAFGAEPNSQVSFVDAGFPGMLPVINRECVAQAVRTGLGLAAHI
GATB_ACIAD      --WEVVIGIEIHTQLATQSKIFSGSSTEFGQDPNTQASLVDLAMPGXXXXXXXXXXXXAIRFGLGIDAYI
GATB_RHOS5      -DWELVIGMEIHAQVSSNAKLFSGASTTFGAEPNSNVSFVDCAMPGMLPVINDFCVAQAVRTGLGLKAQI
GATB_WOLWR      -DWEAVIGLEVHAQVXXXXXXXXXXXTEFGAEHNTQVSLVDAAMPGTLPILNYYCIEQAIRTGLALSAEI
GATB_RHOPA      -DWEVVIGLEIHAQVSSNAKLFSGAATAFGGDQNTHVSLVDAAMPGMLPVINEECVRQAIRSGLGLNAKI
GATB_MYXXD      -DFQPVIGLEVHAQLLTQSKIFCGCSTAFGAEPNRNTCPVCLGMPGVLPVLNQRVAEFAVRTGLALECTI
GATB_GRABC      --WELVIGLEVHAQVISQSKLFSGAATAFGAEPNSQVSLVDAALPGMLPVLNRECVAQAVRTGLGLKAHI
GATB_CUPTR      MQWEVVIGLETHAQLSTASKIFSGTSTAFGAEANTQASPVDLALPGVLPVLNQGAVERAIQFGLAIGATI
GATB_CORJK      -HFDPVMGMEVHVELATKTKMFSTSSAEFGDAPNSNVDPCSLGLPGALPVVNKLGVEWAIKIGLALNCEI
GATB_WOLSU      --FETVIGLEVHVQLNTKTKIFCSCATSFGEEPNKNVCPVCLGLPGALPVLNGEXXXXXXXXXXXXXXXX
GATB_SILPO      -DWELVIGMEVHAQVASQAKLFSGASTAFGAEPNSNVSFVDAAMPGMLPVINEFCVEQAVRTGLGLKAEI
GATB_SULDN      --FEVVIGLEVHVQLNTKTKLFCSCPTSFNHKQNTNTCPTCLALPGALPVLNKEVLNKSIMFGTAVDATI
GATB_PELUB      --YEVVIGLEVHAQVXXXXXXXXXXXXXFGAEPNTQVSLVDAAFPGMLPVINEYCVKQAIKTGIGLRAQI
GATB_BARBK      -DWEVVIGMEVHAQIVSDSKLFSGASTKFGAEPNNHVSLIDAAMPGMLPVVNQECIRQAIRTGLGLKAQI
GATB_SALRD      --YEPVIGLEVHVQLQTNAKIFSPDAAAFGAAPNTQVDPISLGHPGTLPVLNETVVKHALRLGVATHCSI
GATB_BRAJA      -DWEMVIGMEIHAQVTSNSKLFSGASTAFGGEPNSHVSLVDVAMPGMLPVINEECVRQAVRTGLGLNAKI
GATB_EHRCR      -DWEVVIGLEVHAQVISNSKLFSGASTKYDALPNTQVALFDVAMPGMLPVLNEYCVYQAIKTGIALSCKI
GATB_RHOP2      -DWEVVIGLEIHAQVSSNAKLFSGAATEFGGDPNSHVSLVDAAMPGMLPVINEECVKQAIRSGLGLNAQI
GATB_HELPH      MPFEAVIGLEVHVQLNTKTKIFCSCSTSFGESPNSNTCPVCLGLPGALPVLNKEVVKKAIQLGTAIEANI
GATB_FRATW      MNWEMVIGLEVHIQLSTKSKLFSTSATKYGQHQNTQAAFLDLGLPGTLPVVNKEAIRKAVIFGLAVDAKI
GATB_FRATT      MNWEMVIGLEVHIQLSTKSKLFSTSATKYGQHQNTQAAFLDLGLPGTLPVVNKEAIRKAVIFGLAVDAKI
GATB_FRATO      MNWEMVIGLEVHIQLSTKSKLFSTSATKYGQHQNTQAAFLDLGLPGTLPVVNKEAIRKAVIFGLAVDAKI
GATB_FRATH      MNWEMVIGLEVHIQLSTKSKLFSTSATKYGQHQNTQAAFLDLGLPGTLPVVNKEAIRKAVIFGLAVDAKI
GATB_FRATF      MNWEMVIGLEVHIQLSTKSKLFSTSATKYGQHQNTQAAFLDLGLPGTLPVVNKEAIRKAVIFGLAVDAKI
GATB_FRAT1      MNWEMVIGLEVHIQLSTKSKLFSTSATKYGQHQNTQAAFLDLGLPGTLPVVNKEAIRKAVIFGLAVDAKI
GATB_DINSH      -DWELVIGLEVHAQVATNAKLFSGASTLFGAEPNSNVAFVDAGMPGMLPVINEECVAQAVRTGLGLKAAI
GATB_FRATM      MNWEMVIGLEVHIQLSTKSKLFSTSATKYGQHQNTQAAFLDLGLPGTLPIVNKEAIRKAVIFGLAVDAKI
GATB_CAMJ8      --FEVVIGLEVHTQLNTKTKIFCSCATSFGEAPNTNVCPTCLALPGALPVLNEEAVKKAIAFGKAVNATI
GATB_SILST      -DWELVIGMEVHAQVSSNAKLFSGASTQFGAEPNSNVAFVDAAMPGMLPVINEYCVEQAVRTGLGLKADI
GATB_CAMJR      --FEVVIGLEVHTQLNTKTKIFCSCATSFGEAPNTNVCPTCLALPGALPVLNEEAVKKAIAFGKAVNATI
GATB_CAMFF      --FETVIGLEVHCQLNTKTKIFCSCSTSFGDEPNTHVCPTCLALPGALPVLNKEAVKKAISFGKAINATV
GATB_THESQ      MRYRPVIGLEIHVQLSTKTKAFCSCPADFELPPNTAICPVCTGQPGALPVPNEEMIRFAVKTALALNCKI
GATB_THEP1      MRYRPVIGLEIHVQLSTKTKAFCSCPADFELPPNTAICPVCTGQPGALPVPNEEMIRFAVKTALALNCKI
GATB_THEMA      MRYRPVIGLEIHVQLSTKTKAFCSCPADFELPPNTAICPVCTGQPGALPVPNEEMIRFAVKTALALNCKI
GATB_RHOP5      -DWEVVIGLEVHAQVASNAKLFSGASTEFGGAPNAHVSLVDAAMPGMLPVINEECVAQAVRTGLGLNAQI
GATB_ALCBS      MSWEIVIGLEVHVQLNTASKLFSGSKLSTGAEPNTQASLVDLGLPGTLPVVNREAVRKAALFGLAIDADI
GATB_CAMJJ      --FEVVIGLEVHTQLNTKTKIFCSCATSFGEAPNTNVCPTCLALPGALPVLNEEAVKKAIAFGKAVNAAI
GATB_RHOS4      -DWELVIGMEIHAQVSSNAKLFSGASTTFGAEPNSNVSFVDCAMPGMLPVINEFCVAQAVRTGLGLKAQI
GATB_LAWIP      -HFEAVIGLEVHVQLGTKSKLFCSCPTTFGTPPNTNICEICAGMPGALPSLNKLAVEYAVKAGLALHCTI
GATB_CAMC5      --FEVVIGLEVHTQLNTKTKIFCSCSTSFGDEANTHVCPTCLALPGALPVLNKEAVKKAISFGTAINAKI
GATB_RHOSK      -DWELVIGMEIHAQVSSNAKLFSGASTTFGAEPNSNVSFVDCAMPGMLPVINEFCVAQAVRTGLGLKAQI
GATB_RHOS1      -DWELVIGMEIHAQVSSNAKLFSGASTTFGAEPNSNVSFVDCAMPGMLPVINEFCVAQAVRTGLGLKAQI
GATB_RALSO      MQWEVVIGLETHAQLSTASKIFSGASTAFGAAPNTQAAPVDLALPGVLPVLNKGAVERAITFGLAIGAKI
GATB_WOLPP      -NWETVIGLEVHAQVXXXXXXXXXXXXEFGTEHNTQVSLVDAAMPGTLPILNYFCIEQAICTGLAISAEI
GATB_OLICO      -DWEVVIGLEIHAQVTSNAKLFSGAATAFGGAPNEHVSLVDAAMPGMLPVINAECVAQAIRTGLGLKAQI
GATB_ELUMP      --FEPVIGLEIHLQLNTNSKLFCSCPSGMADNPIPNSAVVCTAQPGTLPVLNKGXXXXXXXXXXXXXXXI
GATB_BRASB      -DWEVVIGMEIHAQVTSKSKLFSGASTAFGGDPNSHVSLVDVAMPGMLPVINEECVRQAVRTGLGLNAKI
GATB_METSB      -DFEIVIGMEIHAQVTSRSKLFSGASTEFGGEPNAHVSLVDAAMPGMLPVINQECVAQAVRTGLGLEAQI
GATB_MESFL      -NFEIVIGIENHVELKTKSKMFSSAPVSYGETPNTNVNETDMAYPGSLPTINKKGIELAIRTCNALNMEI
GATB_HELPJ      MPFEAVIGLEVHVQLNTKTKIFCSCSTSFGETPNSNTCPVCLGLPGALPVLNKEVVKKAIQLGTAIEAHI
GATB_CAMJE      --FEVVIGLEVHAQLNTKTKIFCSCATSFGEAPNTNVCPTCLALPGALPVLNEEAVKKAIAFGKAVNATI
GATB_RICTY      --WEYVIGLEIHAQISSKTKLFSGSSTLFAASPNSQVSYVDAAMPGMLPVLNKHCVHQAIKTGLALKAKI
GATB_MYCAP      -NFEAIIGIEIHLELNTKTKMFSPSKIDFNAEANTTVNQIDLGYPGTLPLLNKEAVVSGIKLAKALNMTI
GATB_EHRCJ      -DWEVVIGLEVHAQVISNSKLFSGASAKYDAPPNTQVSLFDVAMPGMLPVLNEYCIYQAVKTGIALSCKI
GATB_BEII9      -DWEIIIGLEVHAQVTSRSKLFSGASTQFGAEPNSNVSLVDAAMPGMLPVINEECVAQAVRTGLGLKAQI
GATB_HELPY      MPFEAVIGLEVHVQLNTKTKIFCSCSTSFGESPNSNTCPVCLGLPGALPVLNKEVVKKAIQLGTAIEANI
GATB_CAMJD      --FEVVIGLEVHTQLNTKTKIFCSCATSFGEAPNTNVCPTCLALPGALPVLNEEAVKKAIAFGKAVNAAI
GATB_BIFA0      --FDPVIGLETHVELSTRTKLFCPAPISFGAEPNTELTPVSLGLPGSLPVLNATAVDYAIKLGLALHCQI
GATB_ANAMM      --WEMVVGLEVHAQVISNSKLFSGASTGFCSEPNTQVALFDVAMPGTLPVLNARCVEQAVRTSLALSCEV
GATB_METNO      -DWEVVIGMEIHAQVTSRSKLFSGASTAFGAEPNDNVSLVDAAMPGMLPVINRECVAQAVRTGLGLKAQI
GATB_METI4      MDYEAIIGLEVHVQLKTQTKLFCGCAVEYGATPNSRVCPVCLGLPGALPSPNKEAIILTIQTGLMLGSEI
GATB_CLAMS      --FEPVLGFEVHVELNTRTKMFSDAPNFFGGEPNTNITPVDLGLPGSLPVVNEQAVKHSISLGLALGCEI
