[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for spne4:ACF56707.1

[Show Plain Result]


## Summary of Sequence Search
    1::289
  539::760     2e-16  26%  821 aa  PPSA_PYRHO RecName: Full=Probable phosphoenolpyruvate synthase;    
  536::757     6e-15  24%  817 aa  PPSA_PYRFU RecName: Full=Phosphoenolpyruvate synthase;       
  536::757     2e-14  24%  819 aa  PPSA_PYRAB RecName: Full=Probable phosphoenolpyruvate synthase;    
  520::724     2e-14  24%  753 aa  PPSA_ARCFU RecName: Full=Probable phosphoenolpyruvate synthase;    
  952::1154    2e-13  24% 1188 aa  PPSA_METJA RecName: Full=Probable phosphoenolpyruvate synthase;      
  575::763     3e-10  28%  820 aa  PPSA_AERPE RecName: Full=Phosphoenolpyruvate synthase;       
  515::669     4e-10  31%  748 aa  PT1P_SALTY RecName: Full=Phosphoenolpyruvate-protein
  342::487     2e-09  29%  556 aa  PT1_STRCO RecName: Full=Phosphoenolpyruvate-protein
  535::773     2e-09  26%  834 aa  PPSA_STAMF RecName: Full=Probable phosphoenolpyruvate synthase;    
  515::669     1e-08  29%  748 aa  PT1P_ECOLI RecName: Full=Phosphoenolpyruvate-protein
  347::491     2e-07  30%  572 aa  PT1_MYCPN RecName: Full=Phosphoenolpyruvate-protein
  563::716     2e-07  28%  792 aa  PPSA_ECOLI RecName: Full=Phosphoenolpyruvate synthase;       
  527::665     3e-07  28%  684 aa  PPSA_METTH RecName: Full=Probable phosphoenolpyruvate synthase;    
  346::486     6e-07  33%  573 aa  PT1_MYCCT RecName: Full=Phosphoenolpyruvate-protein
  730::856     1e-06  36%  947 aa  PPDK1_MAIZE RecName: Full=Pyruvate, phosphate dikinase 1,
  730::856     1e-06  36%  947 aa  PPDK1_ORYSJ RecName: Full=Pyruvate, phosphate dikinase 1,
  459::595     2e-06  29%  831 aa  PTFAX_ECOL6 RecName: Full=Multiphosphoryl transfer protein;        
  459::595     3e-06  28%  831 aa  PTFX1_ECOLI RecName: Full=Multiphosphoryl transfer protein 1;      
  459::595     3e-06  28%  831 aa  PTFAX_SHIFL RecName: Full=Multiphosphoryl transfer protein;        
  459::595     4e-06  28%  831 aa  PTFAX_ECO57 RecName: Full=Multiphosphoryl transfer protein;        
  662::785     4e-06  35%  880 aa  PPDK_RICPR RecName: Full=Pyruvate, phosphate dikinase;       
  724::862     4e-06  33%  953 aa  PPDK_FLATR RecName: Full=Pyruvate, phosphate dikinase,
  724::862     4e-06  33%  953 aa  PPDK_FLABI RecName: Full=Pyruvate, phosphate dikinase,
  427::505     7e-06  36%  573 aa  PT1_BORBU RecName: Full=Phosphoenolpyruvate-protein
  662::785     7e-06  35%  880 aa  PPDK_RICTY RecName: Full=Pyruvate, phosphate dikinase;       
  661::784     1e-05  30%  878 aa  PPDK_RICFE RecName: Full=Pyruvate, phosphate dikinase;       
  390::503     1e-05  32%  567 aa  PT1_CHLMU RecName: Full=Phosphoenolpyruvate-protein
  351::469     2e-05  27%  573 aa  PT1_BACME RecName: Full=Phosphoenolpyruvate-protein
