[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for spne4:ACF56712.1

[Show Plain Result]


## Summary of Sequence Search
    1::280
    7::261     6e-76  54%  276 aa  GR_BACSU RecName: Full=Glyoxal reductase;         Short=GR;        
   11::284     4e-69  48%  284 aa  P100_LEIMA RecName: Full=Probable reductase;         EC=1.1.-.-;
   11::303     5e-64  48%  312 aa  YPR1_YEAST RecName: Full=Putative reductase 1;         EC=1.1.1.-;
    7::258     3e-62  47%  275 aa  Y2408_MYCS2 RecName: Full=Uncharacterized oxidoreductase
   14::300     4e-60  47%  312 aa  GCY_YEAST RecName: Full=Protein GCY;         EC=1.1.1.-;
   11::280     5e-60  45%  280 aa  YTBE_BACSU RecName: Full=Uncharacterized oxidoreductase ytbE;      
    8::259     7e-58  44%  276 aa  Y1919_MYCSJ RecName: Full=Uncharacterized oxidoreductase Mjls_1919;
    8::259     2e-57  43%  276 aa  Y1985_MYCSK RecName: Full=Uncharacterized oxidoreductase Mkms_1985;
    8::253     5e-56  46%  275 aa  DKGA_ECOLI RecName: Full=2,5-diketo-D-gluconic acid reductase A;   
    8::253     2e-55  45%  275 aa  DKGA_ECO57 RecName: Full=2,5-diketo-D-gluconic acid reductase A;   
    4::292     3e-52  40%  323 aa  ALDX_SPOSA RecName: Full=Aldehyde reductase 1;         Short=ALR 1;
   13::264     2e-51  44%  283 aa  Y2407_MYCS2 RecName: Full=Uncharacterized oxidoreductase
    4::271     2e-51  41%  297 aa  ALRA_DICDI RecName: Full=Aldose reductase A;         Short=ARA;    
    7::257     5e-51  44%  275 aa  YER5_SCHPO RecName: Full=Uncharacterized oxidoreductase C2F3.05c;  
    9::260     7e-51  45%  279 aa  Y4205_MYCGI RecName: Full=Uncharacterized oxidoreductase Mflv_4205;
    8::278     9e-51  41%  278 aa  DKGA_CORSC RecName: Full=2,5-diketo-D-gluconic acid reductase A;   
    8::292     1e-50  41%  325 aa  AK1A1_PIG RecName: Full=Alcohol dehydrogenase [NADP+];       
    8::292     1e-50  42%  325 aa  AK1A1_BOVIN RecName: Full=Alcohol dehydrogenase [NADP+];       
    9::260     7e-50  44%  279 aa  Y2161_MYCVP RecName: Full=Uncharacterized oxidoreductase Mvan_2161;
   10::288     1e-49  44%  296 aa  MORA_PSEPU RecName: Full=Morphine 6-dehydrogenase;       
    6::265     2e-49  40%  282 aa  YJ66_YEAST RecName: Full=Uncharacterized oxidoreductase YJR096W;   
    4::267     2e-49  42%  321 aa  YOF5_CAEEL RecName: Full=Uncharacterized oxidoreductase ZK1290.5;  
    8::292     2e-49  40%  325 aa  AK1A1_RAT RecName: Full=Alcohol dehydrogenase [NADP+];       
    8::253     5e-49  44%  277 aa  DKGA_YERPE RecName: Full=2,5-diketo-D-gluconic acid reductase A;   
    8::292     5e-49  40%  325 aa  AK1A1_MOUSE RecName: Full=Alcohol dehydrogenase [NADP+];       
    6::289     1e-48  41%  316 aa  AK1BA_HUMAN RecName: Full=Aldo-keto reductase family 1 member B10; 
    8::292     1e-48  40%  325 aa  AK1A1_PONAB RecName: Full=Alcohol dehydrogenase [NADP+];       
   17::300     2e-48  41%  321 aa  ALRC_DICDI RecName: Full=Aldose reductase C;         Short=ARC;    
   15::297     3e-48  41%  325 aa  YBN4_SCHPO RecName: Full=Uncharacterized oxidoreductase C8E4.04;   
    8::292     4e-48  40%  325 aa  AK1A1_HUMAN RecName: Full=Alcohol dehydrogenase [NADP+];       
    8::253     7e-48  42%  275 aa  DKGA_SALTY RecName: Full=2,5-diketo-D-gluconic acid reductase A;   
    8::253     1e-47  42%  275 aa  DKGA_SALTI RecName: Full=Putative 2,5-diketo-D-gluconic acid
   16::264     2e-47  42%  283 aa  Y1984_MYCSK RecName: Full=Uncharacterized oxidoreductase Mkms_1984;
   16::264     2e-47  42%  283 aa  Y1938_MYCSS RecName: Full=Uncharacterized oxidoreductase Mmcs_1938;
   15::263     2e-47  42%  282 aa  Y2996_MYCBO RecName: Full=Uncharacterized oxidoreductase Mb2996;   
   15::263     2e-47  42%  282 aa  Y2993_MYCBP RecName: Full=Uncharacterized oxidoreductase BCG_2993; 
   16::264     1e-46  41%  283 aa  Y1918_MYCSJ RecName: Full=Uncharacterized oxidoreductase Mjls_1918;
   15::263     1e-46  42%  282 aa  Y2999_MYCTA RecName: Full=Uncharacterized oxidoreductase MRA_2999; 
   15::263     1e-46  42%  282 aa  Y2971_MYCTU RecName: Full=Uncharacterized oxidoreductase
   15::266     4e-46  39%  282 aa  Y1669_MYCLE RecName: Full=Uncharacterized oxidoreductase ML1669;   
   15::266     4e-46  39%  282 aa  Y1669_MYCLB RecName: Full=Uncharacterized oxidoreductase MLBr01669;
    4::277     4e-46  41%  301 aa  AKCL2_MOUSE RecName: Full=1,5-anhydro-D-fructose reductase;        
    3::250     6e-46  38%  267 aa  DKGB_ECOLI RecName: Full=2,5-diketo-D-gluconic acid reductase B;   
   17::268     1e-45  40%  284 aa  Y3816_MYCA1 RecName: Full=Uncharacterized oxidoreductase MAV_3816; 
   14::288     2e-45  38%  320 aa  ALDR_HORVU RecName: Full=Aldose reductase;         Short=AR;       
    3::250     5e-45  38%  267 aa  DKGB_ECO57 RecName: Full=2,5-diketo-D-gluconic acid reductase B;   
   14::265     7e-45  40%  281 aa  Y3007_MYCPA RecName: Full=Uncharacterized oxidoreductase MAP_3007; 
