[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for spne4:ACF56676.1

[Show Plain Result]


## Summary of Sequence Search
    1::364
    1::364     6e-92  47%  369 aa  METB_HAEIN RecName: Full=Cystathionine gamma-synthase;       
    4::362     8e-92  48%  373 aa  METB_BACSU RecName: Full=Cystathionine gamma-synthase;       
    5::377     1e-83  46%  379 aa  MCCB_BACSU RecName: Full=Cystathionine gamma-lyase;       
    4::378     3e-78  43%  380 aa  METC_LACLM RecName: Full=Cystathionine beta-lyase;       
    4::378     3e-78  43%  380 aa  METC_LACLA RecName: Full=Cystathionine beta-lyase;       
    4::378     4e-77  43%  380 aa  METC_LACLC RecName: Full=Cystathionine beta-lyase;       
    9::385     2e-75  44%  387 aa  CGL_DICDI RecName: Full=Cystathionine gamma-lyase;       
    6::387     3e-71  45%  387 aa  METC_COXBU RecName: Full=Cystathionine beta-lyase;       
    8::382     1e-68  39%  390 aa  METC_BACSU RecName: Full=Cystathionine beta-lyase metC;       
    1::363     2e-68  42%  380 aa  METB_HELPY RecName: Full=Cystathionine gamma-synthase;       
    1::375     1e-67  41%  380 aa  METB_HELPJ RecName: Full=Cystathionine gamma-synthase;       
   17::395     7e-67  40%  405 aa  CGL_PIG RecName: Full=Cystathionine gamma-lyase;       
   81::455     7e-66  38%  464 aa  METC_ARATH RecName: Full=Cystathionine beta-lyase, chloroplastic;  
   21::387     2e-64  43%  388 aa  METB_MYCLE RecName: Full=Cystathionine gamma-synthase;       
    7::376     4e-64  41%  386 aa  METB_ECOLI RecName: Full=Cystathionine gamma-synthase;       
   24::390     4e-64  40%  394 aa  CYS3_YEAST RecName: Full=Cystathionine gamma-lyase;       
   17::379     6e-62  39%  405 aa  CGL_MACFA RecName: Full=Cystathionine gamma-lyase;       
   17::381     6e-62  39%  405 aa  CGL_BOVIN RecName: Full=Cystathionine gamma-lyase;       
   21::387     8e-62  42%  388 aa  METB_MYCTU RecName: Full=Cystathionine gamma-synthase;       
   21::387     8e-62  42%  388 aa  METB_MYCBO RecName: Full=Cystathionine gamma-synthase;       
   17::395     3e-60  38%  405 aa  CGL_HUMAN RecName: Full=Cystathionine gamma-lyase;       
   29::382     1e-58  39%  390 aa  CBL_SCHPO RecName: Full=Cystathionine beta-lyase;       
   35::378     2e-58  39%  398 aa  CGL_MOUSE RecName: Full=Cystathionine gamma-lyase;       
   16::394     4e-58  36%  398 aa  CGL_RAT RecName: Full=Cystathionine gamma-lyase;       
    6::372     2e-56  38%  392 aa  CGL_CAEEL RecName: Full=Putative cystathionine gamma-lyase;        
   12::278     2e-52  40%  319 aa  METB_HERAU RecName: Full=Probable cystathionine gamma-synthase;    
   18::395     5e-48  37%  398 aa  MEGL_PSEPU RecName: Full=Methionine gamma-lyase;       
  192::561     2e-46  37%  563 aa  METB_ARATH RecName: Full=Cystathionine gamma-synthase,
    6::404     2e-42  34%  465 aa  STR3_YEAST RecName: Full=Cystathionine beta-lyase;       
   60::400     9e-37  31%  403 aa  METZ_PSEAE RecName: Full=O-succinylhomoserine sulfhydrylase;       
    7::427     5e-33  32%  429 aa  CYSD_SCHPO RecName: Full=O-acetylhomoserine (thiol)-lyase;       
   13::388     5e-32  30%  396 aa  METC_RHIL3 RecName: Full=Putative cystathionine beta-lyase;        
   36::392     3e-31  37%  398 aa  YFHE_SCHPO RecName: Full=Uncharacterized trans-sulfuration enzyme
    4::372     5e-30  32%  378 aa  YHR2_YEAST RecName: Full=Uncharacterized trans-sulfuration enzyme