  738::864     2e-05  35%  955 aa  PPDK_FLABR RecName: Full=Pyruvate, phosphate dikinase,
  351::469     3e-05  27%  572 aa  PT1_BACHD RecName: Full=Phosphoenolpyruvate-protein
  661::784     4e-05  29%  878 aa  PPDK_RICCN RecName: Full=Pyruvate, phosphate dikinase;       
  661::784     4e-05  26%  878 aa  PPDK_RICBR RecName: Full=Pyruvate, phosphate dikinase;       
  733::859     4e-05  33%  949 aa  PPDK_MESCR RecName: Full=Pyruvate, phosphate dikinase,
  723::871     6e-05  28%  963 aa  PPDK1_ARATH RecName: Full=Pyruvate, phosphate dikinase 1,
  347::491     1e-04  28%  572 aa  PT1_MYCGE RecName: Full=Phosphoenolpyruvate-protein
  565::762     1e-04  25%  812 aa  PPSA_HELPY RecName: Full=Phosphoenolpyruvate synthase;       
  565::762     1e-04  25%  812 aa  PPSA_HELPJ RecName: Full=Phosphoenolpyruvate synthase;       
  350::490     2e-04  29%  575 aa  PT1_HAEIN RecName: Full=Phosphoenolpyruvate-protein
  394::525     3e-04  26%  571 aa  PT1_CHLTR RecName: Full=Phosphoenolpyruvate-protein
  739::865     6e-04  33%  956 aa  PPDK_FLAPR RecName: Full=Pyruvate, phosphate dikinase,
  388::501     8e-04  28%  571 aa  PT1_CHLPN RecName: Full=Phosphoenolpyruvate-protein
    1::289

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxLEKIYPQLFHHVGMIRGEYLLRELNQNIILASCQQFVKDYLETICSLYSDEEVWYRFT
PPSA_PYRHO      -----------------------VGLLRAEHMILSIGQHPV-----KFIKEGIEKVAAAFYPRPVWYRTL
PPSA_PYRFU      -----------------------VGLLRAEHMILSIGQHPIXXXXXXXXXXXXXKVAAAFYPRPVWYRTL
PPSA_PYRAB      -----------------------VGLLRAEHMILSIGQHPVXXXXXXXXXXXXXKVAAAFYPRPVWYRTL
PPSA_ARCFU      ----------------------------------------------------MKKVVKAFYPKPVWIRTI
PPSA_METJA      -------------------------------------------------------VADAFYPRPVTYRTL
PPSA_AERPE      -------------------------------------------------------VASAIYPRPVVVRFS
PT1P_SALTY      ----------------------------------------------------------------------
PT1_STRCO       ----------------------------------------------------------------------
PPSA_STAMF      ------------IEKYKDLPFDGIGLMRIEFIITDWVQYHPLYLIEQFIDKLAEGIAKVAQPRPVVVRFS
PT1P_ECOLI      ----------------------------------------------------------------------
PT1_MYCPN       ----------------------------------------------------------------------
PPSA_ECOLI      ----------------------------------------------------IATLGAAFYPKRVIVRLS
PPSA_METTH      ---------------VHPRKFIEEG--REDELVNTLAENIL-------------KVADEFYPRPVWYRTL
PT1_MYCCT       ----------------------------------------------------------------------
PPDK1_MAIZE     ----------------------------------------------------------------------
PPDK1_ORYSJ     ----------------------------------------------------------------------
PTFAX_ECOL6     ----------------------------------------------------------------------
PTFX1_ECOLI     ----------------------------------------------------------------------