    6::292     7e-45  38%  311 aa  ALRB_DICDI RecName: Full=Aldose reductase B;         Short=ARB;    
    3::277     7e-45  41%  301 aa  AKCL2_RAT RecName: Full=1,5-anhydro-D-fructose reductase;       
   14::262     9e-45  40%  281 aa  Y1744_MYCMM RecName: Full=Uncharacterized oxidoreductase MMAR_1744;
   21::294     2e-44  40%  315 aa  6DCS_SOYBN RecName: Full=NAD(P)H-dependent 6'-deoxychalcone
   15::263     3e-44  40%  282 aa  Y1987_MYCUA RecName: Full=Uncharacterized oxidoreductase MUL_1987; 
    3::274     2e-43  41%  301 aa  AKCL2_PIG RecName: Full=1,5-anhydro-D-fructose reductase;       
   16::302     2e-43  40%  321 aa  NADO1_ORYSJ RecName: Full=Probable NAD(P)H-dependent oxidoreductase
    1::291     9e-43  39%  310 aa  S6PD_MALDO RecName: Full=NADP-dependent D-sorbitol-6-phosphate
    9::296     9e-43  41%  323 aa  AK1CD_MOUSE RecName: Full=Aldo-keto reductase family 1 member C13; 
    6::289     1e-42  39%  316 aa  ALDR_RAT RecName: Full=Aldose reductase;         Short=AR;       
   10::266     2e-42  40%  283 aa  YKW2_SCHPO RecName: Full=Uncharacterized oxidoreductase P32A8.02;  
   16::300     3e-42  38%  321 aa  YDG7_SCHPO RecName: Full=Uncharacterized oxidoreductase C26F1.07;  
   16::268     3e-42  39%  286 aa  Y4483_MYCA1 RecName: Full=Uncharacterized oxidoreductase MAV_4483; 
    1::292     3e-42  41%  318 aa  XYL1_PICST RecName: Full=NAD(P)H-dependent D-xylose reductase;     
   18::299     3e-42  39%  322 aa  NADO2_ORYSJ RecName: Full=Probable NAD(P)H-dependent oxidoreductase
    6::287     3e-42  38%  327 aa  AK1A1_CHICK RecName: Full=Alcohol dehydrogenase [NADP+];       
    6::289     3e-42  39%  316 aa  ALDR_MOUSE RecName: Full=Aldose reductase;         Short=AR;       
    7::289     3e-42  38%  316 aa  ALDR_HUMAN RecName: Full=Aldose reductase;         Short=AR;       
    9::296     6e-42  40%  323 aa  DDBX_BOVIN RecName: Full=Dihydrodiol dehydrogenase 3;       
    6::258     7e-42  38%  277 aa  DKGB_CORSS RecName: Full=2,5-diketo-D-gluconic acid reductase B;   
    7::317     1e-41  39%  323 aa  DHB5_MOUSE RecName: Full=Estradiol 17 beta-dehydrogenase 5;        
    7::284     1e-41  37%  324 aa  A1A1B_DANRE RecName: Full=Alcohol dehydrogenase [NADP+] B;       
    6::289     1e-41  38%  316 aa  ALD2_MOUSE RecName: Full=Aldose reductase-related protein 2;       
   10::291     2e-41  38%  327 aa  AK1A1_XENTR RecName: Full=Alcohol dehydrogenase [NADP+];       
    6::296     2e-41  40%  318 aa  XYL1_PACTA RecName: Full=NAD(P)H-dependent D-xylose reductase;     
    9::306     2e-41  41%  323 aa  XYL1_CANSH RecName: Full=NAD(P)H-dependent D-xylose reductase;     
    3::250     2e-41  36%  267 aa  DKGB_SALTY RecName: Full=2,5-diketo-D-gluconic acid reductase B;   
   16::268     3e-41  38%  286 aa  Y4149_MYCPA RecName: Full=Uncharacterized oxidoreductase MAP_4149; 
    9::307     3e-41  37%  324 aa  XYL2_CANTR RecName: Full=NADPH-dependent D-xylose reductase II,III;
    6::285     3e-41  36%  316 aa  ALD1_MOUSE RecName: Full=Aldose reductase-related protein 1;       
    4::290     3e-41  37%  324 aa  A1A1A_DANRE RecName: Full=Alcohol dehydrogenase [NADP+] A;       
    5::293     4e-41  39%  319 aa  XYL1_ASPNG RecName: Full=NAD(P)H-dependent D-xylose reductase;     
   10::272     5e-41  41%  284 aa  I3ACR_SCHPO RecName: Full=NAD/NADP-dependent indole-3-acetaldehyde
    3::250     5e-41  36%  267 aa  DKGB_SALTI RecName: Full=2,5-diketo-D-gluconic acid reductase B;   
    9::299     8e-41  39%  323 aa  AKC1H_RAT RecName: Full=Aldo-keto reductase family 1 member C18;   
   12::301     1e-40  40%  321 aa  DTDH_MUCMU RecName: Full=4-dihydromethyl-trisporate dehydrogenase; 
    9::307     2e-40  37%  324 aa  XYL1_CANTR RecName: Full=NAD(P)H-dependent D-xylose reductase I,II;
    7::289     2e-40  38%  316 aa  ALDR_PIG RecName: Full=Aldose reductase;         Short=AR;       
    7::289     2e-40  37%  316 aa  ALDR_RABIT RecName: Full=Aldose reductase;         Short=AR;       
   10::291     2e-40  38%  327 aa  AK1A1_XENLA RecName: Full=Alcohol dehydrogenase [NADP+];       
    5::295     5e-40  38%  301 aa  ALDR_ENCCU RecName: Full=Aldose reductase;         Short=AR;       
    1::289     5e-40  36%  316 aa  ALD2_CRIGR RecName: Full=Aldose reductase-related protein 2;       
    1::202     5e-40  43%  228 aa  AK1A1_CRIGR RecName: Full=Alcohol dehydrogenase [NADP+];       
    3::296     7e-40  38%  320 aa  AKCL2_HUMAN RecName: Full=1,5-anhydro-D-fructose reductase;        
    9::296     9e-40  40%  323 aa  AK1C2_HUMAN RecName: Full=Aldo-keto reductase family 1 member C2;  
   10::299     2e-39  38%  323 aa  PE2R_RABIT RecName: Full=Prostaglandin-E(2) 9-reductase;       
    5::301     3e-39  38%  317 aa  XYL1_PICGU RecName: Full=NADPH-dependent D-xylose reductase;       
    9::296     3e-39  39%  323 aa  AKC1H_MOUSE RecName: Full=Aldo-keto reductase family 1 member C18; 