    4::429     6e-30  34%  444 aa  MET17_KLULA RecName: Full=Protein MET17;Includes:  RecName:
    4::436     4e-29  32%  444 aa  MET17_YEAST RecName: Full=Protein MET17;Includes:  RecName:
   11::426     2e-28  31%  437 aa  CYSD_EMENI RecName: Full=O-acetylhomoserine (thiol)-lyase;       
   64::379     3e-25  29%  396 aa  METC_BORAV RecName: Full=Cystathionine beta-lyase;       
   91::387     2e-22  30%  395 aa  METC_ECOLI RecName: Full=Cystathionine beta-lyase metC;       
   55::309     2e-21  31%  392 aa  CYSA_STRCO RecName: Full=Putative cystathionine gamma-lyase;       
   91::387     4e-21  31%  395 aa  METC_SALTY RecName: Full=Cystathionine beta-lyase;       
   57::393     8e-20  25%  396 aa  METC_HAEIN RecName: Full=Cystathionine beta-lyase;       
  144::340     1e-11  27%  340 aa  METC_YEAST RecName: Full=Putative cystathionine beta-lyase;        
  373::612     9e-08  25%  621 aa  MET7_NEUCR RecName: Full=Cystathionine gamma-synthase;       
  304::565     8e-07  27%  575 aa  METW_YEAST RecName: Full=Putative cystathionine gamma-synthase
   13::127     3e-04  25%  127 aa  GCSH_PROVI RecName: Full=Glycine cleavage system H protein;
  355::634     5e-04  25%  639 aa  MET7_YEAST RecName: Full=Cystathionine gamma-synthase;       
    1::364

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSKELHINTILAQAGIKSDEATGALVTPLHFSTTYQHPEFGRSTGFDYTRTKNPTRSKAEEVLATIESAD
METB_HAEIN      MTQQYAIDTLLAQAGNRSDERTGAVSAPIFLSTAYGHCGIGESTGFDYTRTKNPTRTVLEETIAKLENGD
METB_BACSU      -----HVETKLAQIGNRSDEVTGTVSAPIYLSTAYRHRGIGESTGFDYVRTKNPTRQLVEDAIANLENGA
MCCB_BACSU      --------TLMIHGGITGDEKTGAVSVPIYQVSTYKQPKAGQHTGYEYSRTANPTRTALEALVTELESGE
METC_LACLM      ------IKTKVIHGGISTDKTTGAVSVPIYQTSTYKQNGLGQPKEYEYSRSGNPTRHALEELIADLEGGV
METC_LACLA      ------IKTKVIHGGISTDKTTGAVSVPIYQTSTYKQNGLGQPKEYEYSRSGNPTRHALEELIADLEGGV
METC_LACLC      ------LKTKVIHGGISTDRTTGAVSVPIYQTSTYKQNGLGQPKEYEYSRSGNPTRHALEELIADLEGGV
CGL_DICDI       ------IGTNVIHAGQSADKNTGAVIVPISLSTTFLQPSPGLHSEYDYSRSGNPTRKAFEECIAACENAK
METC_COXBU      -NKKSHIDTRVIHAGQKPDPLTGAVMTPIYTASTYAQKSPGVHQGYEYSRSQNPTRFAYERCVADLESGQ
METC_BACSU      ------LETQLVHNPFKTDGGTGAVSVPIQHASTFHQSSFEEFGAYDYSRSGTPTRTALEETIAALEGGT
METB_HELPY      ----MRMQTKLIHGGISEDATTGAVSVPIYQTSTYRQDAIGRHKGYEYSRSGNPTRFALEELIADLEGGV
METB_HELPJ      ----MRMQTKLIHGGINEDATTGAVSVPIYQTSTYRQDAIGRHKGYEYSRSGNPTRFALEELIADLEGGV
CGL_PIG         -----HFATQAIHAGQEPEQASKAVVPPISLSTTFKQEAPGQHSGFEYSRSGNPTXNCLEKAVAVLDGAK
METC_ARATH      IKEEASVSTLLVNLDNKFDPFD-AMSTPLYQTATFKQPSAIENGPYDYTRSGNPTRDALESLLAKLDKAD
METB_MYCLE      -------------AGYRPDPATGAVNVPIYASSTFAQDGVGELRGFEYARTGNPMRAALEASLATVEEGV
METB_ECOLI      --------TIAVRSGLNDDEQYGCVVPPIHLSSTYNFTGFNEPRAHDYSRRGNPTRDVVQRXXXXXXXXX
CYS3_YEAST      ----------------------GSVIEPISLSTTFKQSSPANPIGYEYSRSQNPNRENLERAVAALENAQ
CGL_MACFA       -----HFATQAIHVGQEPEQWTSRAVVPLSLSTTFKQAAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAK
CGL_BOVIN       -----HFATQAIHVGQEPEQWTSAVVPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAK
METB_MYCTU      -------------AGYRPDPATGAVNVPIYASSTFQDGVGGLRGGFEYARTGNPTRXXXXXXXXXXXXXX
METB_MYCBO      -------------AGYRPDPATGAVNVPIYASSTFQDGVGGLRGGFEYARTGNPTRXXXXXXXXXXXXXX
CGL_HUMAN       -----HFATQAIHVGQDPEQWTSAVVPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAK
CBL_SCHPO       ---------------------------PIYQSATFKQPCLEHMGKFDYTRSGNPTRSVLQVHLAKLMKAK
CGL_MOUSE       -----------------------AVVLPISLATTFKQDFPGQSSGFEYSRSGNPTRNCLEKAVAALDGAK