PTFAX_SHIFL     ----------------------------------------------------------------------
PTFAX_ECO57     ----------------------------------------------------------------------
PPDK_RICPR      ----------------------------------------------------------------------
PPDK_FLATR      ----------------------------------------------------------------------
PPDK_FLABI      ----------------------------------------------------------------------
PT1_BORBU       ----------------------------------------------------------------------
PPDK_RICTY      ----------------------------------------------------------------------
PPDK_RICFE      ----------------------------------------------------------------------
PT1_CHLMU       ----------------------------------------------------------------------
PT1_BACME       ----------------------------------------------------------------------
PPDK_FLABR      ----------------------------------------------------------------------
PT1_BACHD       ----------------------------------------------------------------------
PPDK_RICCN      ----------------------------------------------------------------------
PPDK_RICBR      ----------------------------------------------------------------------
PPDK_MESCR      ----------------------------------------------------------------------
PPDK1_ARATH     --------------------------------------------------------------DNIVHELA
PT1_MYCGE       ----------------------------------------------------------------------
PPSA_HELPY      -----------------------------------------------FVKKIAEMISAAFYPKPVIVRTS
PPSA_HELPJ      -----------------------------------------------FVKKIAEMISAAFYPKPVIVRTS
PT1_HAEIN       ----------------------------------------------------------------------
PT1_CHLTR       ----------------------------------------------------------------------
PPDK_FLAPR      ----------------------------------------------------------------------
PT1_CHLPN       ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ELTNTEANCLVGTKEFFDEGHPLFGYRGTRRLLACLDEFQAEAHVVTEVYQTNPNLSVIFPFVNDADQLK
PPSA_PYRHO      DAPTNEFREMPGGEDEPEERNPMLGWRGIRRGLDQPELLRAEFKAIKKVVEKGNNIGVMLPLVSHPEQIR
PPSA_PYRFU      DAPTNEFREMPGGEDEPEERNPMLGWRGIRRGLDQPELLRAEFKAIKKVVEKGNNIGVMLPLVSHPEQIR
PPSA_PYRAB      DAPTNEFREMPGGEDEPEERNPMLGWRGIRRGLDQPELLRAEFKAIKKVVEKGNNIGVMLPLVSHPEQIR
PPSA_ARCFU      DAPTDEFRAMEGGEDEPIEANPMLGFRGIRRDLAEEEHFRAEMRAIKKLVDEGTNVGVMLPLITSPEEVK
PPSA_METJA      DAPTDEFRGLEGGENEPIEHNPMLGWRGIRRDLDEVDILKCELKAIKRLREEGKNIEIMIPLVTHPDEVR
PPSA_AERPE      DFKTNEYRRLKGGEKYLDERNPMIGWRGVSRYIHPNYEFRLEVRAIKKVREELKNVWVMFPFVRTTWELE
PT1P_SALTY      ------------------EENPCLGWRGIRITLDQPEIFLIQVRAMLRANAATGNLSILLPMVTSIDEVD
PT1_STRCO       -----------------DEPNPALGVRGLRTLLDHPDVLRTQLTALAKAAEGLPYLEVMAPMVXXXXXXX
PPSA_STAMF      DFKTNEYRGLKGGEKYEEERNPMIGWRGVSRYIHPKYEFRLEVRAIKKVREEMTNVWVMFPFVRTTWELE