GATB_VESOH      MKWETVIGLEIHVQLNTKSKIFSSALTKYGKKPNSQACAIDXXXXXXXXXXNVEAVNKAIRFGVAINAHI
GATB_NITHX      -DWEMVIGLEVHAQVTSNAKLFSGASTAFGGEPNSHVSLVDAAMPGMLPVINEECVRQAVRTGLGLNAQI
GATB_ANAMF      --WEMVIGLEVHAQVISNSKLFSGASTGFCSEPNTQVALFDVAMPGTLPVLNARCVEQAVRTSLALSCEV
GATB_PARUW      -DWEAVIGLEIHVELNTKSKLFSVAPNHFGDEPNTNITEVCTGMPGSLPVLNKEAVRKAVQFGCAIQAEV
GATB_ROSDO      -DWELVIGMEVHAQVTSAAKLFSAASTQFGAEPNNNVSFVDAAMPGMLPTINEYCVEQAVRTGLGLKAEI
GATB_RHOFD      LGYEVVIGFETHAQLSTQSKIFSRAATAFGAEPNTQACAVDLALPGTLPVMNRGAVERAIQFALAIGAQV
GATB_TERTT      MEWETIIGLEVHVQLATNTKIFSGSSTAFGAEPNTQACAIDLAMPGTLPTPNAEAFRFATMFGLAVNAEI
GATB_THELT      MSFKTIVGLEIHVQLMTKTKAFCSCRADFDLPPNTAICPVCTGQPGALPTVNSTMIDYAIKIALALNCNI
GATB_RHORT      --WEVVVGLEVHAQVVSQSKLFSGSSTRFGAPANSQVSLVDAAMPGMLPVINGLCVEQAVRTGLGLRAKI
GATB_THEFY      --YEPVLGLETHVELGTRSKMFCSCATTFGAEPNTQVCPVCLALPGALPVVNSAAVESAIRLGLALNCSI
GATB_RHOE4      --YEPVMGMEVHVELGTATKMFCPCPTEFGAEPNTQVCPVCLGMPGSLPVVNAAAVESAIRIGLALNCSI
GATB_CLOCE      MKYIPSIGLEIHSELSTKSKIFCDCPVSFGGEPNTRCCPVCTGMPGTLPVLNKQAVEYTVIAGLALNCKI
GATB_WOLTR      -DWEAVIGLEVHAQVXXXXXXXXXXXXEFGAEHNTQVSLVDAAMPGTLPILNYYSIEQAIRTGLALSAEI
GATB_EHRRW      -DWEMIIGLEVHAQVISNSKLFSGASAKYDSLPNTQVSLFDVAMPGMLPLLNQYCISQAVKTGLALSCKI
GATB_ANASK      -DFQVVIGLEVHAQLLTASKIFCGCSTAFGAAPNAHTCPVCLGLPGALPALNRSVVEMAVRTGLALGCEI
GATB_RICRS      --WEYVIGLEIHAQIXXXXXXXXXXXTIFAANPNSQVSYIDAAMPGMLPVLNKHCVHQAIKTGLGLKAKI
GATB_ANADE      -DFQVVIGLEVHAQLLTASKIFCGCSTAFGGAPNAHTCPVCLGLPGALPALNRSVVEMAVRTGLALGCEI
GATB_RICRO      --WEYVIGLEIHAQIXXXXXXXXXXXTIFAANPNSQVSYVDAAMPGMLPVLNKHCVHQAIKTGLGLKAKI
GATB_RICAE      --WEYVIGLEIHAQIXXXXXXXXXXXTIFAANPNSQVSYVDAAMPGMLPVLNKHCVHQAIKTGLGLKAKI
GATB_RICCN      --WEYVIGLEIHAQIXXXXXXXXXXXTIFAANPNSQVSYVDAAMPGMLPVLNKHCVHQAIKTGLGLKAKI
GATB_RHOOB      --YEPVLGMEVHVELGTNTKMFCPCPTEFGAEPNTQVCPVCLGLPGSLPVVNEAAVESAIRIGLALNCSI
GATB_NOCFA      --YEPVLGMEVHVELSTATKMFCGCPTDFGAEPNTQVCPVCLGLPGSLPVVNEKAVESAIRIGLALNCSI
GATB_MYCSJ      --FEPVMGMEVHVELSTATKMFCGCANAFGAEPNTQVCPVCLGLPGSLPVLNQQAVESAIRIGLALNCEI
GATB_EHRRG      -DWEMIIGLEVHAQVISNSKLFSGASAKYDSLPNTQVSLFDVAMPGMLPLLNQYCISQAVKTGLALSCKI
GATB_MYCSS      --FEPVMGMEVHVELSTATKMFCGCANAFGAEPNTQVCPVCLGLPGSLPVLNQQAVESAIRIGLALNCEI
GATB_MYCSK      --FEPVMGMEVHVELSTATKMFCGCANAFGAEPNTQVCPVCLGLPGSLPVLNQQAVESAIRIGLALNCEI
GATB_RICPU      --WEYVIGLEIHAQIXXXXXXXXXXXTIFAANPNSQVSYVDAAMPGMLPVLNKHCVHQAIKTGLGLKAKI
GATB_RICFE      --WEYIIGLEIHAQIXXXXXXXXXXXTIFAANPNSQVSYVDAAMPGMLPVLNKHCVYQAIKTGLGLKAKI
GATB_OPITP      MNYEAVIGLEVHVQVKTASKMFTRVAAGYGHAPNTLTDPVVLALPGTLPVMNKAALDAIIKAGLLLGCEI
GATB_SPHWW      --WEVVIGLEVHAQVVSNAKLFSGASAAFGAEPNQSVSLVDAAMPGMLPVPNEECIRQAVKTGMALGAEI
GATB_ORITI      --WEYVIGLEIHAQIKSNAKLFSSASTEFGSSPNSQVELLDAAMPGSLPVLNEFCVHQAIKTALGINAKI
GATB_ORITB      --WEYVIGLEIHAQIKSNAKLFSSASTEFGSSPNSQVELLDAAMPGSLPVLNEFCVHQAIKTALGINAKI
GATB_RICCK      --WEYVIGLEIHAQIXXXXXXXXXXXXXXAAMPNSQVSYVDAAMPGMLPVLNKHCVHQAIKTGLALKAQI
GATB_PROAC      -NYEPVVGLEVHVELSTATKMFCGCSTDTDKDPNTNVCPVCLGLPGSMPAINGHAVESAIRIGLALNCHI
GATB_THERP      MEFETVIGLEVHAQLLTRSKMFCGCSADYGAPPNTHVCPVCLGLPGSLPVINRRAVEMTVMTGLALGCRI
GATB_STRAW      -SYDPVMGLEVHVELGTKTKMFCGCSTELGAEPNSQTCPTCLGMPGALPVVNAIGVESAIKIGLALHCEI
GATB_RHOPB      -DWEIVIGLEVHAQVSSKSKLFSGASTEFGGDPNAHVSLVDAAMPGMLPVINEECVKQAVRSGLGLNAQI
GATB_ANAD2      -DFQVVIGLEVHAQLLTRSKIFCGCSTAFGGAPNAHTCPVCLGLPGALPALNRAVVEMAVRTGLALGCEI
GATB_AGRVS      -DWEIVIGMEVHAQVLSQSKLFSGASTTFGNAPNDNVSLVDAAMPGMLPVINEECVRQAVRTGLGLKAKI
GATB_RHOSR      --YEPVLGMEVHVELGTETKMFCPCPTEFGAEPNTQVCPVCLGLPGSLPVVNEAAVESAIRIGLALNCSI
GATB_CHLTB      --WESVIGLEVHVELNTESKLFSPARNHFGDEPNTNISPVCTGMPGSLPVLNKDAVRKAVLFGCAVEGDV
GATB_CHLT2      --WESVIGLEVHVELNTESKLFSPARNHFGDEPNTNISPVCTGMPGSLPVLNKDAVRKAVLFGCAVEGDV
GATB_CHLTA      --WESVIGLEVHVELNTESKLFSPARNHFGDEPNTNISPVCTGMPGSLPVLNKDAVRKAVLFGCAVEGDV
GATB_CHLMU      --WESVIGLEVHVELNTASKLFSPARNHFGDEPNTNISPVCTGMPGALPVLNKDAVRKAVLFGCAVEGDV
GATB_STRCO      -SYDPVMGLEVHVELGTKTKMFCGCSTALGADPNTQTCPVCLGMPGALPAVNATGVESAIKIGLALNCEI
GATB_CHLTR      --WESVIGLEVHVELNTESKLFSPARNHFGDEPNTNISPVCTGMPGSLPVLNKDAVRKAVLFGCAVEGDV
GATB_NOVAD      --WEVVIGLEVHAQVTSNAKLFSGAATAFGAEPNTQVSLVDAAMPGMLPVPNRECIRQAVRTGMAINAQI
GATB_THENN      MRYRPVIGLEIHVQLSTKTKAFCSCPADFELPPNTAICPVCTGQPGALPVPNEEMIRFAVKTALALNCKI
GATB_MYCS2      --YEPVMGMEVHVELSTATKMFCGCANRFGAEPNTLVCPVCLGLPGALPVLNEAAVESAIRIGLALNCEI
GATB_LEGPL      MEWDTVIGLEVHAQLKTKSKLFSGASTAFGATPNSQTSFIDAGLPGVLPVLNEQAIIMAIQFGLAIHGTI
GATB_LEGPH      MEWDTVIGLEVHAQLKTKSKLFSGASTAFGATPNSQTSFIDAGLPGVLPVLNEQAIIMAIQFGLAIHGTI
GATB_DEIRA      MTYQAVIGLEVHLQLNTRSKIFSACPADYGAGPNEFTDXXXXXXXXXXXXXNRRAVELAMMFGLGLGCDV
GATB_TREPS      --YEVIIGCEIHCQLLTKTKAFCACANRSGGMPNSRVCPVCLGLPGALPVVSEEYVRLGVRAGLALGCTI
GATB_TREPA      --YEVIIGCEIHCQLLTKTKAFCACANRSGGMPNSRVCPVCLGLPGALPVVSEEYVRLGVRAGLALGCTI
GATB_LEIXX      --FEPVLGFEVHVELNTKTKMFCGCANEFGSGANTNTCPTCLGLPGGLPHVNEKAIESSIRLGLALGCDI
GATB_DEIDV      MSYQAVIGLEVHLQLKTRTKIFSSCPAEYGAEPNTFTDXXXXXXXXXXXXXNREAVELAMMFGLSLNCDV
GATB_LEGPC      MEWDTVIGLEVHAQLKTKSKLFSGASTAFGATPNSQTSFIDAGLPGVLPVLNEQAIIMAIQFGLAIHGTI
GATB_CHLFF      -DWESVIGLEVHVELNTKSKLFSSAQNRFGDEPNTNISPVCTGMPGSLPVLNKEAVNKAILFACAVQGEV
GATB_JANSC      -DWELVIGMEVHAQVSTRAKLFSGASTRFGAEPNSNVAFVDAGMPGMLPVINEACVSQAVRTGLGLKAQI
GATB_MYCPA      --FDPVLGLEVHVELSTVTKMFCGCTTAFGAEPNTQVCPVCLGLPGSLPVLNQAAVESAIRIGLALNCEI
GATB_MYCA1      --FDPVLGLEVHVELSTVTKMFCGCTTAFGAEPNTQVCPVCLGLPGSLPVLNQAAVESAIRIGLALNCEI
GATB_ERYLH      --WEVVIGLEVHAQVTSNAKLFSGASTEFGAEPNAQVSLVDAAMPGMLPVPNRECIRQAVRTGMAIEAQI