CGL_RAT         -----HFATQAIHVGPEPEQSSRAVVLPISLATTFKQDSPGQSSGFVYSRSGNPTRNCLEKAVAALDGAK
CGL_CAEEL       -----HFGTAAIHVGQEPEQDMNQVVPPISLSSTYKQDNPGEPKGHDYSRAGNPTRDVLQKNLAALEDAK
METB_HERAU      -------------AGQDPESVTGAVIVPIYQTSTYAQRGVGDHTGYEYSRTDNPTRTALQTCLAALEEAK
MEGL_PSEPU      --------------GYDPQDHGGALVPPVYQTATFTFPTVGEQAGHFYSRISNPTLNLLEARXXXXXXXX
METB_ARATH      ---------------------TDAITTPVFFKKTAELIDFKRSVSFEYGRYGNPTTVVLEDKISALEGAE
STR3_YEAST      ------LDTVVVNTGSQNDQHS-ASVPPVYLSTTFKVDLNNEDANYDYSRSGNPTRSVLQHQIGKLYRVE
METZ_PSEAE      ----------------------------------------GEVPGNVYSRYTNPTVRTFEERIAALEGAE
CYSD_SCHPO      -----HFETLQLHAGQEPDAATSSRAVPIYATTSYVFRDFGQEPGYIYSRMMNPTADVFEKRIXXXXXXX
METC_RHIL3      ------INTRLTHIGNDPFDYHGFINPPVVHASTVLFPNARRTQKYTYGTRGTPTTDALCEAIDALEGSA
YFHE_SCHPO      ---------------------------PIHISTTYTYPPFTKLAEEDYARISGNNVDRAEASLSSVLGAP
YHR2_YEAST      ------LSTALIHGDDKDNRVTD-VAPPINVSTTFRYDDWTERENLDYSRLAHPNSTRLESIFSEILDG-
MET17_KLULA     -----HFDTLQLHAGQKTADAHNPRAVPIYATTSYVFNDFGLETGYIYSRIMNPTLDVLEKRXXXXXXXX
MET17_YEAST     -----HFDTVQLHAGQENDNAHRSRAVPIYATTSYVFENFGLEVGYVYSRFQNPTSNVLEERIXXXXXXX
CYSD_EMENI      --------TLQLHAGQEPDPATNSRAVPIYATTSYTFNDFGKEFGNIYSRIMNPTVDVFEKRIAALEGXX
METC_BORAV      -----------------------------------------------YGRMGMDTHAALEQVFAELEGGT
METC_ECOLI      ----------------------------------------------------------ANSILAFIEQGD
CYSA_STRCO      ----------------------------------------GDPTGYTYGRDENPTWTRLESAIGELEAPG
METC_SALTY      ----------------------------------------------------------ANTILAFVEQGD
METC_HAEIN      -----------------------------------------------YGRRGTLTHFALQDLMCEMEGGA
METC_YEAST      ----------------------------------------------------------------------
MET7_NEUCR      ----------------------------------------------------------------------
METW_YEAST      ----------------------------------------------------------------------
GCSH_PROVI      ----------------------------------------------------------------------
MET7_YEAST      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           YALATSSGMSAIVLAFSGFPVGSKVLAVRDLYGGSFRWFNQVEQEGRFHFTYANTEEELIAELEKDVDVL
METB_HAEIN      RGFAFSSGMAAIQVLMTLFTAPDEWIVSSDVYGGTYRLLDSYKNNNSVKPVYVNTASAIEAAINPNTKAI
METB_BACSU      RGLAFSSGMAAIQTIMALFKSGDELIVSSDLYGGTYRLFNEWKKYGTFHYDDFSDEDCLRSKITPNTKAV
MCCB_BACSU      AGYAFSSGMAAITAVMMLFNSGDHVVLTDDVYGGTYRVMTKVLNRLGIESTFVDTSEEVEKAIRPNTKAI
METC_LACLM      QGFAFSSGLAGIHAVLSLFSAGDHIILADDVYGGTFRLMDKVLTKTGIIYDLVDLSDDLKAAFKEETKAI
METC_LACLA      QGFAFSSGLAGIHAVLSLFSAGDHIILADDVYGGTFRLMDKVLTKTGIIYDLVDLSDDLKAAFKEETKAI
METC_LACLC      QGFAFSSGLAGIHAVLSLFSAGDHIILADDVYGGTFRLVDKVLTKTGIIYDLVDLSEDLKAAFKAETKAV
CGL_DICDI       YALSFASGLATLTTITHLLKSGDEVISIDDVYGGTRRYFTRVAADLKFSFVDLSTLDDLKNAFTDKTRLV
METC_COXBU      HGFAFASGMAATATILELLQPGDHVVVMDDVYGGSYRLFENVRKRSSFSFVDFTDENKVREAVTAKTKML
METC_BACSU      RGFAFSSGMAAISTAFLLLSQGDHVLVTEDVYGGTFRMVTEVLTRFGIEHTFVDMTDEVARSIKPNTKVI
METB_HELPY      KGFAFASGLAGIHAVFSLLQSGDHVLLGDDVYGGTFRLFNQVLVKNGLSCTIIDTSDQIKKAIKPNTKAL
METB_HELPJ      KGFAFASGLAGIHAVFSLLQSGDHVLLGDDVYGGNFRLFNKVLVKNGLSCTIIDTSDQIKKAIKPNTKAL
CGL_PIG         YSLAFASGLAATVTITHLLKAGXQIISMDDVYGGTNRYFRQVAAEFGLKISFVDCSKSKLLEITPETKLV
METC_ARATH      RAFCFTSGMAALSAVTHLIKNGEEIVAGDDVYGGSDRLLSQXXXXXXXXXXXXNTTDEVAAAIGPQTKLV
METB_MYCLE      FARAFSSGMAASDCALRVMRPGDHVIIPDDVYGGTFRLIDKVFTQWNVDYTPVPLSDAVRAAITSRTRLI
METB_ECOLI      XXVLTNTGMSAIHLVTTVFKPGDLLVAPHDCYGGSYRLFDSLAKRGRVLFVDQGDEQALRAALAEKPKLV