PT1P_ECOLI      ------------------EENPCLGWRGIRITLDQPEIFLIQVRAMLRANAATGNLNILLPMVTSLDEVD
PT1_MYCPN       --------------EFPHEDNPFLGYRALRLTLDKQDIFKTQLRALLRAAD-HGQLGIMFPMVATLDELL
PPSA_ECOLI      DFKSNEYANLVGGERYEDEENPMLGFRGAGRYVSFRDCFALECEAVKRVRNDMTNVEIMIPFVRTVDQAK
PPSA_METTH      DAPTDEFKTLEGGENEPYEHNPMLGWRGIRRELDEPEILRAEFRAIKKLHQGYTNIGIMIPLVQHPDELR
PT1_MYCCT       --------------KFDEEMNPFLGYRAIRFTLDRKDIFKDQIRALLRASAFG-KLGIMFPMIATIDEFK
PPDK1_MAIZE     --------------EKLSEVNPMLGFRGCRLGISYLTEMQARAIFEAAIAMTNQGVQVMVPLVGTPQELG
PPDK1_ORYSJ     --------------EKLSEVNPMLGFRGCRLGISYLTEMQARAIFEAAITMTNQGIQVMVPLVGTPQELG
PTFAX_ECOL6     ------------------EENPFLGYRAVRIYPEFAGLFRTQLRAILRAASFG-NAQLMIPMVHSLDQLQ
PTFX1_ECOLI     ------------------EENPFLGYRAVRIYPEFAGLFRTQLRAILRAASFG-NAQLMIPMVHSLDQIQ
PTFAX_SHIFL     ------------------EENPFLGYRAVRIYPEFAGLFRTQLRAILRAASFG-NAQLMIPMVHSLDQIQ
PTFAX_ECO57     ------------------EENPFLGYRAVRIYPEFAGLFRTQLRAILRAASFG-NAQLMIPMVHGLDQIQ
PPDK_RICPR      ------------------EVNPMLGHRGCR-LGICLPEIQIEA-IFTAIFELHKNLELMIPLISNVAEIK
PPDK_FLATR      --TGMSADEIYSKIENLSEVNPMLGFRGCRLGISYLTEMQVRAIFQAAVSMTNQGVTVIVPLVGTPQELR
PPDK_FLABI      --TGMSADEIYSKIENLSEVNPMLGFRGCRLGISYLTEMQVRAIFQAAVSMTNQGVTVIVPLVGTPQELR
PT1_BORBU       ----------------------------------------------------------------------
PPDK_RICTY      ------------------EVNPMLGHRGCR-LGICLPEIQIEA-ILTAIFELHKNLELMIPLISNVAEIK
PPDK_RICFE      ------------------EVNPMLGHRGCRLGICSPEIYQMQIEAITAIFELHKNLELMMPLISNVGEIK
PT1_CHLMU       -------------------------------------------------------LKVLIPGVLDASEIK
PT1_BACME       ------------------EMNPFLGFRAIRLCLEMQDMFRTQLRALLRA-SVYGNLKIMFPMIATVDEFR
PPDK_FLABR      --------------EKLSEVNPMLGFRGCRLGISYLTEMQVRAIFQAAVSMNNQGVTVIVPLVGTPQELR
PT1_BACHD       ------------------ELNPFLGFRAIRLCLEKQDIFRTQLRALLRA-STYGNLKVMFPMIATLEELR
PPDK_RICCN      ------------------EVNPMLGHRGCRLGICSPEIYQMQIEAITAIFELHKNLELMIPLISNVGEIQ
PPDK_RICBR      ------------------EVNPMLGHRGCRLGICSPEIYQMQVEAITAIFELHKELELMIPLISNVNEIK
PPDK_MESCR      --------------EKLSEVNPMLGFRGCRLGISYLTEMQARAIFQAAVSMSNQGVKVMVPLVGTPQELG
PPDK1_ARATH     EETGVKEDEVLSRIEKLSEVNPMLGFRGCRLGISYLTEMQARAIFEAAASMQDQGVTVIVPLVGTPQELG
PT1_MYCGE       --------------QFPHEDNPFLGYRAIRLTLDKQAVFKTQLRALLRASDYG-NLGIMFPMVATLDEXX
PPSA_HELPY      DFKSNEYMRMLGGSSYENEENPMLGYRGASRYYSSYNEWECEALALVREEMGLTNMKVMIPFLRTIEEGK
PPSA_HELPJ      DFKSNEYMRMLGGSSYENEENPMLGYRGASRYYSSYNEWECEALALVREEMGLTNMKVMIPFLRTIEEGK
PT1_HAEIN       ------------------EMNPFLGWRAIRIALDRREILNAQLRAVLRASAFG-KLAVMFPMVEEIRELK
PT1_CHLTR       -------------------------------------------------------LKVLIPGVIDASEIQ
PPDK_FLAPR      --------------EKLSEVNPMLGFRGCRLGISYLTEMQVRAIFQAAVSMNNQGVTVIVPLVGTPQELR
PT1_CHLPN       ------------------------------------------------------SIKVLIPGVSDVSEIK


                         +         .         .         .         .         *         .:210