    9::296     3e-39  39%  323 aa  AK1C1_PONAB RecName: Full=Aldo-keto reductase family 1 member C1
    9::296     3e-39  40%  323 aa  AK1C1_HUMAN RecName: Full=Aldo-keto reductase family 1 member C1;  
    9::296     4e-39  38%  323 aa  PGFS1_BOVIN RecName: Full=Prostaglandin F synthase 1;       
    6::288     1e-38  36%  315 aa  ALDR_BOVIN RecName: Full=Aldose reductase;         Short=AR;       
    9::296     1e-38  39%  323 aa  AK1C1_MACFU RecName: Full=Aldo-keto reductase family 1 member C1
   11::302     1e-38  37%  324 aa  XYL1_CANPA RecName: Full=NADH-dependent D-xylose reductase;        
    9::296     1e-38  38%  323 aa  PGFS2_BOVIN RecName: Full=Prostaglandin F synthase 2;       
    3::296     1e-38  37%  320 aa  AKCL2_MACFA RecName: Full=1,5-anhydro-D-fructose reductase;        
   10::296     1e-38  39%  323 aa  AK1C4_MACFA RecName: Full=Aldo-keto reductase family 1 member C4;  
    9::296     1e-38  39%  323 aa  AK1C1_MACFA RecName: Full=Aldo-keto reductase family 1 member C1
    1::232     2e-38  37%  267 aa  DKGB_YERPE RecName: Full=2,5-diketo-D-gluconic acid reductase B;   
    9::296     2e-38  38%  323 aa  AK1C4_HUMAN RecName: Full=Aldo-keto reductase family 1 member C4;  
   10::296     4e-38  39%  323 aa  AK1C4_MACFU RecName: Full=Aldo-keto reductase family 1 member C4;  
    9::295     5e-38  37%  322 aa  AK1CN_HORSE RecName: Full=Aldo-keto reductase family 1 member C23; 
    9::296     5e-38  38%  323 aa  AK1C3_PONAB RecName: Full=Aldo-keto reductase family 1 member C3
   11::300     6e-38  37%  324 aa  CRO_RANCA RecName: Full=Rho crystallin;
   25::297     8e-38  39%  344 aa  ARA1_YEAST RecName: Full=D-arabinose dehydrogenase [NAD(P)+] heavy
    9::296     8e-38  38%  323 aa  AK1C3_HUMAN RecName: Full=Aldo-keto reductase family 1 member C3;  
    9::296     2e-37  38%  323 aa  AK1CO_HORSE RecName: Full=Aldo-keto reductase family 1 member
   12::302     2e-36  35%  326 aa  AK1D1_HUMAN RecName: Full=3-oxo-5-beta-steroid 4-dehydrogenase;    
   10::296     2e-36  38%  323 aa  AK1CL_MOUSE RecName: Full=Aldo-keto reductase family 1 member C21; 
   11::300     2e-36  36%  324 aa  CRO_RANTE RecName: Full=Rho crystallin;
    6::289     3e-36  37%  329 aa  XYL1_KLULA RecName: Full=NAD(P)H-dependent D-xylose reductase;     
    9::305     1e-35  39%  322 aa  XYL1_CANTE RecName: Full=NAD(P)H-dependent D-xylose reductase;     
   12::301     1e-35  35%  325 aa  AK1D1_MOUSE RecName: Full=3-oxo-5-beta-steroid 4-dehydrogenase;    
    7::288     7e-35  38%  327 aa  GRE3_YEAST RecName: Full=NADPH-dependent aldose reductase GRE3;    
   10::296     1e-34  38%  322 aa  DIDH_RAT RecName: Full=3-alpha-hydroxysteroid dehydrogenase;       
   12::302     3e-34  34%  326 aa  AK1D1_RABIT RecName: Full=3-oxo-5-beta-steroid 4-dehydrogenase;    
   12::302     2e-33  35%  326 aa  AK1D1_RAT RecName: Full=3-oxo-5-beta-steroid 4-dehydrogenase;      
   16::259     2e-33  35%  276 aa  YHH5_SCHPO RecName: Full=Uncharacterized oxidoreductase C28F2.05;  
    8::290     2e-33  35%  312 aa  KAR_YEAST RecName: Full=NADPH-dependent alpha-keto amide reductase;
   16::296     3e-33  38%  322 aa  AK1CD_MESAU RecName: Full=Aldo-keto reductase family 1 member C13; 
    5::295     2e-32  35%  324 aa  XYL1_TRIRE RecName: Full=NAD(P)H-dependent D-xylose reductase;     
    9::291     2e-31  38%  318 aa  AK1CL_RAT RecName: Full=Aldo-keto reductase family 1 member C21;   
    7::284     2e-24  35%  284 aa  YEAE_ECOLI RecName: Full=Uncharacterized protein yeaE;
   12::122     4e-22  51%  129 aa  AKCL1_HUMAN RecName: Full=Aldo-keto reductase family 1 member
    8::218     6e-22  38%  331 aa  GS69_BACSU RecName: Full=General stress protein 69;       
   10::122     2e-20  46%  130 aa  TRAKR_HUMAN RecName: Full=Putative truncated aldo-keto reductase;  
   42::321     1e-19  33%  326 aa  YDJG_ECOLI RecName: Full=Uncharacterized oxidoreductase ydjG;      
   26::301     2e-18  33%  310 aa  YCCK_BACSU RecName: Full=Uncharacterized oxidoreductase yccK;      
   35::281     2e-15  31%  306 aa  YH5B_SCHPO RecName: Full=Uncharacterized oxidoreductase C215.11c;  
   47::339     8e-15  33%  351 aa  YI7E_SCHPO RecName: Full=Putative aryl-alcohol dehydrogenase
   51::298     3e-14  30%  298 aa  YDHF_ECOLI RecName: Full=Oxidoreductase ydhF;         EC=1.-.-.-;
   13::302     4e-14  33%  340 aa  YAKC_SCHPO RecName: Full=Aldo-keto reductase yakc [NADP+];       
   94::363     4e-14  33%  377 aa  Y1669_ARATH RecName: Full=Uncharacterized oxidoreductase At1g06690,
   25::301     4e-14  30%  310 aa  IOLS_BACSU RecName: Full=Protein iolS;         EC=1.1.1.-;AltName:
   37::313     6e-14  31%  324 aa  YAJO_ECOLI RecName: Full=Uncharacterized oxidoreductase yajO;      
    4::280     4e-13  31%  326 aa  YRPG_BACSU RecName: Full=Uncharacterized oxidoreductase yrpG;      
    7::294     2e-12  31%  329 aa  AAD4_YEAST RecName: Full=Probable aryl-alcohol dehydrogenase AAD4; 