CYS3_YEAST      YGLAFSSGSATTATILQSLPQGSHAVSIGDVYGGTHRYFTKVANAHGVETSFTNDLLNDLPQLIKETKLV
CGL_MACFA       YCLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEITPETKLV
CGL_BOVIN       YSLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVATEFGLKISFVDCSKPKLLEITPETKLV
METB_MYCTU      FARAFSSGMAATDCALRAMRPGDHVVIPDDAYGGTFRLIDKVFTRWDVQYTPVRLADAVGAAITPRTRLI
METB_MYCBO      FARAFSSGMAATDCALRAMRPGDHVVIPDDAYGGTFRLIDKVFTRWDVQYTPVRLADAVGAAITPRTRLI
CGL_HUMAN       YCLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEITPETKLV
CBL_SCHPO       HAFVTSNGMSALDMILRCCKSNSHVVAGHDLYGGSDRLLSFNQRQYGFKVDNVDTSDAFEAALRPDTNLV
CGL_MOUSE       HSLAFASGLAATITITHLLKAGDEIICMDEVYGGTNRYFRRVASEFGLKISFVDCSKTKLLEITPQTKLV
CGL_RAT         HCLTFARGLAATTTITHLLKAGDEVICMDEVYGGTNRYFRRVASEFGLKISFVDCSKTKLLEITPQTKLV
CGL_CAEEL       HCQVFSSGLAATSAIINLLKYGDHIVCSDDVYGGTQRYIRRVAVPNH-GLEVDSVDLTDVQNLEKAIKMV
METB_HERAU      HALVFASGLGASTTLMLMLKAGDHVICGDDVYGGTYRLFQRVMTEHGLSFDFIDMAEAVRAAIKPNTRLI
MEGL_PSEPU      XXXXXXXXXXXITSTWTLLRPGDEVLLGNTLYGCTFAFLHHGIGEFGVKLRHVDMADALEAAMTPATRVI
METB_ARATH      STLVMASGMCATVMLLALVPAGGHIVTTTDCYRKTRIFMENFLPKLGITVTVIDPAD--IAGLEAAVNLF
STR3_YEAST      NVLAVSSGMTALDVILRGLVLLNTIIAGDDLYGGTQRLLNFFKQQSHAVSVHVDTSDTVFQSLDK-VDCV
METZ_PSEAE      QAVATASGMSAILLVMSLCSSGDHVLVSRSVFGSTISLFDKYFKRFGIQVDYPPLSDLAAAACKPNTKLF
CYSD_SCHPO      XXXXXXXXXXXLFMALTTLAAGDNIVSTSYLYGGTYNLFKVTLPRLGITTKFVNGDDDLAAQIDENTKAV
METC_RHIL3      GTILVPSGLAAVTIPFLGFAAGDHALVVDSVYGPTRHFCDTMLKRLGVEVEYYHPEIGAGIEFRSNTKLV
YFHE_SCHPO      -SVVYSSGLAAIYGLLSY--LNPKHIAVHKPYSGTIQIIARINRLTGLETSFIDGKCDAIGE----GDVI
YHR2_YEAST      YAVIYSSGLAAFYAAMVHY--NPKKIFIGQSYHGVRAIANILTRN-------YGIEQHPLEDIEKEGDIV
MET17_KLULA     XXXXTSSGQAAQTLAVTGLATGDNIVSTSFLYGGTYNQFKRLGIEARF--VDGDKPEDFEKLFDEKTKAL
MET17_YEAST     XXXXXXXXXXXXTLAIQGLATGDNIVSTSYLYGGTYNQFKSFKRFGEARFVEGDNPEEFEKVFDERTKAV
CYSD_EMENI      XXXXXXXXXXXXFMAISALAAGDNIVSTSNLYGGTYNQFKVLFPRLGIKFVQGXXXXXXXXXXXXRTKAV
METC_BORAV      HCYLASSGLAGISMVFSLLSAGEHALVADCAYGPVHELHEAVLSRLGIDVTFFDAKADLASLVRPTTRLI
METC_ECOLI      HVLMTNTAYEP------SQDFCSKILSK---LGVTTSWFDPL------------IGADIVKHLQPNTKIV
CYSA_STRCO      EALVFASGMAAISVLFSQLRAGDTAVLPDDGYQALPLVRAQLEAYG-IEVRTAPTGRDAQLDVLDGAKLL
METC_SALTY      HILMTNTAYEP------SQDFCSKILGK---LGVTTSWFDPL------------IGADITQHIQPNTKVV
METC_HAEIN      GCYLYPCGTAAVTNSILSFKTGDHVLMSGAAYEPTQYFCNIVLKKMQIDITYYDPGEDIATLIQPNTKVL
METC_YEAST      --------------------------------------------------------------VKPNTTVI
MET7_NEUCR      ---------------------------------------------------------------------L
METW_YEAST      -----------------------------------------------------------VVELQKFLETV
GCSH_PROVI      ----------------------------------------------------------------------
MET7_YEAST      ------------------------------------RKFNHTHFLGQGDSTSMNALKNILHSGEQILAV-


                         +         .         .         .         .         *         .:210
query           YIETPTNPLMLEFDIEXXXXXXXXXXXXXXXDNTFYSPIYQRPIEDGADIVLHSATKYLAGHNDVLAGVV
METB_HAEIN      FIETPSNPLMEECDVVEIAKLAKKHNLMLIVDNTFLTPVLSRPLDLGADVVIHSGTKYIAGHNDALVGLI
METB_BACSU      FVETPTNPLMQEADIEHIARITKEHGLLLIVDNTFYTPVLQRPLELGADIVIHSATKYLGGHNDLLAGLV
MCCB_BACSU      YIETPTNPLLKITDLTLMADIAKKAGVLLIVDNTFNTPYFQQPLTLGADIVLHSATKYLGGHSDVVGGLV
METC_LACLM      YFETPSNPLLKVLDIKEISAIAKAHDALTLVDNTFATPYLQQPIALGADIVLHSATKYLGGHSDVVAGLV
METC_LACLA      YFETPSNPLLKVLDIKEISAIAKAHDALTLVDNTFATPYLQQPIALGADIVLHSATKYLGGHSDVVAGLV
METC_LACLC      YFETPSNPLLKVLDIKEISSIAKAHNALTLVDNTFATPYLQQPIALGADIVLHSATKYLGGHSDVVAGLV