GATB_BORBZ      MEYKLVIGLEIHVQLGLKTKAFCGCKNEFGGVPNSRVCPICLGLPGSLPSVNVELINSAILAGHATNSKI
GATB_BORBU      MEYKLVIGLEIHVQLGLKTKAFCGCKNEFGGVPNSRVCPICLGLPGSLPSVNVELINSAILAGHATNSKI
GATB_NEOSM      --WEVVIGLEVHAQILSKNKLFSDAPCDSTKGPNTAVTLFDAAMPGVLPVLNFNCVEKAIRAGLGLGGKI
GATB_KINRD      --FDPVLGLEVHVELNTATKMFSGSPTEFGAEPNTQVDPTSLGLPGAMPVLNAKALESAIRIGLALNCSI
GATB_BORGA      MEYKLVIGLEIHIQLGLRTKAFCGCKNEFGGVPNSRICPICLGLPGSLPSVNVELINSAILAGHATNSNI
GATB1_SYNAS     MEFEAVIGLEIHIELNCPTKLFCDCPNNPGDEPNVNTCPICLWFPGAIPRLSQAALEKASLLCLGLGAEL
GATB_MYCTU      --FQPVLGLEVHVELSTATKMFCGCTTTFGGEPNTQVCPVCLGLPGSLPVLNRAAVESAIRIGLALNCEI
GATB_MYCTA      --FQPVLGLEVHVELSTATKMFCGCTTTFGGEPNTQVCPVCLGLPGSLPVLNRAAVESAIRIGLALNCEI
GATB_MYCBT      --FQPVLGLEVHVELSTATKMFCGCTTTFGGEPNTQVCPVCLGLPGSLPVLNRAAVESAIRIGLALNCEI
GATB_MYCBP      --FQPVLGLEVHVELSTATKMFCGCTTTFGGEPNTQVCPVCLGLPGSLPVLNRAAVESAIRIGLALNCEI
GATB_MYCBO      --FQPVLGLEVHVELSTATKMFCGCTTTFGGEPNTQVCPVCLGLPGSLPVLNRAAVESAIRIGLALNCEI
GATB_CHLCV      -DWESVIGLEVHVELNTKSKLFSCARNRFGDEPNTNISPVCTGMPGSLPVLNKEAVRKAILFGCAVQGEV
GATB_CHLAB      -DWESVIGLEVHVELNTKSKLFSCARNRFGDEPNTNISPVCTGMPGSLPVLNKEAVRKAVLFGCAVEGEV
GATB_CLAM3      --FEPVLGFEVHVELNTRTKMFSDAPNFFGGEPNTNITPVDLGLPGSLPVVNEQAVKHSISLGLALGCEI
GATB_FRASC      --YEPVIGLETHVELGTASKMFCGCATAFGAEPNTQVCPVCLGLPGSLPVVNEAAVRFAVMIGLALHCEI
GATB_ANADF      -DFQVVLGLEVHAQLLTRSKIFCACPTEFGGAPNTHVXXXXXXXXXXXXXXXXXXXEMAIRTGLALGCEI
GATB_CHLPN      -DWESVIGLEVHVELNTASKLFSSALNRFGDEPNTNISTVCTGLPGSLPVLNQSAVEKAVLFGCAVEGEI
GATB_THET8      --YEAVIGLEVHLHLKTRTKMFCGCRAYFGAEPNTHTCPVCLGLPGALPVPNRVAVEHGLRLALALGAEV
GATB_THET2      --YEAVIGLEVHLHLKTRTKMFCGCRAYFGAEPNTHTCPVCLGLPGALPVPNRVAVEHGLRLALALGAEV
GATB_RICPR      --WEYVIGLEIHAQIXXXXXXXXXXXXXXAASPNSQVSYVDAAMPGMLPVLNKHCVYQAIKTGLVLKAKI
GATB_BORAP      MEYKLVIGLEIHIQLGLKTKAFCGCKNEFGGVPNSRICPICLGLPGSLPSVNVELINSAILAGHATNSKI
GATB_THEAB      MRFKPVIGLEIHVQLNTKTKAFCSCPADFELEPNSAICPVCTGQPGALPVPSKEMYEYGILLASALNCRI
GATB_MYCLE      --FDPVFGLEVHVELSTVTKMFCGCATTFGAEPNTQVCPVCLGLPGSLPVLNRAAVQSAIRIGLALNCEI
GATB_MYCLB      --FDPVFGLEVHVELSTVTKMFCGCATTFGAEPNTQVCPVCLGLPGSLPVLNRAAVQSAIRIGLALNCEI
GATB_FINM2      MNLKTLIGLEIHVELSTKTKMFCGCKNEFGQIPNTNVCPICLGHPGALPHMNKQALRYAIMAGLAFDCDI
GATB_ZYMMO      -SWEIVVGLEVHAQVISKSKLFSGAATAFGAEPNSQVSLIDAAMPGMLPVVNRECIRQAVRTGLAIGAVI
GATB_TREDE      LEYEIIIGCEIHCQLLTKTKAFCSCENRYGGIPNTRVCPCCLGLPGALPRVSKEYVEFGIKAGHALGCRI
GATB_MYCPU      -NFEVIIGIEIHLELNTKTKFFSPSPIDFEAEANTLVHPIDLGYPGTLPRVNKQAIINGIKLAKALNMTI
GATB_BORDL      MEYKLLIGLEVHVQLGLKTKAFCGCKNDFGGIPNSRVCPICLGLPGALPSVNKELVSSAILAGHATNSTI
GATB_NOCSJ      -SYDPAMGLEVHVELNTASKMFCGCPTEFGAEPNTQVCPTCLGLPGAMPVVNGKAVESAIRIGLALNCEI
GATB_LEGPA      MEWDTVIGLEVHAQLKTKSKLFSGASTAFGATPNSQTSFIDAGLPGVLPVLNEQAIIMAIQFGLAIHGTI
GATB_BORRA      MEYKLLIGLEVHVQLGLKTKAFCGCKNDFGGIPNSRVCPICLGLPGALPSVNKELVSSAILAGHATNSTI
GATB_THEM4      MRFKPVIGLEIHVQLNTKTKAFCSCPADFELEPNNAICPVCTGQPGALPVPSKQMYEFGILLAAALNCKI
GATB_MYCS5      INFETVIGIEIHIELKTKTKMFSPVEINFNAESNTKANQIDLGYPGTLPQVNKKAVKYAIMLAKALNMQI
GATB_BORT9      MEYKLLVGLEVHVQLGLKTKAFCGCKNDFGGIPNSRTCPTCLGLPGALPSINKELISSAILAGHATNSKI
GATB_BORHD      MEYRLLVGLEVHVQLGLKTKAFCGCKNDFGGIPNSRTCPTCLGLPGALPSVNKELINSAILAGHATNSKI
GATB_METB6      ---DVIVGLEVHCQLDTKSKLFCGCSTDY-RDDGPNTHVICLGLPGTMPALNKRAIEYAMKVAKALNCTI
GATB_UREU1      -NFEVIIGIEVHTALNTKTKMFSNTPTSHKSMANTLINEIDLALPGTLPSVNQEVVHKGLFLANALHMHT
GATB_SALAI      --YEPVIGLETHVELGTNTKMFCGCPTDFGGAPNTRVCPVCLGLPGSLPVANRAAVEATIRIGLALNCSI
GATB_SALTO      --YEPVIGLETHVELGTNTKMFCGCPTDFGGAPNTRVCPVCLGLPGSLPVANRAAVEATIRIGLALNCSI
GATB_MYCMO      --FETVIGIEIHIELNTKTKMFSPAPNKFNEKPNTLVHPIDVAYPGTLPRLNXXXXXXXXXXXXXXNMEI
GATB_METBU      -----MVGLEVHVQLNNNTKMFCGCSTQY-HDSEPNTHVVCMGLPGALPVINKRAVESAIKIGMALNCEV
GATB_TROWT      -DFEPIIGLEVHVELSTQTKLFSPLASCASQGPNTLVTPVCLGLPGSLPTVNERAVDYGIALGLALGCSI
GATB_TROW8      -DFEPIIGLEVHVELSTQTKLFSPLASCASQGPNTLVTPVCLGLPGSLPTVNERAVDYGIALGLALGCSI
GATB_RHOBA      ----TIIGLEVHVQLKTQTKLFCGCTTEFGAPPNTQVCPVCLGMPGALPVMNREAIALSVKTGLALNCDI
GATB_UREPA      -NFEVIIGIEVHTALNTKTKMFSNAATSHKSIPNTLINEIDLALPGTLPTVNQEVVHKGLFLANALHMRT
GATB_UREP2      -NFEVIIGIEVHTALNTKTKMFSNAATSHKSIPNTLINEIDLALPGTLPTVNQEVVHKGLFLANALHMRT
GATB_HALWD      -DFTAVIGLEVHVQLETDTKIFCGCSTRDNNEPNTRTCPVCLGLPGALPVLNXXXXXXXXXXXXXLNADI
GATB_SULAC      ------IGLEVHVHLTSKTKLFSCPTEYVGKDPNTITCPVCLGLPGAIPVLNENAVRAAIMVALAINAEI
GATB_METMA      ------IGLEIHVQLNKKTKMFCGCSTDYHNAANTHTCPVCLGLPGALPVLNKKAVEAAIKVGLALEGEI
GATB_METHJ      -DLETIIGLEIHCQLNTKSKMFCSCSTDFDNEPNTHTCPVCLGLPGSMPMVNKRAIEFALKVGKALNCTI
GATB_SULTO      ------IGLEVHVHLTSKTKLFSCPSDYTGKDPNTNVCPICLGLPGAIPVLNENAVKAAIMVALAINAEI
GATB_ARCFU      ---DVVIGLEVHVQLNRRTKLFCSCPLNY-HQSPPNTHVVCLGMPGAMPVINXXXXXXXXXXXXXLNAEI
GATB_MYCGA      -NFQPIIGIEVHVVINSKTKMFSPSANSHRSDPNINVHPIDLGLPGTMPEPNGFXXXXXXXXXXXXNMNV
GATB_METBF      ------IGLEIHIQLNKKTKMFCGCSTDYHNAANTHTCPICLGLPGTLPVLNKKAVEAAIKVGLALEGEI
GATB_METAC      ------IGLEIHVQLNKKTKMFCGCSTDYHNAANTHTCPICLGLPGTLPVLNKKVVEAAIKVGLALEGEI
GATB_DICDI      --WELIVGIEVHAQTKTKEKLFS-NSLNIGSMENSRVSFVDAAFPGALPVLNDKCVEQAIKTGLSIGGTI
GATB_METMP      -------GLEIHVQVDTNSKLFCQCPTNY-KDVEPNTNIVCIGHPGAKPMPNKKAIDVAIMVAKMLDMVI
GATB_MYCPN      INFEAIIGIEVHVVLNTATKMFSPAPNQAQNTPNQFINAIDLGLPGTMPQVNEQAVQKALILADALNMQV
GATB_MYCPE      -NFETVIGIEVHVVLXXXXXXXXXXXXXHTDPKNTNISPIDLGHPGTMPLPNKRCIEKAIVLAKALDMEI
GATB_MOUSE      -----VVGLEIHAQISSNSKLFSGAQVCFAAPPNSLVSYFDASLPGTLPVLNRRCVEAAVMTGLALNCHI