query           QAITALRQYGFTGKVGTMIELPSAYFDLSSILETGISKIVVGMNDLTSFVFATMRNSQWHDLESPIMLDM
PPSA_PYRHO      KAKEIAREVGLEPHKGIMIEVPAAAIIIEDLIKEGIDFVSFGTNDLTQYTLAIDRDNELYDETHPAVLKL
PPSA_PYRFU      EAKRIAREVGLEPHKGVMIEVPAAAIIIEDLIKEGIDFVSFGTNDLTQYTLAIDRDNELYDETHPAVLKL
PPSA_PYRAB      KAKEIARSVGLEPHKGIMIEVPAAAIIIEDLIKEGIDFVSFGTNDLTQYTLAIDRDNELYDETHPAVLKL
PPSA_ARCFU      RAKEIAISEGLPLEFGVMVETPAAALILEDIIKEGIDFVSLGTNDLTQYTLAVDRNNELYNETHPAVLKL
PPSA_METJA      RVKEIMREVGLEPPFGIMVETPAAALIIEDFIKEGINFVSLGTNDLTQYTIAIDRNSKYYKEDHPAVLKL
PPSA_AERPE      RALKIMEEEGLSRKVWIMVEVPSTVF-LADEFAKMVDGFSIGSNDLTQLVLGVDRDSGYFDERDPAVLRS
PT1P_SALTY      EARRLIERAGRKPRIGIMLEVPSMVFMLPH-LANRIDFISVGTNDLTQYILAVDRNASIYDSLHPAMLRA
PT1_STRCO       XXXXXCREAGLRAKFGAMVEIPSAALRARSVLQE-VEFLSLGTNDLAQYTFAADRQSRLQDPWQPALLDL
PPSA_STAMF      RALKIMEEEGLKRKVWAMAEVPSIVL-LADKFAEYVDGFSIGSNDLTQLILGADRDSNYFDERDPAVLAG
PT1P_ECOLI      EARRLIERAGRKPRIGIMLEVPSMVFMLPHLAKR-VDFISVGTNDLTQYILAVDRNANIYDSLHPAMLRA
PT1_MYCPN       QAKQLLNQVNKQFKLGIMIEIPAAVL-AANTLSHHVDFFSIGTNDLIQYSFAADRNKNVSYLYQPLNPAL
PPSA_ECOLI      AVVEELARQGLKRKIIMMCEIPSNALLAEQFLEY-FDGFSIGSNDMTQLALGLDRDS-------------
PPSA_METTH      KAKMIAEEAGLKPEFGIMVETPAA----------------------------------------------
PT1_MYCCT       QAKTFVEEYDNQVQIGMMVEIPSA-----AILADQFAKYAIGTNDLIQYSFASDRNQNVSYLYQPLNPSL
PPDK1_MAIZE     HQVTLIRQFANVGKVGTMIEIPRAALVADEIAEQA-EFFSFGTNDLTQMTFGYSRD--------------
PPDK1_ORYSJ     HQVDVIRQIAFTDKVGTMIEIPRAALVADEIAEQA-EFFSFGTNDLTQMTFGYSRD--------------
PTFAX_ECOL6     KAIVELKRDGLTITLGIMVEVPSVCYIIDHFCDE-VDFFSIGSNDMTQYLYAVDRNNRVSPLYNPITPSF
PTFX1_ECOLI     KAIVELKRDGLTITLGIMVEVPSVCYIIDHFCDE-VDFFSIGSNDMTQYLYAVDRNNRVSPLYNPITPSF
PTFAX_SHIFL     KAIVELKRDGLTITLGIMVEVPSVCYIIDHFCDE-VDFFSIGSNDMTQYLYAVDRNNRVSPLYNPITPSF
PTFAX_ECO57     KAIVELKRDGLTITLGIMVEVPSVCYIIDHFCDE-VDFFSIGSNDMTQYLYAVDRNNRVSPLYNPITPSF
PPDK_RICPR      EVVQELEQYKFSFTLGTMIELPRAALESKKIAKE-VDYFSFGTNDLTQTTYGISRD--------------
PPDK_FLATR      HQISVIREMGVTYKVGTMIEIPRAAL-IAEEIGKEADFFSFGTNDLTQMTFGYSRD--------------
PPDK_FLABI      HQISVIREMGVTYKVGTMIEIPRAAL-IAEEIGKEADFFSFGTNDLTQMTFGYSRD--------------
PT1_BORBU       -------------EVGCMIEVPSAAL-ISSKLANKLKFFSIGTNDLTQYVLAVDRGNQLYDKYNPAVLKL
PPDK_RICTY      KVVKKLEQYKFSFTLGTMIELPRAALGSKKIAKE-VDYFSFGTNDLTQTTYGISRD--------------
PPDK_RICFE      EVIEELEQYKFSFMLGTMIELPRAALGSKKIAKE-VDYFSFGTNDLTQTTYGISRD--------------
PT1_CHLMU       QMFQVQLQNGISENIGSMIEIPSAVWMIEEILQES-SFIALGTNDLAQYTLGMSREGNWKQVPHPSVIRM
PT1_BACME       QAKAILLQVSEDIEVGMMVEIPSSAV-IADLFAKEVDFFSIGTNDLIQYTLAADRMNE------------
PPDK_FLABR      HQIGVIREMGLTYKVGTMIEIPRAALIADEIAKEA-EFFSFGTNDLTQMTFGYSRD--------------
PT1_BACHD       QAKAIMQEVSDSIEVGIMVEIPSTAV-AANLFAKEVDFFSIGTNDLIQYTMAADRMNE------------
PPDK_RICCN      KVIEKLEQYKFSFTLGTMIELPRAALGSKKIAKE-VDYFSFGTNDLTQTTYGISRD--------------