CGL_DICDI       WIETPTNPLLKVADIKAVADYVHSRGATLVVDNTFMSPYFQNPLDLGADIVMHSVTKYINGHSDCVMGVL
METC_COXBU      WVESPSNPRLKIVDLXXXXXXXXXXXXXXVADNTFATPIIQRPLELGFDIVTHSATKYLNGHSDIIGGVV
METC_BACSU      YMETPSNPTLGITDIKAVVQLAKENGCLTFLDNTFMTPALQRPLDLGVDIVLHSATKFLSGHSDVLSGLA
METB_HELPY      YLETPSNPLLKITDLAQCASVAKDHGLLTIVDNTFATPYYQNPLLLGADIVAHSGTKYLGGHSDVVAGLV
METB_HELPJ      YLETPSNPLLKITDLAQCASVAKEHNLLTIVDNTFATPYCQNPLLLGTDIVAHNGTKYLGGHSDVVAGLV
CGL_PIG         WIETPTNPILKMIDIEACAQIVHKHGDIILVDNTFMSAYFQRPLALGADICMYSATKYMNGHSDVVMGLV
METC_ARATH      WLESPTNPRQQISDIRKISEMAHAQGALVLVDNSIMSPVLSRPLELGADIVMHSATKFIAGHSDVMAGVL
METB_MYCLE      WVETPTNPLLSIADITSIGELGKKHSVKVLVDNTFASPALQQPLMLGADVVLHSTTKYIGGHSDVVGGAL
METB_ECOLI      LVESPSNPLLRVVDIAKICHLAREVGAVSVVDNTFLSPALQNPLALGADLVLHSCTKYLNGHSDVVAGVV
CYS3_YEAST      WIETPTNPTLKVTDIQKVADLIKKHAAGQDVDNTFLSPYISNPLNFGADIVVHSATKYINGHSDVVLGVL
CGL_MACFA       WIETPTNPVLKMIDIEACAHIVHKRGDIILVDNTFMSPYFQRPLALGADICMCSATKYMNGHSDVVMGLV
CGL_BOVIN       WIETPTNPSLKMIDIEACAHTVHKHGDIILVDNTFMSAYFQRPLSLGADICMYSATKYMNGYSDVVMGLV
METB_MYCTU      WVETPTNPLLSIADITAIAELGTDRSAKVLVDNTFASPALQQPLRLGADVVLHSTTKYIGGHSDVVGGAL
METB_MYCBO      WVETPTNPLLSIADITAIAELGTDRSAKVLVDNTFASPALQQPLRLGADVVLHSTTKYIGGHSDVVGGAL
CGL_HUMAN       WIETPTNPTQKVIDIEGCAHIVHKHGDIILVDNTFMSPYFQRPLALGADISMYSATKYMNGHSDVVMGLV
CBL_SCHPO       LIESPTNPRISICDIRAIVKITRSKAKDALLDNTMLSPVLCNPLDFGYDIVYESATKYLSGHHDLMGGVI
CGL_MOUSE       WIETPTNPTLKLADIACAQIVHKRGDIILVVDNTFMSAYFQRPLALGADICMCSATKYMNGHSDVVMGLV
CGL_RAT         WIETPTNPTLKLADIKACAQIVHKHKDIILVDNTFMSAYFQRPLALGADICMCSATKYMNGHSDVVMGLV
CGL_CAEEL       WFESPSNPLLKVVDIAAVVQTAKKANPEIVVDNTFMSPYFQRPISLGADVVVHSITKYINGHSDVVMGAV
METB_HERAU      WLETPTNPLLKLAPIAAITRVAREHGIWTIVDNTFASPYNQRPITLGADMVLHSTTKYIGGHSDVVGGAI
MEGL_PSEPU      YFESPANPNMHMADIAGVAKIARKHGATVVVDNTYCTPYLQRPLELGADLVVHSATKYLSGHGDITAGIV
METB_ARATH      FTESPTNPFLRCVDIELVSKICHKRGTLVCIDGTFATPLNQKALALGADLVVHSATKYIGGHNDVLAG-C
STR3_YEAST      LLESPTNPLCKVVDIPRILRFVKCISPDTTVDNTMMSGLNCNPLQPGCDVVYESATKYLNGHHDLMGGVI
METZ_PSEAE      FVESPSNPLAELVDIAALAEIAHAKGALLAVDNCFCTPALQQPLKLGADVVIHSATKYIDXXXXXXXXXX
CYSD_SCHPO      YVESIGNPMYNVPDFERIAEVAHAAGVPLMVDNTFGGGGYLRPIDHGADIVTHSATKWXXXXNEPHPGYH
METC_RHIL3      HTEAPGSNTFEMQDIPAISAVAHRHGAVVMMDNTWATPVYFRPLDHGVDISIHASTKYPSGHSDILLGTV
YFHE_SCHPO      WLETPLNPLGIAFDIPFYKELAKKKGAILVVDSTFAPPPIQDALVLGADYVVHSATKYLAGHSDVLAGVT
YHR2_YEAST      HLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFASPPLQYAWNFGADIVLYSATKYFGGHSDLLSGVL
MET17_KLULA     YLESIGNPKYNVPDFEKIVAVAHKHGIPVVVDNTFGAGFFCQPIKYGADIVTHSATKWXXXXXXXXXXXX
MET17_YEAST     YLETIGNPKYNVPDFEKIVAIAHKHGIPVVVDNTFGAGGYFQPIKYGADIVTHSATKWXXXXXXXXXXXX
CYSD_EMENI      YVETIGNPRYNVPDFEVIAKVAHEKGIPLVVDNTFGAGGYVRPIEHGADIVVHSATKWXXGKNAAREGYH
METC_BORAV      FAEAPGSLLFEMLDMPALARFAKQHDLILATDNTWGSGYIYRPLTLGAQVSVIAGTKYVGGHSDLMLGAV
METC_ECOLI      FLESPGSITMEVHDVPAIVAAVRSVVPDAIIDNTWAAGVLFKALDFGIDVSIQAATKYLVGHSDAMIGTA
CYSA_STRCO      WIETPSNPGLDVCDVRRLVEAAHAGGALVAVDNTLATPLGQRPLELGADFSVASGTKQLTGHGDVLLGYV
METC_SALTY      FLESPGSITMEVHDIPSIVSAVRRVAPEAVIDNTWAAGVLFKALEFDIDISIQAGTKYLIGHSDAMVGTA
METC_HAEIN      FLEAPSSITMEIPDIPTIVKAARKVNPNIVIDNTWSAGVLFKALEHDIDISIQAGTKYLVGHSDIMIGTA
METC_YEAST      FLESPGSGTMEVQDIPALVSVAKKHGIKTILDNTWATPLFFDAHAHGIDISVEAGTKYLGGHSDLLIGLA
MET7_NEUCR      FCEFPGNPLLTCPDLVRIRELADKYEFAVVVDETI-GTFANVNVLQFADIVVSSLTKIFSGDCNVMGGGA
METW_YEAST      FVETPSNPLLNMPDLKKLRSLADQYGFFIVIDDTIGG--LNVDILPYADIVSTSLTKLFNGASNVMGGSV