GATB_METJA      -------GLEIHVQIDTKSKLFCNCSTNY-LDAEPNTNVVCLGLPGAKPLPNKKAVEVAIMVALGCKIVV
GATB_METTH      -------GLEIHVQLDTRSKLFCRCPTDY-QEAPPNTNIVCLNQPGAKPYPNRSALEGALKIALMLDCRI
GATB_META3      -------GLEIHVQVDTNSKLFCTCPTNY-NEVEPNTNIVCMAHPGARPMPNKKAVDMAIMVAKMLGCEI
GATB_METM7      -------GLEIHVQVDTNSKLFCQCPTNY-KDVEPNTNIVCIGHPGAKPMPNKKAIDMAIMVALGCEMVI
GATB_HALMA      -----VIGLEVHVQLETETKIFCGCSTDVADEPNTHTCPVCLGLPGALPXXXXXXXXXXXXXXXXIDADI
GATB_SULSO      ------IGLEVHVHITAKTKLFSCPSDYTGKDPNTVTCPVCLGLPGAIPVLNENAVKYGILTALALNCQI
GATB_METM5      -------GLEIHVQVDTNSKLFCQCPTNY-KDVEPNTNIVCIGHPGAKPMPNKKAIDMAIMVALGCEMVI
GATB_METKA      ------IGFEVHVQLDTRTKLFCDCPTDYEDEPNENTCPVCTGMPGAKPLPNEEALLIALEIAHMLDCEL
GATB_METM6      -------GLEIHVQVDTNSKLFCQCPTNY-KDVEPNTNIVCIGHPGAKPMPNKKAIDMAIMVALGCEMVI
GATB_NATPD      -----VIGLEVHVQLETDTKIFCGCSTDADDNEEPNTRTVCLGLPGALPVLNXXXXXXXXXXXXXLSSDI
GATB_METVS      -------GLEIHVQVDTNSKLFCKCPTNY-KDVFPNTNIVCIGHPGAKPMPNKKAFDIAIMVAKMLNCEM
GATB_HALSA      -----IIGLEVHVQLETDTKIFCGCSTDTDDDPNTHTCPVCLGLPGALPTLNEGAVEAAVKLGKAIDADI
GATB_HUMAN      -----VVGLEIHAQISSNSKLFSGSQVRFSAPPNSLVSFFDASLPGTLPVLNRRCVEAAVMTGLALNCHI
GATB_METS3      -------GLEIHVQLETESKLFCDCPTNY-KEAPANSNIVCLNQPGAKPYTNEKAIENALMISLMLNCKI
GATB_COPPD      MNFKFVAGLEIHVQLNTKTKMFCSCPTEGPDIPNTRVCPVCLGYPGTLPVLNREAVVMAIALGKALHGHI
GATB_METST      -------GLEIHVQLNTNSKLFCSCPTNYQSAPN-NTNIVCLNQPGAKPYPNQAALDNAIKVALMLGCEI
GATB_MYCGE      INFEAIIGIEVHVVLNTASKMFSKAPNRVDNQKNHFIDPIDLGLPGTLPQVNEXXXXXXXXXXXXXXXXV
GATB_EMENI      --WELTVGVEIHAQLNTETKLFSRAPTSPSELPNTNVALFDLAFPGSQPEFQVATLLPALRAAIALNCDI
GATB_YEAST      -------GLEIHTQLNTKNKLFSQSTTSLVDAPNHHTSYYDIALPGTQPVLNLEAILFAMKLSLALGSQV
GATB_SCHPO      ------IGLEIHLQLATVKKLFSPAKVNPLAQPNTCVAYFDVSLPGSMPILNPEALKFAVKGALALNCEV
GATB_AERPE      ------IGLEIHVQLNAGSKLFCGCDSEYGYKPNTNVCPVCLGLPGALPVPSRRPIVLAIAASMALGCRV
GATE_ARCFU      --------------------------------------------------VNREALLIAIQVAKMLNMEV
GATE_DESK1      ------VGLEIHVQLDTARKLFCPAKSEVGEIDRAA--LLEWKYEYEAPVESSCLVEADEEPPSSMNMRI
GATE_AERPE      ------VGLEIHQQLDTREKLFCSCPAELGEEEHDEAALFEWRYIYQAPLNHSCLVEADEEPPHPINREI
GATE_METM6      ------VGLEIHQQLNTKRKLFCPSQSEMGNDTTCLVELDDEPPHDVAP----DAVDTALEVSTLMNMKM
GATE_METM5      ------VGLEIHQQLNTKRKLFCPSQSEMGNDSTCLVELDDEPPHDVSPE----AVDTALEVSTLMNMKM
GATE_METJA      INYEKVVGLEIHQQLNTKRKLFCPTILRDDEPDGEIVRVLRPSLSEMGEVDRAALIEAALEVALLMNMNV
GATE_THEVO      ---------------------------------------------------NEDAIATAISVARALNCDI
GATE_METMP      ------VGLEIHQQLNTKRKLFCPSQSEMGNDTTCLVELDDEPPHDVAPE----AVDTALEVSTLMNMKM
GATE_SULAC      ------VGLEIHQQLNTNKKLFCDCSTHHGTLQRYTAALFEWQFNSCLVELNREXXXXXXXXXMSLESNI
GATE_METS3      --------------------------------------------------LNKEALEICITIAALMNMHI
GATE_METM7      ------VGLEIHQQLNTKRKLFCPSQSEMGNDTTCLVELDDEPPHDVAPE----AVDTALEVSTLMNMKM
GATE_METKA      -------------------------------------------------------LDVAIKVTLLLGGSV
GATE_METVS      ------VGLEIHQQLNTKRKLFCNCPTKIRDDENDTTCLVELDDEPPHNVSEEGL-NTALEVSTLMNMNF
GATE_THENV      -------GLEIHIQLNTRRKLFCDDEPHFRLERRLHVSVSELGAPAVMWEVRKGYRDTAVAVAKMFNAKL
GATE_PYRIL      ------VGLEIHIQLNTKRKLFCDDEPHFRIERRLHLSVSELGAPAVLWEVRKGYRDTAVAVAKMFNAKI
GATE_METAC      --------------------------------------------------LNKEALDISLGVSKLFNMKP
GATE_METTH      MDWEKVMGLEIHQQLDTESKLFCPTQSELGKFDRAETCLVEADEEPPHP-LNPEALEIAVTIALLLNMRV
GATE_HALMA      -----VAGLEIHQQLDTATKLFCPTKSELGEIDEAEESMVDREFEYLAHRVDREAMETTLEIAQLLDMSV
GATE_SULTO      ----------------------------------------------------------------------
GATE_PYRCJ      ------VGLEIHIQLNTRRKLFCDDEPHFRLERRLHISLSEWEVRKRRRYVYEGYRDTALGVAKMFNAKP
GATE_SULSO      ----------------------------------------------------------------------
GATE_PYRAE      -------GLEIHIQLNTQRKLFCDDEPHFRVERRLHISVSEWEVRKRRKYIYEGYRDTAVAVAKMFNAKL
GATE_SULIA      ----------------------------------------------------------------------
GATE_PYRFU      INYEEVVGLEIHRQLDTK-KLFSPVPSKLSDD-------VDFTFPAALEEFKKGALEVALQIAYLLNAKP
GATE_PYRAR      -------GLEIHIQLNTRRKLFCDDEPHFRVERRLHISVSEWEVRKRRKYIYEGYRDTAVAVAKMFNAKL
GATE_PYRKO      ------VGLEIHRQLDTK-KLFSPVPSELSDE-------VDFTFPAALEEFKKGALEVALQIGYLLNAKP
GATE_METBF      --------------------------------------------------LNKEALDISLGIAKLFNMKP
GATE_METMA      --------------------------------------------------LNREALDISLGVAKLFNMKP
GATE_THEGJ      ------VGLEIHRQLDTK-KLFSPVPSEL-------TEKVDFTFPAALEEFKKGALEVTLQIAYLLNAKP
GATE_SULIY      ----------------------------------------------------------------------
GATE_SULIN      ----------------------------------------------------------------------
GATE_SULIM      ----------------------------------------------------------------------
GATE_SULIL      ----------------------------------------------------------------------
GATE_SULIK      ----------------------------------------------------------------------
GATE_PYRHO      ------VGLEIHRQLDTK-KLFSPVPTKFSDE-------VDFTFPAALEEFKKGRVEVALQIAYLLNAKP
GATE_THESM      ----------------------------------------------------------------------
GATE_HALSA      -----------------------------------------------------------------LGMDA
GATE_HALS3      -----------------------------------------------------------------LGMDA
GATE_NATPD      ----------------------------------------------------------------------
GATE_PYRAB      ---------------------------------------------------DREALEVALQIAYLLNAKP
GATE_THEAC      -------------------------------------------------------IATAISVSKALNCDI