PPDK_RICBR      KLLEERYEHKFSFSLGTMIELPRAALNSKKIAEE-VDYFSFGTNDLTQTTYGISRD--------------
PPDK_MESCR      HQVSLIRNFSETGKVGTMIEIPRAAL-VADEIAMEAEFFSFGTNDLTQMTFGYSRD--------------
PPDK1_ARATH     HQVDVIRKHTVSYKVGTMIEIPRAALIADEIAKEA-EFFSFGTNDLTQMTFGYSRD--------------
PT1_MYCGE       XXXXXXXEFNETKKLGIMIEIPSAAL-AADCLGKHVDFFSIGSNDLIQYSFAADRNKNVSYLYQPLNPAL
PPSA_HELPY      KVLEILRKNNLSGKNGIMCELPVNVILADDFLSL-FDGFSIGSNDLTQLTLGVDRDSELFDERNEAMLKM
PPSA_HELPJ      KVLEILRKNNLSGKNGIMCELPVNVILADDFLSL-FDGFSIGSNDLTQLTLGVDRDSELFDERNEAMLKM
PT1_HAEIN       AVIETLRLFDNNIQVGVMVETPSAAVN-AKFLAKEVDFFSIGTNDLTQYTLAVDRGNEFYNPMHPSVLGL
PT1_CHLTR       EEIRLLKGISENILWGSMIEIPSAVWMIEEILQES-SFVALGTNDLAQYTLGTXXXXXXXXVPHPSVIRM
PPDK_FLAPR      HQIGVIREMGLTMKVGTMIEIPRXXXXXXXXXXXXXF-FSFGTNDLTQMTFGYSRD--------------
PT1_CHLPN       KWETIQTRFPKGHKVGTMIEFPSAVWMIEEILPE-CDFLSIGTNDLVQYTLGISRESHLNVTLPPAVIRM


                         .         .         .         +         .         .         .:280
query           LRDMQDKARKNKINFAVAGYLNTSFIQKMNQLGIKCIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PPSA_PYRHO      IKHVIKVCKKYGVETSICG---------------------------------------------------
PPSA_PYRFU      IKHVIKVCKRYGVETSICG---------------------------------------------------
PPSA_PYRAB      IKHVIKVCKRYGVETSICG---------------------------------------------------
PPSA_ARCFU      IERTIKVCKEHGVKSSICGQAGSHVVEKLVEFGIDSV---------------------------------
PPSA_METJA      VEHVIKTCKKHGIKTSICGQAGSHIVEKLVEWGIDSV---------------------------------
PPSA_AERPE      IEILIEKAHSQGATVSICG---------------------------------------------------
PT1P_SALTY      LSMIAQEAEKHGLDLRLCG---------------------------------------------------
PT1_STRCO       VALSAEAAKAEGKSCGVCG---------------------------------------------------
PPSA_STAMF      IKMIIEKAHSKGATVSICG---------------------------------------------------
PT1P_ECOLI      LAMIAREAEIHGIDLRLCG---------------------------------------------------
PT1_MYCPN       LKLIYLTIEGGKVN--------------------------------------------------------
PPSA_ECOLI      ----------------------------------------------------------------------
PPSA_METTH      ----------------------------------------------------------------------
PT1_MYCCT       LRLIQ-----------------------------------------------------------------
PPDK1_MAIZE     ----------------------------------------------------------------------
PPDK1_ORYSJ     ----------------------------------------------------------------------
PTFAX_ECOL6     LRMLQ-----------------------------------------------------------------
PTFX1_ECOLI     LRMLQ-----------------------------------------------------------------
PTFAX_SHIFL     LRMLQ-----------------------------------------------------------------
PTFAX_ECO57     LRMLQ-----------------------------------------------------------------
PPDK_RICPR      ----------------------------------------------------------------------