GCSH_PROVI      ----------------------------------------------------HEWVKLLADGATALVGIT
MET7_YEAST      FIEAPSNPLLKMGDLQELKRLSDLYSFYIVVDETV-GGFVNIDVLPYADIVCSSLTKIFSGDSNVIAGSL


                         .         .         .         +         .         .         .:280
query           VTNSLELYEKLFYNLNTTGAVLSPFDSYQLLRGLKTLSLRMERSTANAQEVVAFLKDSPAVKEVLYTGRG
METB_HAEIN      VAKGQELCDRIAYIQNGAGAVLSPFDSWLTIRGMKTLSLRMKRHQENAQAIAEFLKAQPQVESVLYPNKG
METB_BACSU      VVKDERLGEEMFQHQNAIGAVLPPFDSWLLMRGMKTLSLRMRQHXXXXXXXXXXXXXXXXISDVLYPGKG
MCCB_BACSU      VTASKELGEELHFVQNSTGGVLGPQDSWLLMRGIKTLGLRMEAIDQNARKIASFLENHPAVQTLYYPGSG
METC_LACLM      TTNSKELASEIGFLQNSIGAVLGPQDSWLVQRGIKTLALRMEAHSANAQKIAEFLETSKAVSKVYYPGLG
METC_LACLA      TTNSKELASEIGFLQNSIGAVLGPQDSWLVQRGIKTLALRMEAHSANAQKIAEFLETSKAVSKVYYPGLG
METC_LACLC      TTNSNELAIEIGFLQNSIGAVLGPQDSWLVQRGIKTLAPRMEAHSANAQKIAEFLEASQAVSKVYYPGLG
CGL_DICDI       ATNNDELYAKLKFLQNSIGAVPSPFDCFLALRGLKTLHVRMEAHQKNAFAICNFLEKHPKVERVIYKGYG
METC_COXBU      VGDNKTLAEQLKYLQNAIGAIAAPFDSFMVLRGLKTLAIRMERHCENAMQLAQWLEKHPKVKRVYYPGLG
METC_BACSU      AVKDEELGKQLYKLQNAFGAVLGVQDCWLVLRGLKTLQVRLEKASQTAQRLAEFFQKHPAVKRVYYTGAG
METB_HELPY      TTNNEALAQEIAFFQNAIGGVLGPQDSWLLQRGIKTLGLRMEAHQKNALCVAEFLEKHPKVERVYYPGRG
METB_HELPJ      TTNNEALAQEFDFFQNAIGGVLGLQDSWLLQRGIKTLGLRMEAHQKNALCVAEFLEKHPKVERVYYPGRG
CGL_PIG         SLNSETLHSRLRFLQNSLGAVPSPIDCYLCNRGLKTLQVRMEKHFENGMAVAQFLESHPLVEKVIYTGCP
METC_ARATH      AVKGEKLAKEVYFLQNSEGSGLAPFDCWLCLRGIKTMALRIEKQQENARKIAMYLSSHPRVKKVYYAGAG
METB_MYCLE      VTNDEELDQAFGFLQNGAGAVPSPFDAYLTMRGLKTLVLRMQRHNENAITVAEFLAGHPSVSAVLYPGLG
METB_ECOLI      IAKDPDVVTELAWWANNIGVTGGAFDSYLLLRGLRTLVPRMELAQRNAQAIVKYLQTQPLVKKLYHKGFG
CYS3_YEAST      ATNNKPLYERLQFLQNAIGAIPSPFDAWLTHRGLKTLHLRVRQAALSANKIAEFLADKENVVAVNYPGGG
CGL_MACFA       SVNCERLHNRLRFLQNSLGAVPSPLDCYLCNRGLKTLHVRMEKHFKNGMAVAQFLESNPGVEKVIYTGCT
CGL_BOVIN       SLNSESLHDRLRFLQNSLGAVPSPIDCYLCNRGLKTLQVRMEKHFENGMAVAQFLESNPQVEKVIYTGCP
METB_MYCTU      VTNDEELDEEFAFLQNGAGAVPGPFDAYLTMRGLKTLVLRMQRHSENACAVAEFLADHPSVSSVLYPGLG
METB_MYCBO      VTNDEELDEEFAFLQNGAGAVPGPFDAYLTMRGLKTLVLRMQRHSENACAVAEFLADHPSVSSVLYPGLG
CGL_HUMAN       SVNCESLHNRLRFLQNSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFLESNPWVEKVIYTGCT
CBL_SCHPO       ATKSDEIAKSVFFNINAMGAAMAPFECFLLLRGIKTMGLRVERAQQNAIEIAKFLKSSTAIFYSFARGPG
CGL_MOUSE       SVNSDDLNSRLRFLQNSLGAVPSPFDCYLCCRGLKTLQVRMEKHFKNGMAVARFLETNPRVEKVVYSGCP
CGL_RAT         SVTSDDLNERLRFLQNSLGAVPSPFDCYLCCRGLKTLQIRMEKHFRNGMAVARFLESNPRVEKVIYTGCP
CGL_CAEEL       ITDNDEFQQHLFFMQLAVGAVPSPFDCFLVNRGLKTLHIRMRAHYENALAVAKYLEANDRIESVLYKGMS
METB_HERAU      MTSNDELYEKLKFLQNAAGAVPGPFDCWLVLRGVKTLSIRMRDDERNALAIAQFLTEHPGVEKVIYPG--
MEGL_PSEPU      VGSQALVDRIRLQGLDMTGAVLSPHDAALLMRGIKTLNLRMDRHCANAQVLAEFLARQPQVELIHYPGLG
METB_ARATH      ICGSLKLVSEIRNLHHVLGGTLNPNAAYLIIRGMKTLHLRVQQQNSTAFRMAEILEAHPKVSHVYYTGFG
STR3_YEAST      ISKTPEIASKLYFVINSTGAGLSPMDSWLLVRGLKTLGVRLYQQQRNAMILAHWLENSCGFKKSFNNGPG
METZ_PSEAE      XXXXEQMKEVVGF-LRTAGPTLSPFNAWLFLKGLETLRIRMQXXXXXXXXXXEWLERQPGIERVYYAGLG
CYSD_SCHPO      GMVFTETFGNLAYTLRDVGGNANPFGVFLLLQGLETLSLRMERHVQNAFALAKYLEKHPKVNWVSYPGLE
METC_RHIL3      SANA-EHWERLKEANGVLGICGAPDDAYQILRGLRTMGLRLERHYESALDIAKWLEGRDDVARVLFKGAS
YFHE_SCHPO      ASKDRSKILDLKADRAYLGTILHPQQAFLLLRSLRTFPLRIAKHSENGFLVAQHLNDSSLILEVYHNGHA
YHR2_YEAST      VVKEEATSRQLKDDRIYLGTNVANLESFMLLRSLRTYEMRITKQSENATKLVRFLSDHQSVKKQLVGGYG
MET17_KLULA     XDSGKEGYHGLIFNLRDLGPVLSPFAGFLLLQGLETLSLRGERHGSNALKLAQYLESSPYVKKYLENGFG