    8::329     5e-12  31%  346 aa  TAS_SHIFL RecName: Full=Protein tas;
    8::329     5e-12  31%  346 aa  TAS_ECOLI RecName: Full=Protein tas;
   45::340     5e-12  31%  376 aa  AAD14_YEAST RecName: Full=Putative aryl-alcohol dehydrogenase
   47::286     1e-11  31%  300 aa  YCSN_BACSU RecName: Full=Uncharacterized oxidoreductase ycsN;      
   16::174     2e-11  35%  306 aa  YQKF_BACSU RecName: Full=Uncharacterized oxidoreductase yqkF;      
   11::300     3e-11  30%  323 aa  Y2320_MYCBO RecName: Full=Uncharacterized oxidoreductase Mb2320;   
   11::300     3e-11  30%  323 aa  Y2298_MYCTU RecName: Full=Uncharacterized oxidoreductase
   42::295     3e-11  32%  344 aa  KCAB_SCHPO RecName: Full=Putative voltage-gated potassium channel
   51::336     3e-10  30%  387 aa  STCV_EMENI RecName: Full=Putative sterigmatocystin biosynthesis
    9::290     6e-10  34%  328 aa  KCAB_ORYSJ RecName: Full=Probable voltage-gated potassium channel
   15::215     3e-09  30%  306 aa  IN22_MAIZE RecName: Full=IN2-2 protein;
   21::292     4e-09  31%  346 aa  YGHZ_ECOLI RecName: Full=Uncharacterized protein yghZ;
   21::292     4e-09  31%  346 aa  YGHZ_ECO57 RecName: Full=Uncharacterized protein yghZ;
   45::312     1e-08  33%  367 aa  KCAB2_HUMAN RecName: Full=Voltage-gated potassium channel subunit
  147::284     2e-08  26%  286 aa  YDBC_ECOLI RecName: Full=Putative oxidoreductase ydbC;       
   45::312     2e-08  33%  367 aa  KCAB2_BOVIN RecName: Full=Voltage-gated potassium channel subunit
   45::312     2e-08  32%  367 aa  KCAB2_XENLA RecName: Full=Voltage-gated potassium channel subunit
   45::312     2e-08  33%  367 aa  KCAB2_RAT RecName: Full=Voltage-gated potassium channel subunit
   45::312     2e-08  33%  367 aa  KCAB2_MOUSE RecName: Full=Voltage-gated potassium channel subunit
   79::258     5e-08  31%  401 aa  KCAB1_RAT RecName: Full=Voltage-gated potassium channel subunit
   97::276     5e-08  31%  419 aa  KCAB1_RABIT RecName: Full=Voltage-gated potassium channel subunit
   86::265     5e-08  31%  408 aa  KCAB1_MUSPU RecName: Full=Voltage-gated potassium channel subunit
   79::258     5e-08  31%  401 aa  KCAB1_MOUSE RecName: Full=Voltage-gated potassium channel subunit
   97::276     5e-08  31%  419 aa  KCAB1_HUMAN RecName: Full=Voltage-gated potassium channel subunit
   79::258     5e-08  31%  401 aa  KCAB1_BOVIN RecName: Full=Voltage-gated potassium channel subunit
   46::352     5e-08  28%  385 aa  AAD_PHACH RecName: Full=Aryl-alcohol dehydrogenase [NADP+];        
   79::258     2e-07  31%  401 aa  KCAB1_CHICK RecName: Full=Voltage-gated potassium channel subunit
   86::191     4e-07  33%  274 aa  GSH0_HUMAN RecName: Full=Glutamate--cysteine ligase regulatory
    4::205     6e-07  30%  331 aa  ARK74_HUMAN RecName: Full=Aflatoxin B1 aldehyde reductase member 4;
   79::258     8e-07  29%  401 aa  KCAB3_XENLA RecName: Full=Voltage-gated potassium channel subunit
   86::191     1e-06  32%  274 aa  GSH0_RAT RecName: Full=Glutamate--cysteine ligase regulatory
   86::191     1e-06  32%  274 aa  GSH0_MOUSE RecName: Full=Glutamate--cysteine ligase regulatory
   62::320     1e-06  29%  388 aa  NORA_ASPPA RecName: Full=Norsolorinic acid reductase;       
   86::191     1e-06  32%  274 aa  GSH0_BOVIN RecName: Full=Glutamate--cysteine ligase regulatory
   47::252     1e-06  31%  288 aa  AAD10_YEAST RecName: Full=Putative aryl-alcohol dehydrogenase
   62::320     2e-06  29%  388 aa  NORA_ASPFL RecName: Full=Norsolorinic acid reductase;       
    4::205     8e-06  30%  331 aa  ARK73_HUMAN RecName: Full=Aflatoxin B1 aldehyde reductase member 3;
   60::241     8e-06  29%  367 aa  ARK72_MOUSE RecName: Full=Aflatoxin B1 aldehyde reductase member 2;
   32::209     1e-05  29%  327 aa  ARK73_RAT RecName: Full=Aflatoxin B1 aldehyde reductase member 3;  
   52::233     2e-05  28%  359 aa  ARK72_HUMAN RecName: Full=Aflatoxin B1 aldehyde reductase member 2;
  191::298     5e-05  36%  320 aa  YZ38_AQUAE RecName: Full=Probable adenosine monophosphate-protein
   53::152     9e-05  32%  212 aa  AAD6_YEAST RecName: Full=Putative aryl-alcohol dehydrogenase AAD6; 
  151::205     2e-04  31%  287 aa  GSH0_SCHPO RecName: Full=Putative glutamate--cysteine ligase
  125::241     4e-04  32%  367 aa  ARK72_RAT RecName: Full=Aflatoxin B1 aldehyde reductase member 2;  
  312::414     5e-04  32%  706 aa  IF2_ALKMQ RecName: Full=Translation initiation factor IF-2;
  158::243     5e-04  25%  514 aa  CLS2_BACCR RecName: Full=Cardiolipin synthetase 2;       
   15::95      6e-04  35%  239 aa  MHR1_CANAL RecName: Full=Mitochondrial homologous recombination
   33::172     6e-04  36%  285 aa  ALKE_BABBO RecName: Full=Aldo-keto reductase;Flags: Fragment;
   10::62      8e-04  45%   89 aa  CROB_LEPLU RecName: Full=Rho beta-crystallin;Flags: Fragments;
  158::243     8e-04  24%  514 aa  CLS2_BACAN RecName: Full=Cardiolipin synthetase 2;       
    1::280