GATE_METHJ      ----------------------------------------------------------------------
GATE_CALMQ      ------VGLEIHIQLDTGRKLFCHCKPELKNTEPSELSSIDWEFRKMKTMMYEGFNDVALAVSKVFNAKV
MRAW_RHOPA      ----------------------------------------------------------------------
BIN3_MOUSE      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           HKKMHFDRKNYFYPDNPKAYQISQFDEPIGYNGWIEVELEDGTTKKIGIERAHLEEDAGKNTHGTDGYSY
GATB_STRP4      HKKMHFDRKNYFYPDNPKAYQISQFDEPIGYNGWIEVELEDGTTKKIGIERAHLEEDAGKNTHGTDGYSY
GATB_STRR6      HKKMHFDRKNYFYPDNPKAYQISQFDEPIGYNGWIEVELEDGTTKKIGIERAHLEEDAGKNTHGTDGYSY
GATB_STRP2      HKKMHFDRKNYFYPDNPKAYQISQFDEPIGYNGWIEVELEDGTTKKIGIERAHLEEDAGKNTHGTDGYSY
GATB_STRZT      HKKMHFDRKNYFYPDNPKAYQISQFDEPIGYNGWIEVELEDGTTKKIGIERAHLEEDAGKNTHGTDGYSY
GATB_STRZJ      HKKMHFDRKNYFYPDNPKAYQISQFDEPIGYNGWIEVKLEDGTTKKIGIERAHLEEDAGKNTHGTDGYSY
GATB_STRPN      HKKMHFDRKNYFYPDNPKAYQISQFDEPIGYNGWIEVKLEDGTTKKIGIERAHLEEDAGKNTHGTDGYSY
GATB_STRPI      HKKMHFDRKNYFYPDNPKAYQISQFDEPIGYNGWIEVELEDGTTKKIGIERAHLEEDAGKNTHGTDGYSY
GATB_STRPS      HKKMHFDRKNYFYPDNPKAYQISQFDEPIGYNGWIEVELEDGTTKKIGIERAHLEEDAGKNTHGTDGYSY
GATB_STRP7      HKKMHFDRKNYFYPDNPKAYQISQFDEPIGYNGWIEIELEDGTTKKIGIERAHLEEDAGKNTHGTDGYSY
GATB_STRPJ      HKKMHFDRKNYFYPDNPKAYQISQFDEPIGYNGWIEVELEDGTTKKIGIERAHLEEDAGKNTHGTDGYSY
GATB_STRZP      HKKMHFDRKNYFYPDNPKAYQISQFDEPIGYNGWIEVKLEDGTTKKIGIERAHLEEDAGKNTHGTDGYSY
GATB_STRT2      HQHMHFDRKNYFYPDNPKAYQISQFDEPIGYNGWIEVQLEDGTTKKIGIERAHLEEDAGKNTHGTDGFSY
GATB_STRT1      HQHMHFDRKNYFYPDNPKAYQISQFDEPIGYNGWIEVQLEDGTTKKIGIERAHLEEDAGKNTHGTDGFSY
GATB_STRTD      HQHMHFDRKNYFYPDNPKAYQISQFDEPIGYNGWIEVQLEDGTTKKIGIERAHLEEDAGKNTHGTDGFSY
GATB_STRP8      HKEMHFDRKNYFYPDNPKAYQISQFDEPIGYNGWIEIKLEDGSTKKIRIERAHLEEDAGKNTHGTDGYSY
GATB_STRPD      HKEMHFDRKNYFYPDNPKAYQISQFDEPIGYNGWIEIKLEDGSTKKIRIERAHLEEDAGKNTHGTDGYSY
GATB_STRP3      HKEMHFDRKNYFYPDNPKAYQISQFDEPIGYNGWIEIKLEDGSTKKIRIERAHLEEDAGKNTHGTDGYSY
GATB_STRP1      HKEMHFDRKNYFYPDNPKAYQISQFDEPIGYNGWIDIKLEDGSTKKIRIERAHLEEDAGKNTHGTDGYSY
GATB_STRPZ      HKEMHFDRKNYFYPDNPKAYQISQFDEPIGYNGWIDIKLEDGSTKKIRIERAHLEEDAGKNTHGTDGYSY
GATB_STRPM      HKEMHFDRKNYFYPDNPKAYQISQFDEPIGYNGWIEIKLEDGSTKKIRIERAHLEEDAGKNTHGTDGYSY
GATB_STRPC      HKEMHFDRKNYFYPDNPKAYQISQFDEPIGYNGWIKIKLEDGSTKKIRIERAHLEEDAGKNTHGTDGYSY
GATB_STRPB      HKEMHFDRKNYFYPDNPKAYQISQFDEPIGYNGWIKIKLEDGSTKKIRIERAHLEEDAGKNTHGTDGYSY
GATB_STRPG      HKEMHFDRKNYFYPDNPKAYQISQFDEPIGYNGWIEIKLEDGSTKKIRIERAHLEEDAGKNTHGTDGYSY
GATB_STRP6      HKEMHFDRKNYFYPDNPKAYQISQFDEPVGYNGWIEIKLEDGSTKKIRIERAHLEEDAGKNTHGTDGYSY
GATB_STRPF      HKEMHFDRKNYFYPDNPKAYQISQFDEPIGYNGWIDIKLEDGSTKKIRIERAHLEEDAGKNTHGTDGYSY
GATB_STRSY      HKDMHFDRKNYFYPDNPKAYQISQFDEPIGYNGWIEIELEDGSTKKIRIERAHLEEDAGKNTHGTDGYSY
GATB_STRS2      HKDMHFDRKNYFYPDNPKAYQISQFDEPIGYNGWIEIELEDGSTKKIRIERAHLEEDAGKNTHGTDGYSY
GATB_STRS7      HQHMHFDRKNYFYPDNPKAYQISQFDEPIGYNGWIDITLEDGSTKKIRIERAHLEEDAGKNTHGTDGYSY
GATB_STREM      HQHMHFDRKNYFYPDNPKAYQISQFDEPIGYNGWIDITLEDGSTKKIRIERAHLEEDAGKNTHGTDGYSY
GATB_STRU0      HKKMHFDRKNYFYPDNPKAYQISQFDEPIGFNGWIDITLEDGTSKKIRIERAHLEEDAGKNTHGTDGYSY
GATB_STRE4      HQHMHFDRKNYFYPDNPKAYQISQFDEPIGYNGWIDITLEDGSTKKIRIERAHLEEDAGKNTHGTDGYSY
GATB_STRA3      HQNMHFDRKNYFYPDNPKAYQISQFDEPIGYNGWIEIELEDGTRKKIRIERAHLEEDAGKNTHGTDGYSY
GATB_STRA5      HQNMHFDRKNYFYPDNPKAYQISQFDEPIGYNGWIEIELEDGTRKKIRIERAHLEEDAGKNTHGTDGYSY
GATB_STRA1      HQNMHFDRKNYFYPDNPKAYQISQFDEPIGYNGWIEIELEDGTRKKIRIERAHLEEDAGKNTHGTDGYSY
GATB_STRGC      HQKMHFDRKNYFYPDNPKAYQISQFDEPIGYNGWIEIELEDGTTKKIRIERAHLEEDAGKNTHGSDGYSY
GATB_STRSV      HQKMHFDRKNYFYPDNPKAYQISQFDEPIGYNGWIEIELEDGTTKKIRIERAHLEEDAGKNTHGSDGYSY
GATB_STRMU      HQRMHFDRKNYFYPDNPKAYQISQFDEPIGYNGWIEIELEDGSTKKIRIERAHLEEDAGKNTHGADGYSY
GATB_LACLM      HKSMHFDRKNYFYPDNPKAYQISQFDEPIGYNGSIEIELEDGHKATIRIERAHLEEDAGKNTHGTDGYSY
GATB_LACLS      HKSMHFDRKNYFYPDNPKAYQISQFDEPIGYNGSIEIELEDGHKATIRIERAHLEEDAGKNTHGTDGYSY
GATB_LACLA      HKSMHFDRKNYFYPDNPKAYQISQFDEPIGYNGSIEIELEDGHKATIRIERAHLEEDAGKNTHGTDGYSY
GATB_ENTFA      SKETHFDRKNYFYPDNPKAYQISQFDQPIGHDGWXXXXXXXXXXXXXXXXX-HLEEDAGKNIHGTDGYSY
GATB_OCEIH      ATDTKFDRKNYFYPDNPKAYQISQFDQPIGENGWIEIEV-NGEKKKIGITRLHLEEDAGKLTHGEDGYSY
GATB_LYSSC      EQETKFDRKNYFYPDNPKAYQISQFDKPIGKNGWIDIEV-DGYTKRIGITRLHMEEDAGKLSHAGD-HSL
GATB_BACA2      ATDTKFDRKNYFYPDNPKAYQISQFDKPIGENGWIEIEV-GGKTKKIGITRLHLEEDAGKLTHTGDGYSL
GATB_BACP2      ATDTKFDRKNYFYPDNPKAYQISQFDKPIGENGWIEIEVE-GKTKRIGITRLHLEEDAGKLTHTGDGYSL
GATB_BACLD      ATDTKFDRKNYFYPDNPKAYQISQFDKPIGENGWIEIEV-GGKTKRIGITRLHLEEDAGKLTHTGDGYSL
GATB_BACSK      ATDTKFDRKNYFYPDNPKAYQISQFDKPIGEHGWIEIEV-GGKKKRIGITRLHLEEDAGKLTHGTDGHSL
GATB_BACSU      ATDTKFDRKNYFYPDNPKAYQISQFDKPIGENGWIEIEV-GGKTKRIGITRLHLEEDAGKLTHTGDGYSL
GATB_LACS1      TQDVGFDRKNYFYPDNPKAYQITQARTPIGTNGWLEIELEDGTKKKIGIREMHVEEDAGKNTHNPDGYSY
GATB_BACCN      ATETKFDRKNYFYPDNPKAYQISQFDKPIGQNGWIEIEV-GGQKKRIGITRLHLEEDAGKSTHTGEGYSL
GATB_LISMF      AKHTKFDRKNYFYPDNPKAYQISQFDKPIGEHXXXXXXXXXXXXXXXXT-RLHLEEDAGKNTHTSHGYSL
GATB_LISMC      AKHTKFDRKNYFYPDNPKAYQISQFDKPIGEHXXXXXXXXXXXXXXXXT-RLHLEEDAGKNTHTSHGYSL
GATB_MACCJ      RTETKFDRKNYFYPDNPKAYQISQFDEPIGENGYIDIEV-NGETKRIGITRLHMEEDAGKLTH-KDGYSL
GATB_LACBA      EQHTHFDRKNYFYPDNPKAYQITQSDKPIGHDGWVEIDV-DGVKKKIGIAEMHIEEDAGKNTHERD-YSY
GATB_LISMH      AEHTKFDRKNYFYPDNPKAYQISQFDKPIGEHXXXXXXXXXXXXXXXXT-RLHLEEDAGKNTHTSHGYSL
GATB_BACHD      ATDTKFDRKNYFYPDNPKAYQISQFDKPIGENGWIEIEV-DGTKKKIGITRLHLEEDAGKLTHSGNGYSL
GATB_GEOKA      ATETKFDRKNYFYPDNPKAYQISQYDQPLGRNGWIEIEV-NGKKKKIGITRIHLEEDAGKLTHTGDGYSL