MET17_YEAST     VDSGAEGYHGTIYNLRDLGPLMNPFASFLLLQGVETLSLRAERHGENALKLAKWLEQSPYVKKYLSNGFG
CYSD_EMENI      GLNFWETFGPIAFALRDLGSALNPFAAQQLILGLETLSLRAERHASNALALANWLKKNDHVSWVSYVGLG
METC_BORAV      VTNDEAIAKRLNRTQYALGYSVSADDAWLALRGVRTMPVRMAQHARHALEVCEFLQNRPEVVRLYHSGSN
METC_ECOLI      VCNA-RCWEQLRENAYLMGQMVDADTAYITSRGLRTLGVRLRQHHESSLKVAEWLAEHPQVARVNFTGSS
CYSA_STRCO      AGRDAGAMAAVRRWRKIVGAIPGPMEAWLAHRSIATLQLRVDRQDSTALKVAEALRTRPEITGLRYPGLP
METC_SALTY      VANA-RCWEQLRENAYLMGQMLDADTAYMTSRGLRTLGVRLRQHQESSLKIAAWLANHPQVARVNFTGSS
METC_HAEIN      VANA-RTWDQLREHSYLMGQMVDADSAYTTARGIRTLGVRLKQHQESSIKVAKWLSEQPEVKTVYHPAXX
METC_YEAST      SANE-ECWPLLRSTYDAMAMLPGAEDCQLALRGMRTLHLRLKEVERKALDLAAWLGNRDEVEKVLYKGSS
MET7_NEUCR      IFNPNSRYYSALKSFQQLEDTYWPEDVIFMERNSRDFVARIDRVNANAEAICRVLQDHPLVKTLYYPGYG
METW_YEAST      VLNSLYPYAREYFRSANFEDLLWCEDAIVLERNSRDFEDRTLRANANTGILLNDLEEGKICKKIYYPGYG
GCSH_PROVI      DFAQSELGDIVFVELKPEGTVLGEQEIFGTVEAVKTVADLFAPVAGTILELNGVLDAAETVNQDPY-GEG
MET7_YEAST      VLNPYEFARKFMKTEDGYEDCLWCEDALCLERNSRDFTIKVNTNTDILLKRVLLPQVGKLFKKIYYPGYG


                         .         *         .         .         .         .         +:350
query           GMISFKVADETRIPHILNSLKVFSFAESLGGVESLITYPTTQTHADIPAEVRHSYGLTDDLLRLSIGIED
METB_HAEIN      GMLSFRLQDEAWVNTFLKSIKLITFAESLGGTESFITYPATQTHMDIPESERVARGITNTLLRFSVGIED
METB_BACSU      GMLSFRLQKEEWVNPFLKALKTICFAESLGGVESFITYPATQTHMDIPEEIRIANGVCNRLLRFSVGIEH
MCCB_BACSU      GMISFDIGSEERVDAFLGNLKLFTIAESLGAVESLISVPARMTHASIPRERRLELGITDGLIRISVGIED
METC_LACLM      GMISFELTDENAVKDFVENLSYFTLAESLGGVESLIEVPAVMTHASIPKELREEIGIKDGLIRLSVGVEA
METC_LACLA      GMISFELTDENAVKDFVENLSYFTLAESLGGVESLIEVPAVMTHASIPKELREEIGIKDGLIRLSVGVEA
METC_LACLC      GMISFELTDENAVKNFVENLRYFTLAESLGGVESLIEVPAVMTHASIPKELREEIGIKDGLIRLSVGVEA
CGL_DICDI       GMVVFFVIDQSR--SFLENIKLFALAESLGGVESLIELPSVMTHASVPAEERAKLGISDTLIRLSVGIED
METC_COXBU      GMISVELCDLNETKKVLERCQLFTLAESLGGVESLIEHPAIMTHASIPQAERQKLGITDGFIRLSVGIEA
METC_BACSU      AVLSFELESKEAVKKLVENVSLPVFAVSLGAVESILSYPATMSHAAMPKEEREKRGITDGLLRLSVGVEH
METB_HELPY      GMLSFTLKNDSEAVAFVESLKLFILGESLGGVESLVGIPAFMTHACIPKTQREAAGIRDGLVRLSVGIE-
METB_HELPJ      GMFSFTLKNDSEAVAFVESLKLFILGESLGGVESLVGIPALMTHACIPKAQREAAGIRDGLVRLSVGIEH
CGL_PIG         GMISFYIKGSLHAETFLKSLKLFTLAESLGGYESLAELPAIMTHSSVPKSDREVLGIRDTLIRLSVGLED
METC_ARATH      SVFSFITGSVALSKHLVETTKYFSIAVSFGSVKSLISMPCFMSHASIPAEVREARGLTEDLVRISAGIED
METB_MYCLE      GMVSLRMAGRLAAQDLCARTKVFTLAESLGGVESLIEQPSAMTHASTTGS---QLEVPDDLVRLSVGIED
METB_ECOLI      AMLSFELGDEQTLRRFLGGLSLFTLAESLGGVESLISHAATMTHXXXXXXXXXXXGISETLLRISTGIED
CYS3_YEAST      GMISFRIGGAEAASKFASSTRLFTLAESLGGIESLLEVPAVMTHGGIPKEAREASGVFDDLVRISVGIED
CGL_MACFA       GMITFYIKGTLQHAEILKNLKLFTLAESLGGFESLVELPAIMTHASVPKNDRDVLGISDTLIRLSVG---
CGL_BOVIN       GMVTFYIKGSLQAETFLQNLKLFTLAESLGGYESLAELPAIMTHASVPKSDREVLGISDTLIRLSVGLE-
METB_MYCTU      GMVSVRMAGRRAAQDLCAKTRVFILAESLGGVESLIEHPSAMTHASTAGS---QLEVPDDLVRLSVGIED
METB_MYCBO      GMVSVRMAGRRAAQDLCAKTRVFILAESLGGVESLIEHPSAMTHASTAGS---QLEVPDDLVRLSVGIED
CGL_HUMAN       GMVTFYIKGTLQHAEILKNLKLFTLAESLGGFESLAELPAIMTHASVLKNDRDVLGISDTLIRLSVGXXX
CBL_SCHPO       AVMSVFTGDVEVSKTIVNTTKLFEISVSFGAVNSLISMPAYMSHASIKKEVRDARGLSEDLIRICVGIEN
CGL_MOUSE       GMVSFYIKGALQAKAFLKNLKLFTLAESLGGYESLAELPAIMTHASVPEKDRATLGINDTLIRLSVG---
CGL_RAT         GMVSFYIKGTLQHAQVLKNIKLFALAESLGGYESLAELPAIMTHASVPEKDRATLGISDTLIRLSVGXXX
CGL_CAEEL       GMISFYLKGELQESRFLSALKVFTLAESLGGYESLAELPSIMTHASVPAETRIVLGITDNLIRISVGIE-
METB_HERAU      ----------------------------------------------------------------------