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MDTYQLNNGVEIPVLGFGTFKAKDGEEAYRAVLEALKAGYRHIDTAAIYQNEESVGQAIKDSGVPREELF
GR_BACSU        -DTVKLHNGVEMPWFGLGVFKVENGNEATESVKAAIKNGYRSIDTAAIYKNEEGVGIGIKESGVAREELF
P100_LEIMA      -----LSNGVKMPQFGLGVWQSPAGEVTENAVNWALCAGYRHIDTAAIYKNEESVGAGLRASGVPREDVF
YPR1_YEAST      --TLKLNTGASIPVLGFGTWRSVDNN-GYHSVIAALKAGYRHIDAAAIYLNEEEVGRAIKDSGVPREEIF
Y2408_MYCS2     -----LNDGNSIPQVGLGVWQTP-AEDTERAVAAALQAGYRHIDTAAAYRNETETGRAIANSGVPREDIF
GCY_YEAST       -----LNTGAQIPQIGLGTWQSKEND-AYKAVLTALKDGYRHIDTAAIYRNEDQVGQAIKDSGVPREEIF
YTBE_BACSU      -----LHNGVEMPWFGLGVFQVEEGSELVNAVKTAIVHGYRSIDTAAIYGNXXXXXXXXXXXXXXXXDLF
Y1919_MYCSJ     -----LNDGNSIPQVGLGVWQTPP-EDTERXXXXXXXXGYRHVDTAAAYGNEEQTGRAIAQSGLDRSQVY
Y1985_MYCSK     -----LNDGNSIPQVGLGVWQTPP-EDTERXXXXXXXXGYRHVDTAAAYGNEEQTGRAIAQSGLDRSQVY
DKGA_ECOLI      ----KLQDGNVMPQLGLGVWQASN-EEVITAIQKALEVGYRSIDTAAAYKNEEGVGKALKNASVNREELF
DKGA_ECO57      ----KLQDGNVMPQLGLGVWQASN-EEVITAIQKALEVGYRSFDTAAAYKNEEGVGKALKNASVNREELF
ALDX_SPOSA      --TTTLNTGASLELVGYGTWQAAPGEVG-QGVKVAIETGYRHLDLAKVYSNQPEVGAAIKEAGVKREDLF
Y2407_MYCS2     --TVTLNDDNTLPVVGIGVGELSDSE-AERSVSAALEAGYRLIDTAAAYGNEAAVGRAIAASGIPRDEIY
ALRA_DICDI      --SFKLSSGHKIPLVGFGTWKAETTLVG-KAVEVALDAGYRHIDCAAVYLNEKEVGEAFTEATVKREDVF
YER5_SCHPO      ----KLNNGLKCPQFAYGSYMV-NRTKCFDSVYAALQCGYRHIDSAQMYHNEADCGRAIEETGTKREDIW
Y4205_MYCGI     --TVTLNDDNTMPVIGLGVGELSDAETE-QAVTAALEAGYRLIDTAAAYGNEAAVGRAIAASGVPRDELF
DKGA_CORSC      -----LNDGNSIPQLGYGVFKVPPAD-TQRAVEEALEVGYRHIDTAAIYGNEEGVXXXXXXXXXXRDDLF
AK1A1_PIG       -----LHTGQKMPLIGLGTWKSEPGQ-VKAAIKYALTVGYRHIDCAAIYGNELEIGEALTETAVPREELF
AK1A1_BOVIN     -----LHTGQKMPLIGLGTWKSDPGQ-VKAAIKYALSVGYRHIDCAAIYGNETEIGEALKENVVPREELF
Y2161_MYCVP     --TVILNDDNTMPVIGLGVGELSDAE-AEQSVLAALEAGYRLIDTAAAYGNEAAVGRAIAKSGVPRGELF
MORA_PSEPU      -----LNNGVKMPALGLGVFXXXXXXXXXXXXXXXXX-GYRLIDTARSYNNEAQVGEGIRNSGVDRAEMF
YJ66_YEAST      ---YKLSNGFKIPSIALGTYDIPRSQTA-EIVYEGVKCGYRHFDTAVLYGNEKEVGDGIEDPGNKREEIF
YOF5_CAEEL      --TTVLSNNVEMPLIGLGT--THSGGYYHDAVLHSIKCGYRLIDTAKRYGVEKQLGIAVKNCSVPREEMF
AK1A1_RAT       -----LHTGQKMPLIGLGTWKSEPGQ-VKAAIKYALSVGYRHIDCASVYGNETEIGEALKESAVPREELF
DKGA_YERPE      ----KLYDGRLMPQLGLGVWQASI-QETELAVSKALEVGYRSIDTAAIYKNXXXXXXXXXXXXXXRDELF
AK1A1_MOUSE     -----LHTGQKMPLIGLGTWKSEPGQ-VKAAIKHALSAGYRHIDCASVYGNETEIGEALKESAVPREELF
AK1BA_HUMAN     ----ELSTKAKMPIVGLGTWKSPLGK-VKEAVKVAIDAGYRHIDCAYVYQNEHEVGEAIQEKAVKREDLF
AK1A1_PONAB     -----LHTGQKMPLIGLGTWKSEPGQ-VKAAVKYALSVGYRHIDCAAIYGNEPEIGEALKEDAVPREELF
ALRC_DICDI      ---FKLNDGNQIPSIGLGTYYSENPGEVGDAINNALKNGYRHIDGAAFYGNEKVIGNSLKEGEIKREDIF
YBN4_SCHPO      ---FTLPNGDKIPSIGLGTWRSGK-DETKNAVCAALKAGYRHIDTAHIYGNEKEIGEGIRESGVPRTDIW
AK1A1_HUMAN     -----LHTGQKMPLIGLGTWKSEPGQ-VKAAVKYALSVGYRHIDCAAIYGNEPEIGEALKEDAVPREELF
DKGA_SALTY      ----RLQDGNVMPQLGLGVWKASN-EEVIAAIHKALEVGYRSIDTATAYQNEEGVGKALKAASVAREELF
DKGA_SALTI      ----RLQDGNVMPQLGLGVWKASN-EEVIAAIHKALEVGYRSIDTATAYQNEEGVGKALKAASVAREELF
Y1984_MYCSK     -----LNDGHSIPVLGLGV-GXXXXXXXXXXXXXXXXXGYRLIDTAAVYGNEAAVGRAVNASGIPREEIY
Y1938_MYCSS     -----LNDGHSIPVLGLGV-GXXXXXXXXXXXXXXXXXGYRLIDTAAVYGNEAAVGRAVNASGIPREEIY
Y2996_MYCBO     -----LNDEHTMPVLGLGVAELSD-DETERAVSAALEIGCRLIDTAYAYGNEAAVGRAIAASGVAREELF
Y2993_MYCBP     -----LNDEHTMPVLGLGVAELSD-DETERAVSAALEIGCRLIDTAYAYGNEAAVGRAIAASGVAREELF
Y1918_MYCSJ     -----LNDGHSIPVLGLGV-GXXXXXXXXXXXXXXXXXGYRLIDTAAVYGNEAAVGRAVNASGIPREEIY
Y2999_MYCTA     -----LNDEHTMPVLGLGVAELSD-DETERAVSAALEIGCRLIDTAYAYGNEAAVGRAIAASGVAREELF
Y2971_MYCTU     -----LNDEHTMPVLGLGVAELSD-DETERAVSAALEIGCRLIDTAYAYGNEAAVGRAIAASGVAREELF
Y1669_MYCLE     -----LNDENTMPLLGLGVAELSE-DETERAVLAALEIGCRLIDTAAAYGNEAAVSRAIAASGIPRAQLF
Y1669_MYCLB     -----LNDENTMPLLGLGVAELSE-DETERAVLAALEIGCRLIDTAAAYGNEAAVSRAIAASGIPRAQLF
AKCL2_MOUSE     -----------IPTVGLGTWKASPGEVT-DAVKLAINLGYRHFDCAYLYHNESEVGEKIKEGVVKREDLF
DKGB_ECOLI      -----------IPAFGLGTFRLKD-DVVISSVITALELGYRAIDTAQIYDNEAAVGQAIAESGVPRHELY
Y3816_MYCA1     -----LNDENTMPVLGLGVAELSD-DETERAVSAALEVGCRLIDTAAAYGNEAAVGRAIAASGIPRAELF
ALDR_HORVU      -DHFVLKSGHAMPAVGLGTWRA--GSDTAHSVRTAIEAGYRHVDTAAEYGVEKEVGKGLKEAGIDRKDLF
DKGB_ECO57      -----------IPAFGLGTFRLKD-DVVISSVKTALELGYRAIDTAQIYDNEAAVGLAIAESGVPRHELY
Y3007_MYCPA     -----LNDENTMPVLGLGVAELSD-DETERAVSAALEVGCRLIDTAAAYGNEAAVGRAIAASGIPRAELF
ALRB_DICDI      -NTFKLNDDIHIPMIGLGTYNGAKVGEVGDAVKVALKSGYRHIDGAAIYMNEKEIGHALKEGEIKREDIF
AKCL2_RAT       ----------QIPTVGLGTWKASPGEVT-DAVKVAINLGYRHFDCAYLYHNESEVGEKIKEGVVKRDELF
Y1744_MYCMM     -----LNDENTMPVLGMGVAGLSD-DETERAVSAALEIGCRLIDTAAAYGNEAAVGRAIAASGIPRAELF
6DCS_SOYBN      -----------MPVVGMGSFTCK--KDTKEAIIEAVKQGYRHFDTAAAYGSEQALGEALKEAIVSRQDLF
Y1987_MYCUA     -----LNDENTMPVLGMGVAGLSD-DETERAVSAALEIGCRLIDTAAAYGNEAAVGRALAASGIPRAELF
AKCL2_PIG       ----------KIPVLGLGTWQAAPGEVT-EAVKVAIDTGYRHFDCAYLYHNENEVGVGIQDEGVVREDLF
NADO1_ORYSJ     -----------MPRVGMGTFPFTSSEDTTAAMLRAIELGYRHFDTARIYATEGCVGEAVAEAVASRADVF
S6PD_MALDO      MSTVTLSSGYEMPVIGLGLWRLEK-DELKEVILNAIKIGYRHFDCAAHYKSEADVGEALKTGLVKREELF