GATB_LISMO      AEHTKFDRKNYFYPDNPKAYQISQFDKPIGEHXXXXXXXXXXXXXXXXT-RLHLEEDAGKNTHTSHGYSL
GATB_BACWK      ATETKFDRKNYFYPDNPKAYQISQFDKPIGENGWIEIEV-DGKKKRIGITRLHLEEDAGKSTHAADG-SL
GATB_BACC4      ATETKFDRKNYFYPDNPKAYQISQFDKPIGENGWIEIEV-DGKKKRIGITRLHLEEDAGKSTHTADG-SL
GATB_LISIN      AEHTKFDRKNYFYPDNPKAYQISQFDKPIGEHXXXXXXXXXXXXXXXXT-RLHLEEDAGKNTHTSHGYSL
GATB_LACSS      ARDTHFDRKNYFYPDNPKAYQITQYEQPLGKDGYIEVEI-DGHKKQIGIAELHVEEDAGKNTHGSDGYSY
GATB_LACRJ      AHHMHFDRKNYFYPDNPKAYQITQSDTPIAHDGWIEIEV-NGKKKKIGIKEMHIEEDAGKNTH-TSKYSY
GATB_LACRD      AHHMHFDRKNYFYPDNPKAYQITQSDTPIAHDGWIEIEV-NGKKKKIGIKEMHIEEDAGKNTH-TSKYSY
GATB_BACC7      ATETKFDRKNYFYPDNPKAYQISQFDKPIGENGWIEIEV-DGKKKRIGITRLHLEEDAGKSTHTADG-SL
GATB_BACC1      ATETKFDRKNYFYPDNPKAYQISQFDKPIGENGWIEIEV-DGKKKRIGITRLHLEEDAGKSTHTADG-SL
GATB_BACC3      ATETKFDRKNYFYPDNPKAYQISQFDKPIGENGWIEIEV-DGKKKRIGITRLHLEEDAGKSTHTADG-SL
GATB_BACC0      ATETKFDRKNYFYPDNPKAYQISQFDKPIGENGWIEIEV-DGKKKRIGITRLHLEEDAGKSTHTADG-SL
GATB_BACAN      ATETKFDRKNYFYPDNPKAYQISQFDKPIGENGWIEIEV-DGKKKRIGITRLHLEEDAGKSTHTADG-SL
GATB_BACAH      ATETKFDRKNYFYPDNPKAYQISQFDKPIGENGWIEIEV-DGKKKRIGITRLHLEEDAGKSTHTADG-SL
GATB_BACAC      ATETKFDRKNYFYPDNPKAYQISQFDKPIGENGWIEIEV-DGKKKRIGITRLHLEEDAGKSTHTADG-SL
GATB_BACAA      ATETKFDRKNYFYPDNPKAYQISQFDKPIGENGWIEIEV-DGKKKRIGITRLHLEEDAGKSTHTADG-SL
GATB_GEOTN      ATETKFDRKNYFYPDNPKAYQISQYDQPLGKNGWIEIEV-NGKKKKIGITRIHLEEDAGKLMHTGDGYSL
GATB_BACHK      ATETKFDRKNYFYPDNPKAYQISQFDKPIGENGWIEIEV-DGKKKRIGITRLHLEEDAGKSTHTADG-SL
GATB_BACCZ      ATETKFDRKNYFYPDNPKAYQISQFDKPIGENGWIEIEV-DGKKKRIGITRLHLEEDAGKSTHTADG-SL
GATB_BACCR      ATETKFDRKNYFYPDNPKAYQISQFDKPIGENGWIEIEV-DGKKKRIGITRLHLEEDAGKSTHTADG-SL
GATB_BACCQ      ATETKFDRKNYFYPDNPKAYQISQFDKPIGENGWIEIEV-DGKKKRIGITRLHLEEDAGKSTHTADG-SL
GATB_STAHJ      ATNSKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEV-DGETKRIGITRLHMEEDAGKSTH-KDGYSL
GATB_LACCB      TRLTHFDRKNYFYPDNPKAYQITQSEKPLGTNGWVEIEV-DGKKKKIGIAELHVEEDAGKNQHEDDGYSY
GATB_LISW6      AEHTKFDRKNYFYPDNPKAYQISQFDKPIGEHXXXXXXXXXXXXXXXXT-RLHLEEDAGKNTHTSHGYSL
GATB_BACC2      ATETKFDRKNYFYPDNPKAYQISQFDKPIGENGWIEIEV-DGKKKRIGITRLHLEEDAGKSTHTADG-SL
GATB_LACC3      TRLTHFDRKNYFYPDNPKAYQITQSEKPLGTNGWVEIEV-DGKKKKIGIAELHVEEDAGKNQHEDDGYSY
GATB_STAAU      ATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEV-DGETKRIGITRLHMEEDAGKSTHKGE-YSL
GATB_STAAR      ATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEV-DGETKRIGITRLHMEEDAGKSTHKGE-YSL
GATB_STAS1      ATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEV-DGETKRIGITRLHMEEDAGKSTH-KDGYSL
GATB_STAES      ATNSKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEV-DGETKRIGITRLHMEEDAGKSTH-KDGYSL
GATB_STAEQ      ATNSKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEV-DGETKRIGITRLHMEEDAGKSTH-KDGYSL
GATB_STAAW      ATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEV-DGETKRIGITRLHMEEDAGKSTHKGE-YSL
GATB_STAAT      ATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEV-DGETKRIGITRLHMEEDAGKSTHKGE-YSL
GATB_STAAS      ATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEV-DGETKRIGITRLHMEEDAGKSTHKGE-YSL
GATB_STAAN      ATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEV-DGETKRIGITRLHMEEDAGKSTHKGE-YSL
GATB_STAAM      ATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEV-DGETKRIGITRLHMEEDAGKSTHKGE-YSL
GATB_STAAE      ATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEV-DGETKRIGITRLHMEEDAGKSTHKGE-YSL
GATB_STAAC      ATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEV-DGETKRIGITRLHMEEDAGKSTHKGE-YSL
GATB_STAA9      ATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEV-DGETKRIGITRLHMEEDAGKSTHKGE-YSL
GATB_STAA8      ATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEV-DGETKRIGITRLHMEEDAGKSTHKGE-YSL
GATB_STAA3      ATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEV-DGETKRIGITRLHMEEDAGKSTHKGE-YSL
GATB_STAA2      ATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEV-DGETKRIGITRLHMEEDAGKSTHKGE-YSL
GATB_STAA1      ATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEV-DGETKRIGITRLHMEEDAGKSTHKGE-YSL
GATB_LACPL      EHHTYFDRKNYFYPDNPKAYQITQHEKPIAHDGWIEIEV-DGKKKKIGIEEMHIEEDAGKNTHEND-YSY
GATB_BACST      ATETKFDRKNYFYPDNPKAYQISQYDQPLGKNGWIEIEV-NGKKKKIGITRIHLEEDAGKLTHTGDGYSL
GATB_STAAB      ATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEV-DGETKRIGITRLHMEEDAGKSTHKGE-YSL
GATB_STASP      ATNSKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEV-DGETKRIGITRLHMEEDAGKSTH-KDGYSL
GATB_STACT      ATESKFDRKNYFYPDNPKAYQISQFDQPIGEHGYIDIEV-DGETKRIGITRLHMEEDAGKSTH-KDGYSL
GATB_LACF3      TKKMHFDRKNYFYPDNPKAYQITQSETPIAHDGWVEIEV-DGKKKKIGIKEMHIEEDAGKNTH-TGSYSY
GATB_PEDPA      TRTQHFDRKNYFYPDNPKAYQVTQADTPIGTDGWXXXXXXXXXXXXXXAEM-HIEEDAGKNSHNPNGYSY
GATB_LACJO      LPVTHFDRKNYFYPDNPKAYQITQFFQPLARDGYIEIEVR-GKKKRIGIHEMHIEEDAGKNTHGANGYSY
GATB_LACGA      LPVTHFDRKNYFYPDNPKAYQITQFFQPLARDGYIEVEVR-GKKKRIGIHEMHIEEDAGKNTHGANGYSY
GATB_LACAC      LPTTHFDRKNYFYPDNPKAYQITQFFQPLARDGYIEVEVR-GKKKRIGIHEMHIEEDAGKNTHGTNGYSY
GATB_LACH4      LPTTHFDRKNYFYPDNPKAYQITQFFQPLARDGYIEVEVR-GKKKRIGIHEMHIEEDAGKNTHGTNGFSY
GATB_BREBN      SRETKFDRKNYFYPDSPKAYQISQFDQPIGYNGWIDIEV-NGETKRIGITRLHLEEDAGKLTHSDGGESL
GATB_OENOB      TRDVHWDRKNYFYPDNPKSYQVTQQQTPIGHDGYVEIKKEDGTSKRIGIKELHVEEDAGKNSHSGKGYSL
GATB_LACDB      NPVTHFDRKNYFYPDNPKAYQITQFFKPLAENGYXXXXXXXXXXXXXXXXXXXXX-DAGKNTHGTNGFSY
GATB_LACDA      NPVTHFDRKNYFYPDNPKAYQITQFFKPLAENGYXXXXXXXXXXXXXXXXXXXXX-DAGKNTHGTNGFSY
