[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for spne4:ACF56680.1

[Show Plain Result]


## Summary of Sequence Search
    1::186
   29::189     1e-28  39%  189 aa  Y1576_METJA RecName: Full=Uncharacterized protein MJ1576;
   55::209     4e-15  29%  219 aa  YGYB_MYCHO RecName: Full=Uncharacterized 25.5 kDa protein in gyrB
 1357::1471    5e-04  28% 1727 aa  ALM1_SCHPO RecName: Full=Abnormal long morphology protein 1;AltName:
    1::186

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxNGLVKNRMQTKEAWSQIDVQLKRRNDLLPNLIETVKGYAKYEGSTLEKVA
Y1576_METJA     -------------------------NRFQTEATLGQIRVALKKRLDMINQLVEAVKSYASFEKETLTKIT
YGYB_MYCHO      --------------------NELMRDQNEIQNASSLIQAAEKRRRAVLIKMMDSLIGYKNFENETLSKIT
ALM1_SCHPO      ---------------------------LENERAQNQSKIQLELKNTKLAAAWRTK--YEQVVNKSLEKHN


                         .         .         *         .         .         .         .:140
query           ELRNQVAAATSPAEAMKASDALTRQVSGIFAVAESYPDLKASANFVKLQEELTNTENKISYSRQLYNSVV
Y1576_METJA     ELRSSVLKANTAEEIQNIERESRNILGNILVAVENYPELKTSETVKELMDAIKEIEDEIARHRYTYNNIV
YGYB_MYCHO      QYRSKLSNITSPVELKSQIDSIRGALNFQF---EQYPDLKASKLYLQFSTEISMQEDEIYATIRNYNMIA
ALM1_SCHPO      QIRQQLSQKTSELEAKVANEQLNKPSATPTATTQSEPSTVSLEEFNSTKEELSSTQRKLSEIMDILNT--


                         +         .         .         .         .         *         .:210
query           SNYNVKLETFPSNIIAGMFGFKAADFLQTPEEEKSVPKVDFxxxxx
Y1576_METJA     QEFNTKIDTFPSNIVANLFGFRKMDYLQFEEEIYERPKISF-----
YGYB_MYCHO      TSFNSKIYTFWTNCVAQKLDLYNVAIFQASEIER------------
ALM1_SCHPO      ----------------------------------------------