AK1CD_MOUSE     ----KLNDGHLIPALGFGTYKPKEKSKSLEAACLALDVGYRHVDTAYAYQVEEEIGQAIKAGVVKREDLF
ALDR_RAT        ----ELNNGTKMPTLGLGTWKSPPGQVT-EAVKVAIDMGYRHIDCAQVYQNEKEVGVALKEQVVKRQDLF
YKW2_SCHPO      --TVTLTNGMVIPRIGFGAFMLKYNE-CYGLVTQALDSGYRHIDTAAVYGNEDICGKAIVDNNVKRTDIF
YDG7_SCHPO      ---FTLADGSKIPGLGLGTWRSEPNQTK-NAVKTALQYGYRHIDAAAIYGNEDEVGDGIKESGVPRKDIW
Y4483_MYCA1     --TVALNDEAKMPVLGLGVAKLSD-EETESSVLAALEAGCRLIDTAASYGNEAAVGRAIAASGIPREELF
XYL1_PICST      MPSIKLNSGYDMPAVGFGCWKV-DVDTCSEQIYRAIKTGYRLFDGAEDYANEKLVGAGVKDEGVKREDLF
NADO2_ORYSJ     -----------MPRIGMGTFPFTSSEETTAALLRAIELGYRHFDTARLYATEGCVSEAVAEAVASRADVF
AK1A1_CHICK     -DFVALYNGQKIPLIGLGTWKSEPGQ-VKEAVKYALSVGYRHVDCAAAYSNEAEIGDAFQECVGPREDLF
ALDR_MOUSE      ----ELNNGTKMPTLGLGTWKSPPGQVT-EAVKVAIDLGYRHIDCAQVYQNEKEVGVALKEQVVKRQDLF
ALDR_HUMAN      -----LNNGAKMPILGLGTWKSPPGQVT-EAVKVAIDVGYRHIDCAHVYQNENEVGVAIREQVVKREELF
DDBX_BOVIN      ----KLNDGHFIPVLGFGTFAPREKSEALEVTKFAIEAGFRHIDSAHLYQNEEQVGQAIRDGTVKREDIF
DKGB_CORSS      --TISLNDGRPFAEPGLGTYNLR-GDEGVAAMVAAIDSGYRLLDTAVNYENESEVGRAVRASSVDRDELI
DHB5_MOUSE      --TVRLSDGHFIPILGFGTYAPQEKSKATEATKIAIDAGFRHIDSASMYQNEKEVGLAIRDGTVKREDIF
A1A1B_DANRE     -----LSTGRKMPLLGLGTWKSEPGL-VKQAVIWALESGYRHIDCAPIYANEPEIGEAFQDKGIRREDVF
ALD2_MOUSE      ----ELSTKAKMPIVGLGTWKSPPNQ-VKEAVKAAIDAGYRHIDCAYAYCNENEVGEAIKEKAVQREDLF
AK1A1_XENTR     -----LYTGQKIPLIGLGTWKSAPGQ-VKDAVKYALGVGYRHIDCAFVYGNETEVGEAIKESGLSREEVF
XYL1_PACTA      ---YTLNNGRKIPAIGMGCWKL---ENAADMVYAAIKEGYRLFDCACDYGNEKEVGEAIKDGLVKRKDLF
XYL1_CANSH      ---FKLNNGLEMPSIGFGCWKL-DKSTAADQVYNAIKAGYRLFDGAEDYGNEQEVGEGVKDEGVTREEIF
DKGB_SALTY      -----------IPAFGLGTFRLKD-DVVIASVKTALELGYRAVDTAQIYDNEAAVGQAIAESGVPRNELY
Y4149_MYCPA     --TVALNDEAKKPVLGLGVAKLSD-EETESSVLAALEAGCRLIDTAASYGNEAAVGRAIAASGIPREELF
XYL2_CANTR      --TIKLNSGYEMPLVGFGCWKVNN-ETAADQIYNAIKTGYRLFDGAEDYGNEKEVGEAIKEGLVKREELF
ALD1_MOUSE      ----ELSTKAKMPLVGLGTWKSSPGQ-VKEAVKAAIDAGYRHIDCAYVYHNENEVGEAIKENAVKREDLF
A1A1A_DANRE     --TITLSTGQRMPTVGLGTWKSAPGQ-VKQAVLAALDCGYRHIDCAAAYSNEREVGEALTERLGPRDDIF
XYL1_ASPNG      --TVKLNSGYDMPLVGFGLWKVNNDTCADQ-IYHAIKEGYRLFDGACDYGNEVEAGQAIKDGLVKREELF
I3ACR_SCHPO     ---------IPVPAYGVGTFKKEKGETIVDSVKNALAAGFIHIDCAEVYGNEEEVGVALKEANVPRSKLF
DKGB_SALTI      -----------IPAFGLGTFRLKD-DVVIASVKTALELGYRAVDTAQIYDNEAAVGQAIAESGVPRNELY
AKC1H_RAT       ----ELNDGHSIPVLGFGTYATEENKKSMESTKIAIDVGFRHIDCSHLYQNEEEIGQAIEDGTVKREDIF
DTDH_MUCMU      --------GDKMPIRGFGCWKI-DTKDCEETVYQAIKTGYRLFDGACDYGNEVEVGRAINEGLVKREDLF
XYL1_CANTR      --TIKLNSGYEMPLVGFGCWKVTNATAADQ-IYNAIKTGYRLFDGAEDYGNEKEVGEAIKEGLVKREELF
ALDR_PIG        -----LYTGAKMPILGLGTWKSPPGKVT-EAVKVAIDLGYRHIDCAHVYQNENEVGLGLQEKVVKREDLF
ALDR_RABIT      -----LYNGAKMPILGLGTWKSPPGQVT-EAVKTAIDLGYRHIDCAHVYQNENEVGVALKEQVVKREELF
AK1A1_XENLA     -----LYTGQKMPLIGLGTWKSAPGQ-VKDAVKYALGVGYRHIDCAFVYGNETEVGEAIKESGLKREEVF
ALDR_ENCCU      --TQKLNNGKEIPTVGLGTWGMEDEAVLEGAIRNALSLGYRHIDTAFIYGNEKMIGNILKDEGVQRKDLF
ALD2_CRIGR      MSTFELSTKAKMPIVGLGTWQSPPGQ-VKEAVKVAIDAGYRHIDCAYAYYNEHEVGEAIKEKAVRREDLF
AK1A1_CRIGR     -------------LIGLGTWKSNPGQ-VKAAIKYALSVGYRHIDCAAVYGNEIEIGEALKENAVPREELF
AKCL2_HUMAN     ----------DIPAVGLSSWKASPGKVT-EAVKEAIDAGYRHFDCAYFYHNEREVGAGIKEGAVRREDLF
AK1C2_HUMAN     ----KLNDGHFMPVLGFGTYAPAEKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRDGSVKREDIF
PE2R_RABIT      -----LSDGHFIPVLGFGTYAPEEKSKAMEATKIAIDAGFRHIDSAYFYKNEKEVGLAIRDGTVKREDIF
XYL1_PICGU      -----LNSGYEMPSVGFGCWKV-DKATCADTIYNAIKVGYRLFDGAEDYGNEKEVGEGINDEGVARDELF
AKC1H_MOUSE     ----ELNDGHSIPVLGFGTYATEEHKKSMESTKIAIDVGFCHIDCSHLYQNEEEIGQAIEDGTVKREDIF
AK1C1_PONAB     ----KLNDSHFMPVLGFGTYAPPEKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRDGSVKREDIF
AK1C1_HUMAN     ----KLNDGHFMPVLGFGTYAPAEKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRDGSVKREDIF
PGFS1_BOVIN     ----KLNDGHFIPVLGFGTYAPEEKSEALEATKFAIEVGFRHVDSAHLYQNEEQVGQAIRDGTVKREDIF
ALDR_BOVIN      -----LYTGAKMPILGLGTWKSPPGKVT-EAVKVAIDLGYRHIDCAHVYQNENEVGLALQEQVVKREDLF
AK1C1_MACFU     ----KLNDGHFMPVLGFGTYAPAEKNKAIEATKLAIEAGFRHIDSAHLYNNEEYVGLAIRDGTVKREDIF
XYL1_CANPA      ----KLNSGYEIPLVGFGCWKLTN-DVASDQIYRAIKSGYRLFDGAEDYANEQEVGEAIKEGIVKREELF
PGFS2_BOVIN     ----KFNDGHFIPVLGFGTYAPEEKSEALEATKFAIEVGFRHVDSAHLYQNEEQVGQAIRDGTVKREDIF
AKCL2_MACFA     ----------DIPAVGLSCWKASPGKVT-EAVKVAIDAGYRHFNCAYFYHNEKEVGAGIKEGAVRREDLF
AK1C4_MACFA     -----LNDGHFMPVLGFGTYAXXXXXXXXXXXXTAIEAGFRHIDSAYLYNNEEQVGLAIRDGSVKREDIF
AK1C1_MACFA     ----KLNDGHFMPVLGFGTYAPAEKNKALEATKLAIEAGFRHIDSAHLYNNEEYVGLAIRDGTVKREDIF
DKGB_YERPE      ---------MSIPVFGLGTFRLQD-QIVIDSVSQALTLGYRAIDTAQIYENEAPVGQAIQESGINRDELF
AK1C4_HUMAN     ----ELNDGHFMPVLGFGTYAPPERNRAVEVTKLAIEAGFRHIDSAYLYNNEEQVGLAIRDGSVKREDIF
AK1C4_MACFU     -----LNDGHFMPVLGFGSYAXXXXXXXXXXXXTAIEAGFRHIDSAYLYNNEEQVGLAIRDGSVKREDIF
AK1CN_HORSE     ----ELNDGHFIHALGFGTYAPNEKSKAVEATKSAIDAGFRHIDCAHLYDNEKEVGLAIRDGTVKREDIF
AK1C3_PONAB     ----KLNDGHFMPVLGFGTYAPPERSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRDGSVKREDIF
CRO_RANCA       -----LNDGNMMPILGLGTYAAPDVPKAEEAVKTAIDVGYRHIDCAFITGNEMHIGNGIRDGTVKREDIF