GATB_THEP3      ANFSKMDRKNYFYPDLPKAYQISQYDLPLCSNGYVEIEV-DGKVKKIGIKRIHIEEDAGKLLHENTDGSL
GATB_THEPX      ANFSKMDRKNYFYPDLPKAYQISQYDLPLCSNGYVEIEV-DGKVKKIGIKRIHIEEDAGKLLHENTDGSL
GATB_THETN      ANFSKMDRKNYFYPDLPKAYQISQYDLPLCSNGYIEIEVEGGT-KRIGIKRIHIEEDAGKLLHGTDG-SL
GATB_TRIEI      ALYSKFDRKQYFYPDLPKNYQISQYDLPIAEHGWLEIEIEDGTRKKIGITRLHMEEDAGKLVHGGSDYSM
GATB_CARHZ      AEYCKFDRKNYYYPDLPKNYQISQYDLPLAKNGYLEIEV-DGQVKRIGITRIHMEEDAGKLVHAVTPYSL
GATB_CLOBK      NKVCRMDRKNYFYPDCPKNYQITQDEVPICRDGYIEIELENGEKKKIGIERIHMEEDAGKLLH-TNAGTL
GATB_CLOBH      NKVCRMDRKNYFYPDCPKNYQITQDEVPICRDGYIEIELENGEKKKIGIERIHMEEDAGKLLH-TNAGTL
GATB_CLOB1      NKVCRMDRKNYFYPDCPKNYQITQDEVPICRDGYIEIELENGEKKKIGIERIHMEEDAGKLLH-TNAGTL
GATB_CLOBM      NKVCRMDRKNYFYPDCPKNYQITQDEVPICRDGYIEIELENGEKKRIGIERIHMEEDAGKLLH-TNAGTL
GATB_CLOB6      NKVCRMDRKNYFYPDCPKNYQITQDEVPICRDGYIEIELENGEKKKIGIERIHMEEDAGKLLH-TNAGTL
GATB_CALS8      ARYSKQDRKNYFYPDLPKAYQISQYDLPLCYNGYIDIEV-NGQKKRIGIKRIHIEEDAGKLLHDQEEGSL
GATB_CLOBL      NKVCRMDRKNYFYPDCPKNYQITQDEVPICRDGYIEIELENGEKKKIGIERIHMEEDAGKLLH-TNAGTL
GATB_CLOBJ      NKVCRMDRKNYFYPDCPKNYQITQDEVPICRDGYIEIELENGEKKKIGIERIHMEEDAGKLLH-TNAGTL
GATB_ANATD      ARYSKQDRKNYFYPDLPKAYQISQYDLPLCYNGYIDIEV-NGQKKRIGIKRIHIEEDAGKLLHDQEEGSL
GATB_SYNJB      APYSKFDRKQYFYPDLPKNYQISQYDLPIATHGWIEIQLSDGRTKRIGITRLHMEEDAGKLVHGSDSYSL
GATB_MOOTA      APFCKFDRKNYYYPDLPKNYQISQYDLPLATGGYLKINV-DGQERVIGITRVHMEEDAGKLVHVDGGYSL
GATB_CLOTE      NKSSRLDRKNYFYPDCPKNYQITQDELPICKNGYIEIELENGEKKRVGIERIHIEEDAGKLLHTKAG-TL
GATB1_CLOAB     THIGRMDRKHIFYPDNSRNYQITQDELPLCTNGYIEIELEDGSKKKIGVERIHIEEDAGKLLH-TNAGTL
GATB_PERMH      HELSVFARKNYFYPDLPKGYQISQYDKPLATNGYIDIKVND-KTERIRIHRLHMEEDAGKTIH-KGSYSY
GATB_PELTS      AGFSKFDRKNYYYPDMPKNYQISQYDLPIARNGYIEIDV-NGKRKRIGITRLHMEEDTGKLVHQTTPFSL
GATB_PROMA      AKHCKFDRKQYFYPDLPKNYQISQFDEPIAEEGWIEVEVKETYLKKIGIERLHMEEDAGKLVHGSDRYSL
GATB_CYAP7      ASYSKFDRKQYFYPDLPKNYQISQYDLPIVEQGSLEIEVVDKETKEIGITRLHMEEDAGKLVHGSDRYSL
GATB_SYMTH      QRHSKFDRKNYFYADLPSGYQISQFDLPLCYDGYVDITKKDGTTRRIRIKRIHLETDAGKLLHAGDDYSL
GATB2_SYNAS     NEECSFARKNYFYPDLPKGYQISQYAYPLAEFGYVDIEVEDGK-KRIGLTRIHMEEDAGKLIHDPHNSSY
GATB_THEYD      APYSRFARKNYFYPDLPKGYQISQYELPLCEDGYLEIML-NGTKRKIRIKRIHLEEDAGKNIHDPSGYSF
GATB_GEOUR      APRSVFARKNYFYPDLPKGYQISQFELPICIDGHLDIEVEGGM-KRIGITRIHMEEDAGKLVHGVGDDSC
GATB_GEOSM      TQRNVFARKNYFYPDLPKGYQISQFDLPICQHGHLDIDLE-GERKRIGITRIHMEEDAGKLVHGVDD-SC
GATB_GEOSF      APRSIFARKNYFYPDLPKGYQISQYELPICSAGHLDIQVE-GTAKRIGITRIHMEEDAGKLVHGVGDDSC
GATB_CLOBA      TKVGRMDRKNYFYPDCPKNYQITQDELPICRNGYIDIELESGEVKRIGIERIHIEEDAGKLLHTKRG-TL
GATB_SYNJA      APYSKFDRKQYFYPDLPKNYQISQYDLPIATHGWVEIQLSDGRSKRIGITRLHIEEDAGKLVHGSDSYSL
GATB_CLOBB      TKVGRMDRKNYFYPDCPKNYQITQDELPICRDGYIDIELESGEVKRIGIERIHIEEDAGKLLHTKRG-TL
GATB_ANASP      AKYSKFDRKQYFYPDLPKNYQISQYDLPIAEHGWLEIELLDADRKRIGITRLHMEEDAGKLVHGSDRYSL
GATB_LEPIN      TLFTKFDRKNYFYPDLPKGYQISQFDKPICTGGGVTFTIKEDSARYVRLTRIHLEEDAGKLIHSADPQSY
GATB_SYNY3      APYSKFDRKQYFYPDLPKNYQISQFDLPIVEHGSLEIELVDKKTKEIGITRLHMEEDAGKLVHGSDRHSL
GATB_LEPIC      TLFTKFDRKNYFYPDLPKGYQISQFDKPICTGGGVTFTIKEDSARYVRLTRIHLEEDAGKLIHSADPQSY
GATB_GEOBB      TKRNVFARKNYFYPDLPKGYQISQFDLPICQHGHLDIEVE-GEKKRIGITRIHMEEDAGKLVHGVDD-SC
GATB_PELCD      APRSIFARKNYFYPDLPKGYQISQFELPICEHGRLDIDV-DGTSKSIGITRIHMEEDAGKLLHDDGDTSR
GATB_PSEU2      GQHNVFARKNYFYPDLPKGYQISQMELPIVGKGHLDIPLEDGTVKRIGITRAHLEEDAGKSLHEDQGMTG
GATB_LEPBL      SLFTKFDRKNYFYPDLPKGYQISQFDKPICTGGGVTFTIKEESSRYVRLTRIHMEEDAGKLIHSADPQSY
GATB_LEPBJ      SLFTKFDRKNYFYPDLPKGYQISQFDKPICTGGGVTFTIKEESSRYVRLTRIHMEEDAGKLIHSADPQSY
GATB_PSESM      GQHNVFARKNYFYPDLPKGYQISQMELPIVGKGHLDIPLEDGTVKRVGITRAHLEEDAGKSLHEDQGMTG
GATB_CYAA5      APYSKFDRKQYFYPDLPKNYQISQFDLPIVEHGSLEIELVDKTRKTIGITRLHMEEDAGKLVHGSDRHSL
GATB_PSE14      GQHNVFARKNYFYPDLPKGYQISQMELPIVGKGHLDITLEDGTVKRIGITRAHLEEDAGKSLHEDQGMTG
GATB_SYNPW      AEHSKFDRKQYFYPDLPKNYQISQYDEPIAEDGWIEVEVKDTYLKTIGIERLHMEEDAGKLVHGSDRHSL
GATB_ANAVT      AKYSKFDRKQYFYPDLPKNYQISQYDLPIAEHGWLEIELLDAERKRIGITRLHMEEDAGKLVHGSDRYSL
GATB_SYNPX      AEHSKFDRKQYFYPDLPKNYQISQYDEPIAEEGWIEVEVKDTYLKKIGIERLHMEEDAGKLVHGSDRHSL
GATB_PSEU5      AEKNVFARKNYFYPDLPKGYQTSQMDHPIVGKGHLDITLEDGSTRRIGITRAHLEEDAGKSLHEDHGMSG
GATB_PROM1      ASHSKFDRKQYFYPDLPKNYQISQFDEPIAEDGWIEVEVKETYVKKIGIERLHMEEDAGKLVHGSDQHSL
GATB_PELPD      TQRSIFARKNYFYPDLPKGYQISQFEDPVCQWGWLDIEL-NGETKRIGITRIHMEEDAGKLVHADDG-SG
GATB_NEIMA      NRKNVFDRKNYFYPDLPKGYQISQLDLPIVEHGKLEIVVGDDV-KTINVTRAHMEEDAGKSVHGLNGATG
GATB_DESMR      NPVSVFARKNYFYPDLPKGYQTSQFEQPICEHGHVDITV-DGTAKRIGITRIHMEEDAGKNIHSADNLSY
GATB_PROMT      ASHSKFDRKQYFYPDLPKNYQISQFDEPIAEDGWIEVEVKETYVKKIGIERLHMEEDAGKLVHGSDQHSL
GATB_COXB2      PPYSIFARKNYFYPDLPKGYQISQYNFPIVQNGHLDIENEDGTTKRIGITRAHLEEDAGKSFHGMQGYSG
GATB_CLONN      NKLCRMDRKNYYYVDCPKNYQITQSEYPLCKDGYIEISLENGEAKKISIERIHIEEDAGKLIHNSQG-TF
GATB_HERA2      PEYCEFSRKSYTYPDLPKAWQITMYDKPICINGELEITLGNGETKRVGITRAHLEEDTGMLQHGDETHSL
GATB_PROM9      AEHCKFDRKQYFYPDLPKNYQISQFDEPLAENGWLEVEIKDPYTKKIGIERLHMEEDAGKLVHGSDRYSL
GATB_NEIMB      NQKNVFDRKNYFYPDLPKGYQISQLDLPIVEHGKLEIVVGDDV-KTINVTRAHMEEDAGKSVHGLNGATG
GATB_COXBR      PPYSIFARKNYFYPDLPKGYQISQYNFPIVQNGHLDIENEDGTTKRIGITRAHLEEDAGKSFHGMQGYSG
GATB_COXBN      PPYSIFARKNYFYPDLPKGYQISQYNFPIVQNGHLDIENEDGTTKRIGITRAHLEEDAGKSFHGMQGYSG
GATB_COXB1      PPYSIFARKNYFYPDLPKGYQISQYNFPIVQNGHLDIENEDGTTKRIGITRAHLEEDAGKSFHGMQGYSG
GATB_PSEMY      APQNVFARKNYFYPDLPKGYQTSQMDHPIVGKGHLDITLEDGTVKRIGITRAHLEEDAGKSLHEDHGMSG
GATB_DESPS      NQWNQFARKNYFYPDLPKGYQTSQFDLPIVEGGHIEIEV-DGVSKVIGITRMHMEEDAGKLVHDVEPVSH