PPDK_FLATR      ----------------------------------------------------------------------
PPDK_FLABI      ----------------------------------------------------------------------
PT1_BORBU       IKKVLDDGVSSGIDVSVCG---------------------------------------------------
PPDK_RICTY      ----------------------------------------------------------------------
PPDK_RICFE      ----------------------------------------------------------------------
PT1_CHLMU       IHYVAARAKQRNIPVSVCG---------------------------------------------------
PT1_BACME       ----------------------------------------------------------------------
PPDK_FLABR      ----------------------------------------------------------------------
PT1_BACHD       ----------------------------------------------------------------------
PPDK_RICCN      ----------------------------------------------------------------------
PPDK_RICBR      ----------------------------------------------------------------------
PPDK_MESCR      ----------------------------------------------------------------------
PPDK1_ARATH     ----------------------------------------------------------------------
PT1_MYCGE       LRLIKLVVEGGKLN--------------------------------------------------------
PPSA_HELPY      FKKAIEACKRHNKYCGICG---------------------------------------------------
PPSA_HELPJ      FKKAIEACKRHNKYCGICG---------------------------------------------------
PT1_HAEIN       IKQVID----------------------------------------------------------------
PT1_CHLTR       IHHVVEQAKQKNVPVSVCGEMDPALLPMFLGLGVK-----------------------------------
PPDK_FLAPR      ----------------------------------------------------------------------
PT1_CHLPN       IHHVLQAAKQNQVPVSICG---------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxx
PPSA_PYRHO      ---------
PPSA_PYRFU      ---------
PPSA_PYRAB      ---------
PPSA_ARCFU      ---------
PPSA_METJA      ---------
PPSA_AERPE      ---------
PT1P_SALTY      ---------
PT1_STRCO       ---------
PPSA_STAMF      ---------
PT1P_ECOLI      ---------
PT1_MYCPN       ---------
PPSA_ECOLI      ---------
PPSA_METTH      ---------
PT1_MYCCT       ---------
PPDK1_MAIZE     ---------
PPDK1_ORYSJ     ---------
PTFAX_ECOL6     ---------
PTFX1_ECOLI     ---------
PTFAX_SHIFL     ---------
PTFAX_ECO57     ---------
PPDK_RICPR      ---------
PPDK_FLATR      ---------
PPDK_FLABI      ---------
PT1_BORBU       ---------
PPDK_RICTY      ---------
PPDK_RICFE      ---------
PT1_CHLMU       ---------
PT1_BACME       ---------
PPDK_FLABR      ---------
PT1_BACHD       ---------
PPDK_RICCN      ---------
PPDK_RICBR      ---------
PPDK_MESCR      ---------
PPDK1_ARATH     ---------
PT1_MYCGE       ---------
PPSA_HELPY      ---------
PPSA_HELPJ      ---------
PT1_HAEIN       ---------
PT1_CHLTR       ---------
PPDK_FLAPR      ---------
PT1_CHLPN       ---------