ARA1_YEAST      ---FSLNNGVRIPALGLGTANPHEKAETKQAVKAAIKAGYRHIDTAWAYETEPFVGEAIKDGSIKREDLF
AK1C3_HUMAN     ----KLNDGHFMPVLGFGTYAPPERSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRDGSVKREDIF
AK1CO_HORSE     ----KLNDGHVIPVLGFGTYAPEEVPKSRTVEVTAIDAGFRHIDSAYSYNNEKEVGQAIRDGTVKREDIF
AK1D1_HUMAN     -----LSDGNSIPIIGLGTYKSTPKGACATSVKVAIDTGYRHIDGAYIYQNEHEVGEAIREKKVRREDIF
AK1CL_MOUSE     -----LNDGNFIPVLGFGTALPLECPKSKAKELTAIDAGFHHFDSASVYNTEDHVGEAIRDGTVRREDIF
CRO_RANTE       -----LNDGNMMPILGLGTYASPHVPKAEEAVKIAIDVGYRHIDCAFITGNEMHIGNGIRDGTVKREDIF
XYL1_KLULA      -ETVTLNNGEKMPLVGLGCWKMPNDVCADQ-IYEAIKIGYRLFDGAQDYANEKEVGQAIKEGLVKREDLV
XYL1_CANTE      ----KLSSGHLMPSIGFGCWKATAGEQVYQAI----KAGYRLFDGAEDYGNEKEVGDGVKDEGVKREEIF
AK1D1_MOUSE     -----LSDGNNIPLIGLGTYSDPRPVKTYVAVKTAIDEGYRHIDGAYVYHNEHEVGEAIREKKVKREEIF
GRE3_YEAST      -----LNNGLKMPLVGLGCWKI-DKKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEAISEGLVSRKDIF
DIDH_RAT        -----LNDGNFIPVLGFGTTVAKD--EVIKATKIAIDNGFRHFDSAYLYEVEEEVGQAIRDGTVKREDIF
AK1D1_RABIT     -----LGDGNSIPIIGLGTYKTTPKGSCATSVKIAIDTGYRHIDGAYIYQNEHEVGETIAEGKVRREDIF
AK1D1_RAT       -----LNDGNSIPIIGLGTYSDPRPVKTFIAVKTAIDEGYRHIDGAYVYRNEHEVGEAIREKKVKREEIF
YHH5_SCHPO      --------------LCFGVYQLKD---CYQQVIEALSLGIRVIDSAITYRNEKECEQAIQDFNIKREDIT
KAR_YEAST       ---FTLNNGNKIPIIGTGTYKNEETDATFEQIVYALKLGIIHIDAAEIYRTYPEVGKALSLTEKPRNAIF
AK1CD_MESAU     -----------IPALGFGTYKPIEKSKAMEAANLAIGVGYRHIDTAYAYQIEEEIGQAIKAGIVKREDMF
XYL1_TRIRE      --TLKLNSGYDMPQVGFGLWKV-DNAVCADTVYNAIKAGYRLFDGACDYGNEEGVARAIKDGLVKREDLF
AK1CL_RAT       ----KLNDGHFIPVLGFGTAMPSEKSKAKEVTKIAIDAGFHHFDSAFVYNTEDHVGEAIREKTTRREDIF
YEAE_ECOLI      ----QFSGDVSLPAVGQGTWYMGEDASQRKTEVAALRAGIELIDTAEMYADEKVVGEAL--TGL-REKVF
AKCL1_HUMAN     ----RLNDGPFMPVLGFGTYAPDHTSQAAEATKVAIDVGFRHIDSAYLYQNEEEVGQAIADGTVKREEIF
GS69_BACSU      ------DTGIEASRIGLGTWAGTDEKTSIETIRAALDQGITLIDTAPAYQSEEIVGKAIKEYG-KRDQVI
TRAKR_HUMAN     ----KLNDGKFMPILGFGTSVARKVSNVEEAVQVAIDVGYRHIDSAYTHLNEEGIGQAIRNGTVKRKDIF
YDJG_ECOLI      -------------------------------ILEAHRCGINLIDTAPGYNSEVIVGQALKK--LPREQVV
YCCK_BACSU      ---------------GHNLFPNLNDETGKDLVRTALDGGVNFIDTAFIYRSEELIGEVVQERGV-RNELI
YH5B_SCHPO      -------------VTGDGIWDEPKDKEACIATLKRLELNINFIDTADSYGPEVSEN-LLREALYPYKGLI
YI7E_SCHPO      ----------------------------FKIMKAAYDAGIRTFDTANCYSSEELVGKFIRKYEIPRSSIV
YDHF_ECOLI      -----------------------------------------HADIYGGYQCEAAFGEALKLAPHLRERME
YAKC_SCHPO      -----------VPAIGFGAMYGPSSEEANQAVLHAADLGCTFWDSSDMYANEECIGRWFKQTG-RRKEIF
Y1669_ARATH     ----------------------------------SLDNGIDFFDTAEVYGSKFSLGAISSETLLPGAEVS
IOLS_BACSU      ---------------GHNLYPNLNEETGKELVREAIRNGVTMLDTAYIYRSEELIGEVLREFN--REDVV
YAJO_ECOLI      -------------------------EESSRPIIKALEGGINFFDTANSYSDEEIVGRALRDFA-RREDVV
YRPG_BACSU      --TYLGRTGLRVSRLCLGTMNFTDEKTAFRIMDEALDNGIQFFDTANIYGTESIIGKWFAQGGQRREKVV
AAD4_YEAST      -------------------------EQAFELLDAFYEAGGNCIDTANSYQNEESIGEWMKSRKL-RDQIV
TAS_SHIFL       ------HSSLEVSTLGLGTFGEQNSEADAHAQLDAVAQGINLIDVAEMYPTETYVGNWLAKHG-SREKLI
TAS_ECOLI       ------HSSLEVSTLGLGTFGEQNSEADAHAQLDAVAQGINLIDVAEMYPTETYVGNWLAKHG-SREKLI
AAD14_YEAST     -----------------GFMGSMNKEQAFELLDAFYEAGGNCIDTANSYQNEESIGEWMASRKL-RDQIV
YCSN_BACSU      ---------------------------------------FDHADIYGGYTCEKLFGNALALSPGLRENIE
YQKF_BACSU      ---------VGLGCMSLGTEKNK----ALSILDEAIELGINYLDTADLYRNEEIVGDAIQNR---RHDII
Y2320_MYCBO     ----------QVSRIGLGTWQFGSREWGYRDIVKRARAGVTLFDTAEIYKSERILGEALGDD---RTEVV
Y2298_MYCTU     ----------QVSRIGLGTWQFGSREWGYRDIVKRARAGVTLFDTAEIYKSERILGEALGDD---RTEVV
KCAB_SCHPO      -----------------------DVEHTKNCLKQAWDLGINTFDTAEIYSNGNSMGKAIKELGWDRSEYV
STCV_EMENI      -------------------------ETAFALLDRFYEAGGNFIDTANFYQGEGSLGEWVASRG-NRDELV
KCAB_ORYSJ      -------SGLRVSQLSYGTFGNQLDVKEAKALLQACRAGVNFFDNAEVYANEEIMGQAMRDLGWRRSDVV
IN22_MAIZE      ------SQGLEVSAQGLGCMPPKPESEMIKLIHHAVDAGVTFLDTSDVYTNEVLLGKALQ--GGVREKVE
YGHZ_ECOLI      -------SGLRLPALSLGNFGHVNALESQRAILKAFDLGITHFDLANNYSAEENFGRLLRDFAAYRDELI
YGHZ_ECO57      -------SGLRLPALSLGNFGHVNALESQRAILKAFDLGITHFDLANNYSAEENFGRLLRDFAAYRDELI
KCAB2_HUMAN     -------SGLRVSCLGLGTWVTFGGEMAEQLMTLAYDNGINLFDTAEVYKAEVVLGNIIKKKGWRRSSLV
YDBC_ECOLI      ----------------------------------------------------------------------
KCAB2_BOVIN     -------SGLRVSCLGLGTWVTFGGEMAEQLMTLAYDNGINLFDTAEVYKAEVVLGNIIKKKGWRRSSLV
KCAB2_XENLA     -------SGLRVSCLGLGTWVTFGGEMAEQLMTLAYDNGINLFDTAEVYKAEVVLGNIIKKKGWRRSSLV
KCAB2_RAT       -------SGLRVSCLGLGTWVTFGGEMAEHLMTLAYDNGINLFDTAEVYKAEVVLGNIIKKKGWRRSSLV
KCAB2_MOUSE     -------SGLRVSCLGLGTWVTFGGEMAEHLMTLAYDNGINLFDTAEVYKAEVVLGNIIKKKGWRRSSLV
KCAB1_RAT       -------SGLRVSCLGLGTWVTFGGEVAERLMTIAYESGVNLFDTAEVYKAEVILGSIIKKKGWRRSSLV
KCAB1_RABIT     -------SGLRVSCLGLGTWVTFGGEVAERLMTIAYESGVNLFDTAEVYKAEVILGSIIKKKGWRRSSLV
KCAB1_MUSPU     -------SGLRVSCLGLGTWVTFGGEVAERLMTIAYESGVNLFDTAEVYKAEVILGSIIKKKGWRRSSLV