GATB_DESDG      NNDSVFARKNYFYPDLPYGYQISQFERPLCEHGHLDIPVNGGT-KRIGITRIHMENDAGKNIHSADNASY
GATB_NEIG2      NRKNVFDRKNYFYPDLPKGYQISQLDLPIVEHGKLEIVV-GGDVKTINVTRAHMEEDAGKSVHGLNGATG
GATB_NEIG1      NRKNVFDRKNYFYPDLPKGYQISQLDLPIVEHGKLEIVV-GGDVKTINVTRAHMEEDAGKSVHGLNGATG
GATB_SYNE7      APYSKFDRKQYFYPDLPKNYQISQYDLPIAEHGWIEIEVKEPYTKKIGVTRLHMEEDAGKLVHGSDRHSL
GATB_THISH      SPRSVFARKNYFYPDLPKGYQISQYELPVVGLGKLEIELEDGETKVIGITRAHLEEDAGKSLHEDHGMSG
GATB_EUBE2      TQDCKFDRKNYFYPDNPQNYQISQLYLPICRNGHVDVTLSDGTEKTIRIHEIHMEEDAGKLVHDEEGVSY
GATB_GEOLS      SPTNIFARKNYFYPDLPKGYQISQFDLPICLAGHLDIAVGD-QTKRIGITRIHMEEDAGKLVHGQGGGSG
GATB_COXBU      PPYSIFARKNYFYPDLPKGYQISQYNFPIVQNGHLDIENEDGTTKRIGITRAHLEEDAGKSFHGMQGYSG
GATB_CHLT3      APYSIMARKNYFYPDLPKGYQISQFEEPICSEGYIEFDV-DGEPHKTRLVRIHIEEDAGKSIHDIGDDTY
GATB_CYAP8      ASYSKFDRKQYFYADLPKNYQISQYDLPIVEHGFLEIELVDKKTKEIGITRLHMEEDAGKLVHGSDRHSL
GATB_CLOPH      TKNCKFDRKNYFYPDLPKAYQVSQLYLPICRNGSIEIEV-DGIKKSIGIHEIHMEEDAGKLVHDPEDCTL
GATB_NEIM0      NQKNVFDRKNYFYPDLPKGYQISQLDLPIVEHGKLEIVVGDDV-KTINVTRAHMEEDAGKSVHGLNSATG
GATB_SYNS9      AEHSKFDRKQYFYPDLPKNYQISQFDQPIAEEGWIEVEVKDTYLKTIGIERLHMEEDAGKLVHGSDRHSL
GATB_PSEFS      GQHNVFARKNYFYPDLPKGYQISQMELPIVGKGYLDIPLEDGTIKRVGVTRAHLEEDAGKSLHEENGATG
GATB_PSEAB      DRQNVFARKNYFYPDLPKGYQTSQMDHPIVGKGHLDITLEDGTTKRIGITRAHLEEDAGKSLHEDQGMSG
GATB_SYNP6      APYSKFDRKQYFYPDLPKNYQISQYDLPIAEHGWIEIEVKEPYTKKIGVTRLHMEEDAGKLVHGSDRHSL
GATB_PSEAE      DRQNVFARKNYFYPDLPKGYQTSQMDHPIVGKGHLDITLEDGTTKRIGITRAHLEEDAGKSLHEDQGMSG
GATB_PSEA8      DRQNVFARKNYFYPDLPKGYQTSQMDHPIVGKGHLDITLEDGTTKRIGITRAHLEEDAGKSLHEDQGMSG
GATB_NOSP7      ARYSKFDRKQYFYPDLPKNYQISQYDLPIAEHGWLEIELVDASRKRIGITRLHMEEDAGKLVHGSDSYSL
GATB_PROA2      APHSVLARKNYFYPDLPKGYQISQFEEPICLEGCLSIDAGEGQ-RDIRLIRIHIEEDAGKSIHDIGDDTF
GATB_PSEPF      GQHNVFARKNYFYPDLPKGYQISQMELPIVGKGHLDIALEDGTVKRVGITRAHLEEDAGKSLHEESGATG
GATB_CHLPB      ARQSILARKNYFYPDLPKGYQISQFEEPICSEGMVFVDTDEGR-KNIRLVRIHIEEDAGKSIHDIGDDTF
GATB_SYNP2      SPYSKFDRKQYFYPDLPKNYQISQFDLPIVEHGHLEIEIADKPSKTIGVTRLHMEEDAGKLVHGSDRYSK
GATB_BRAHW      QKKSRFARKHYFYPDLPSYYQITQMDEPICTEGHLDITVDDGSSKSIRINRIHMEEDAGKLVHDDTGLSY
GATB_PSEF5      GQHNVFARKNYFYPDLPKGYQISQMELPIVGKGHLDIPLEDGTMKRVGITRAHLEEDAGKSLHEENGATG
GATB_PROM5      AEHCKFDRKQYFYPDLPKNYQISQFDEPLAENGWLEVEIKETYLKKIGIERLHMEEDAGKLVHGSDRYSL
GATB_DESVV      NRTSVFARKNYFYPDLPKGYQISQYEQPICEHGHLDISVGDAV-KRIGITRIHLEDDAGKNIHSAENVSY
GATB_DESVH      NRTSVFARKNYFYPDLPKGYQISQYEQPICEHGHLDISVGDAV-KRIGITRIHLEDDAGKNIHSAENVSY
GATB_NITEU      NSPSVFARKNYFYPDLPKGYQISQLEHPIVEGGHVAIQTGD-QEKTIRLTRAHLEEDAGKSTHEEHGMTG
GATB_ALHEH      APRSVFARKNYFYPDLPKGYQISQYELPIVEGGELWIELEDGERKRIGVTRAHLEEDAGKSLHEDHGMTG
GATB_PSEA7      DRQNVFARKNYFYPDLPKGYQTSQMDHPIVGKGHLDITLEDGTTRRIGITRAHLEEDAGKSLHEDQGMSG
GATB_DESAA      SPYSRFARKNYFYPDLPKGYQISQYELPIAEHGHLMVDTDQGK-KKIGITRIHMEEDAGKLTHDSHRVSR
GATB_PROMP      AEHCKFDRKQYFYPDLPKNYQISQFDEPLAENGWLEVEIKETYLKKIGIERLHMEEDAGKLVHGSDRYSL
GATB_UNCTG      NKRCTFARKQYFYPDVPKNYQITQSEPPLCSRGKLAITI-DGKEKIINITRIHLEEDAGKLVHEIGNYSL
GATB_SYNSC      AEHSKFDRKQYFYPDLPKNYQISQYDEPIAEEGCIEVEVKDTYLKTIGIERLHMEEDAGKLVHGSDRHSL
GATB_THEEB      APYSKFDRKQYFYPDLPKNYQISQYDLPIAHHGYLEIELVDGTAKKIGITRLHMEEDAGKLVHGSDAYSL
GATB_METFK      APRSVFARKNYFYPDLPKGYQISQYELPVVGKGALTIQVGD-TEKTIRITRAHLEEDAGKSMHGASGQSG
GATB_GEOSL      APRSVFARKNYFYPDLPKGYQISQYELPICQNGHLDIEV-DGQVKRIGITRIHMEEDAGKLVHGLGSGSG
GATB_GEOMG      APRSVFARKNYFYPDLPKGYQISQFELPICQNGHLDIEVE-GETKRIGITRIHMEEDAGKLVHGLGSGSG
GATB_DESVM      NPVSVFARKNYFYPDLPKGYQISQFETPICEHGHLNISV-NGQTRRIGITRIHMEDDAGKNIHSADNASY
GATB_NEIMF      NRKNVFDRKNYFYPDLPKGYQISQLDLPIVEHGKLEIVVGDDV-KTINVTRAHMEEDAGKSVHGLNGATG
GATB_EUBR3      TQYSKFDRKNYFYPDNPQNYQISQLYLPICRNGSVEIETANGK-KNVRIHEIHMEEDAGKLVHDEEDVSI
GATB_PROMM      AEHSKFDRKQYFYPDLPKNYQISQFDEPIAEEGWIEVEVKDTYLKRIGIERLHMEEDAGKLVHGSDRHSL
GATB_LEPBP      TKFTKFDRKNYFYPDLPKGYQISQFDKPYATKGGIHVLLKGEKEEKIPLTRIHMEEDAGKLIHSHDNRSY
GATB_LEPBA      TKFTKFDRKNYFYPDLPKGYQISQFDKPYATKGGIHVLLKGEKEEKIPLTRIHMEEDAGKLIHSHDNRSY
GATB_PSEPW      GKRNVFARKNYFYPDLPKGYQISQMDLPIVGKGHLDIALEDGTIKRIGVTRAHLEEDAGKSLHEDSGSTG
GATB_HALHL      APRSVFARKNYFYPDLPKGYQISQYDLPIVEGGHLDIELEDGASKRIGITRAHLEEDAGKSLHEDHGMTG
GATB_CHLCH      APHSVLARKNYFYPDLPKGYQISQFEEPICSDGSIDVEL-DGVNRTIHLIRIHIEEDAGKSIHDIGDDTF
GATB_THICR      GRRSVFDRKNYFYPDLPKGYQTSQFSFPIVDTGGV-VEIEDGEIKKIGVTRAHLEEDAGKSIHDAPGQTG
GATB_PROM3      AEHSKFDRKQYFYPDLPKNYQISQFDEPIAEEGWIEVEVKDTYLKRIGIERLHMEEDAGKLVHGSDRHSL
GATB_CLOK5      NNKSRMDRKNYFYADCPKNYQITQQEIPICREGFIEIRNHLGEKKRIGIERIHMEEDAGKLIH-TDEGTL
GATB_CLOK1      NNKSRMDRKNYFYADCPKNYQITQQEIPICREGFIEIRNHLGEKKRIGIERIHMEEDAGKLIH-TDEGTL
GATB_BDEBA      RRKSVFARKNYFYPDLPKGYQISQYDQPICENGSITFKV-DGKEKTVSITRAHMEEDAGKSNHHGE-YTL
GATB_METCA      APVSVFARKNYFYPDLPKGYQISQYDLPVVARGKLSINV-DGKALTIGITRAHLEEDAGKSLHEDHGYTG
GATB_NITMU      NSPSIFARKNYFYPDLPKGYQISQYELPVVEGGHIQLQVQDGKEKTVRLVRAHLEEDAGKSLHEDHGMSG
GATB_GLOVI      HPQSKFDRKQYFYPDLPKNYQISQYDLPLAERGWLEIEVEGEPAKRIGITRLHMEEDAGKLVHGADRHSL
GATB_CELJU      GKRSVFERKNYFYPDLPKGYQTTQLAEPIVGAGYVDLELEGGRTKRVRIHHAHLEEDAGKSLHEDAGMSG
GATB_RHOCS      NLRSVFDRKNYFYADLPAGYQISQFQQPVVGNGTIVLDLADGSTREVGIERLHLEIDAGKSLHDQPSKTY
GATB_NITOC      AKHSVFARKNYFYPDLPKGYQISQYELPIVADGHVIIELEDGVEKRIEIVRAHLEEDAGKSLHEDHGMTG
GATB_CHLL2      APSSILARKNYFYPDLPKGYQISQFEEPICTEGMLRIDVGDGC-RDIRLIRIHIEEDAGKSIHDIGDDTY
GATB_PSEPK      GKRNVFARKNYFYPDLPKGYQISQMDLPIVGKGHLDIALEDGTIKRIGVTRAHLEEDAGKSLHEDSGSTG
GATB_PSEP1      GKRNVFARKNYFYPDLPKGYQISQMDLPIVGKGHLDIALEDGTIKRIGVT