MEGL_PSEPU      GMIAFELKGGIGAGRFMNALQLFSRAVSLGDAESLAQHPASMTHSSYTPEERAHYGISEGLVRLSVGLED
METB_ARATH      GVVSFEIDGETTIKFV-DSLKIPYIAPSFGGCESIVDQPAIMSYWDLPQEERLKYGIKDNLVRFSFGVED
STR3_YEAST      AVLSFETGSFEHSKRLVSSLSIWAVTVSFGCVNSLLSMPCKMSHASIDPELRKERDFPEDLVRLCCGIEN
METZ_PSEAE      AVVSFDVGGRDAAWRFIDATRMVSITTNLGDTKTTIAHPATTSHGRLSPEDRARAGIGDSLIRVAVGLED
CYSD_SCHPO      SHVSHKLADQSR--KVVNALKLASQLANVGDAKTLVIAPAYTTHLQLTDEEQISAGVTKDLIRVAVGIEH
METC_RHIL3      GIFSFVLASRAKAHAFLDALRIFGLGYSWGGFESLAAYLNDRTVAKAPTD--------GPVIRLQIGIED
YFHE_SCHPO      SCFSVLLKSDTVAKHLCCELKYFHHATSLGSVESLIEW---RRMTDSKIDPR--------LVRLSIGIED
YHR2_YEAST      PVFAITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWAMTDPYID------------QTLIRVSVGCES
MET17_KLULA     GVLSFGVKDEESDPQVVDNLKLASNLANVGDSKTLVIAPYFTTHQQLTDEEKLASGVTKDLIRVSVGTEF
MET17_YEAST     GVLSFGVADKETDPQVVDNLKLASNLANVGDAKTLVIAPYFTTHKQLNDKEKLASGVTKDLIRVSVGIEF
CYSD_EMENI      GVLSFGVKGEAAVSQVVDNFKLISNLANVGDSKTLAIHPWSTTHEQLTDQERIDSGVTEDAIRISVGTEH
METC_BORAV      GMLAVQLGLSPQAARFVNALTLFGIGFSWGGFESLVQLVT-------PGELRHQYGGSDALVRLHIGLE-
METC_ECOLI      GLFSFKKLNNEELANYLDNFSLFSMAYSWGGYESLILANQPEHIAAIRPQGEIDFSGT--LIRLHIGLED
CYSA_STRCO      DDPSHKVASQ------------------------------------------------------------
METC_SALTY      GLFSFKKLTEAELSAYLDNFSLFSMAYSWGGYESLI----IANQPEQIAAIRPAGGVTGTLVRVHIGLES
METC_HAEIN      XELTQRLTSE-QVSKFMDHFQLFAMAYSWGGFESLILCNQPEEIAHIRPNIKRN--LTGSLIRVHIGFEN
METC_YEAST      GLFSIVLKNRAGLEKMVEGMKVLQLGFSWGG---------------------------------------
MET7_NEUCR      GLISVVLKGKKQAVAFYDAIET-AKGPSL-GTNFTLTSPYVLLAHYQELDWAEQYGVDRNLIRISVGLEG
METW_YEAST      CLFSVAFFNEGDAKAFYDSLKVFKGPSNGTNFTLACPYVHLAHHSEL--EEVSKFGADPNIIRVSVGLED
GCSH_PROVI      WMVKMKVADPSSLDALMDAA---AYTEMIGG---------------------------------------
MET7_YEAST      GLFSLTFFNIEEAKKFFNNLELCK-GPSLGTNFTLACPYAIIAHYQELDEVA-QYGVETNLVRVSVGLEN


                         .         .         .         .         *         .         .:420
query           ARDLIADLRQALEx
METB_HAEIN      VEDIKADLLQA---
METB_BACSU      AEDLKEDLKQAL--
MCCB_BACSU      AEDLLEDIGQALE-
METC_LACLM      IEDLLTDIKEALE-
METC_LACLA      IEDLLTDIKEALE-
METC_LACLC      LEDLLTDLKEALE-
CGL_DICDI       INDLLADISQALD-
METC_COXBU      ITDLRHDLEAAL--
METC_BACSU      ADDLEHDFEQALK-
METB_HELPY      --------------
METB_HELPJ      EQDLLEDLDQA---
CGL_PIG         KQDLMDDLDQALK-
METC_ARATH      VDDLISDL------
METB_MYCLE      VGDLLCDLKQAL--
METB_ECOLI      GEDLIADL------
CYS3_YEAST      TDDLLEDIKQALK-
CGL_MACFA       --------------
CGL_BOVIN       --------------
METB_MYCTU      IADLLGDLEQAL--
METB_MYCBO      IADLLGDLEQAL--
CGL_HUMAN       XXXXXXXXXQALK-
CBL_SCHPO       VDDLKADLENAL--
CGL_MOUSE       --------------
CGL_RAT         XXXXXXXXGQALK-
CGL_CAEEL       --------------
METB_HERAU      --------------
MEGL_PSEPU      IDDLLADVQQALK-
METB_ARATH      FEDVKADILQALE-
STR3_YEAST      IVDLKKDLLAAM--
METZ_PSEAE      LDDLKADMARGL--
CYSD_SCHPO      IDDIIADFAQALE-
METC_RHIL3      VADLKADIER----
YFHE_SCHPO      AADLIADLNR----
YHR2_YEAST      ANDLIKDLASALK-
MET17_KLULA     IDDIIAD-------
MET17_YEAST     IDDIIADFQQSFE-
CYSD_EMENI      IDDIIADFEQS---
METC_BORAV      --------------
METC_ECOLI      VDDLIADL------
CYSA_STRCO      --------------
METC_SALTY      VDDLIADL------
METC_HAEIN      VDELIADLKAGFE-
METC_YEAST      --------------
MET7_NEUCR      TDELINVFTRALK-
METW_YEAST      IQWLLKVFSSALD-
GCSH_PROVI      --------------
MET7_YEAST      SDVLCNVFQRAIE-