KCAB1_MOUSE     -------SGLRVSCLGLGTWVTFGGEVAERLMTIAYESGVNLFDTAEVYKAEVILGSIIKKKGWRRSSLV
KCAB1_HUMAN     -------SGLRVSCLGLGTWVTFGGEVAERLMTIAYESGVNLFDTAEVYKAEVILGSIIKKKGWRRSSLV
KCAB1_BOVIN     -------SGLRVSCLGLGTWVTFGGEVAERLMTIAYESGVNLFDTAEVYKAEVILGSIIKKKGWRRSSLV
AAD_PHACH       ---------------GMGTM---DKEASFKLLDAFYNAGGNFIDTANVYQSEEFIGEWMEARG-NRDQMV
KCAB1_CHICK     -------SGLRVSCLGLGTWVTFGGEVAEQLMTIAYESGVNLFDTAEVYKAEVILGNILKKKGWRRSSLV
GSH0_HUMAN      -----------------------------------------------------------------REEMK
ARK74_HUMAN     ----QLSRARPATVLGAMEMGRRMDAPTSAAVTRALERGHTEIDTAFLYQSETILGGLGLRMGSSDCRVK
KCAB3_XENLA     -------SGLRVSCLGLGTWVTFGSQISDEVAENLMTVAYEHFDTAEVYRAERTLGKILKKKEWRRSSYV
GSH0_RAT        -----------------------------------------------------------------REEMK
GSH0_MOUSE      -----------------------------------------------------------------REEMK
NORA_ASPPA      ------------------------------------ESGGNFIDVANFYQGERWVGEWMAQRQ-NRDEIV
GSH0_BOVIN      -----------------------------------------------------------------REEMK
AAD10_YEAST     ----------------------------------------------------------------------
NORA_ASPFL      ------------------------------------ESGGNFIDVANFYQGERWVGEWMAQRQ-NRDEIV
ARK73_HUMAN     ----QLSRARPATVLGAMEMGRRMDAPTSAAVTRALERGHTEIDTAFVYQSETIXXXXXXXXXXSDCRVK
ARK72_MOUSE     -----------------------DASASAASVRAFLERGHSELDTAFMYQSENIXXXXXXXXXXXDCTVK
ARK73_RAT       -----------------------------------LQRGHTEIDTAFVYANGQSXXXXXXRSGCKVKIAT
ARK72_HUMAN     -----------------------DAPASAAAVRAFLERGHTELDTAFMYSDGQSETIXXXXXXXXRVKIA
YZ38_AQUAE      ----------------------REAEEGAIVVVEKLSRG-RKIDYSSITETVEYYGNLVFDE-------L
AAD6_YEAST      -------------------------ERAFELLDAFYEAGGNFIDTANNYQNEQSIGEWMVSRKL-RDQIV
GSH0_SCHPO      ----------------------------------------------------------------------
ARK72_RAT       ----------------------------------------------------------------------
IF2_ALKMQ       ----------------------------------------------------------------------
CLS2_BACCR      -----------------------NGDETFRAILNGLKRAKHHIHMEYYIVRDDKLGTEIKDILIQKKEGV
MHR1_CANAL      -------------------------------LIEQLKT--RQQNGARIAQGKKSEHELIKNNLGP--QVF
ALKE_BABBO      ----------------------------------------------------------------------
CROB_LEPLU      ----------------------------------------------------------------------
CLS2_BACAN      -----------------------NGDETFQAILDGLKRAKHHIHMEYYIVRDDKLGTEIKDILIQKKEGV


                         .         .         *         .         .         .         .:140
query           VTTKLWNSQQTYEQARQAFEESLEKLGLDYLDLYLIHWPNPKPLRENDQWKIRNAEVWRAMEDLYQEGKI
GR_BACSU        ITSKVWNEDQGYETTLAAFEKSLERLQLDYLDLYLIHWPG------KDKYK----DTWRALEKLYKDGKI
P100_LEIMA      ITTKLWNTEQGYESTLAAFEESRQKLGVDYIDLYLIHWPRGKDILSKEGKKYLDS--WRAFEQLYKEKKV
YPR1_YEAST      ITTKLWGTEQRDPEA--ALNKSLKRLGLDYVDLYLMHWPVPLPTLEDGTVDIDTKETWELMQELPKTGKT
Y2408_MYCS2     LVTKLWNSDQGYDATLAAFDASVQRLGVDYLDLYLIHWPVP----ENNKF----VDTFKAFAHLRDQGRI
GCY_YEAST       VTTKLWCTQ--HHEPEVALDQSLKRLGLDYVDLYLMHWPDPAYIKNEDNWNF--IKTWELMQELPKTGKT
YTBE_BACSU      ITSKVWNADLGYEETLAAFETSLSKLGLDYLDLYLIHWPVEGKYKE----------AWRALETLYKEGRI
Y1919_MYCSJ     LVTKLWNSEQGYDATLAAFEASVDRLGVDYLDLYLIHWPVPE--------KNLFVDTFRAFARLREDGRI
Y1985_MYCSK     LVTKLWNSEQGYDATLAAFEASVDRLGVDYLDLYLIHWPVPE--------KNLFVDTFKAFARLREDGRI
DKGA_ECOLI      ITTKLWNDD--HKRPREALLDSLKKLQLDYIDLYLMHWPVP----AIDHY----VEAWKGMIELQKEGLI
DKGA_ECO57      ITTKLWNDD--HNRPREALLDSLKKLQLDYIDLYLMHWPVP----AIDHY----VEAWKGMIELQKEGLI
ALDX_SPOSA      ITSKLWNNSHRPEQVEPALDDTLKELGLEYLDLYLIHWPVAFPPKANDKLEVSLVDTWKAMVKLLDTGKV
Y2407_MYCS2     VTTKLATPDQGFTSSQAAARASLERLGLDYVDLYLIHWPGGDTSKYVDS--------WGGLMKVKEDGIA
ALRA_DICDI      ITSKLWNTFHKKEHVRPALERTLSDLGLQYLDLYLVHWPVAFEYTSNDQEFVSIRETWEEMEKLVDAGLV
YER5_SCHPO      FTSKL-NDLSGYKSTLSSIDASVKACGLGYIDLFLLHSPYGDRI-----------ESWKALEKGVEEGKL
Y4205_MYCGI     VTTKLATEDAGFQSSQDALRASLERLGLDYVDLYLIHWPVSQQGKHVDSWLMKSKEV----------GLT
DKGA_CORSC      ITTKLWNDRHDGDEPXXXXXXXXXXXXXDQVDLYLVHWPTPAA----DNY----VHAWEKMIELRAAGLT
AK1A1_PIG       VTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPGDNPFPKNADGTIRYKDTWKALEALVAKGLV
AK1A1_BOVIN     VTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPGDSPFPKNADGTIRYKETWRALEALVAKGLV
Y2161_MYCVP     VTTKLATDDLGFQSSQDALRASLERLGLDYVDLYLIHWPAGSQGTYVDS--------WGGLMKLKELGLT
MORA_PSEPU      VTTKLFNCDYGYERALRAFDESLGRLGLDYVDLYLLHWP-------TKDWN-ATIQSWKAAEKILGDGRA
YJ66_YEAST      YTTKLWNSQNGYKRAKAAIRQCLNEVGLQYIDLLLIHSP-----LEGSKLRL---ETWRAMQEAVDEGLV
YOF5_CAEEL      LSTKLW-PVDCGDEVYNAFQTSCEKLQTDYLDMYMIHMPQLPDWIVNQ--KETKEKTWRQMELLYEDEHV
AK1A1_RAT       VTSKLWNTKHHPEDVEPAVRKTLADLQLEYLDLYLMHWPNPFPKNADGTVKYDSTETWKALEALVAKGLV
DKGA_YERPE      ITTKLWNDDQHNPQ--QALETSLQKLQLDYVDLYLIHWPDPK----QDHY----VSAWRELVTLKEQGLI
AK1A1_MOUSE     VTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPGDNPFPKNADGTVRYKETWKALEVLVAKGLV
AK1BA_HUMAN     IVSKLWPTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQPKDDKGNAGGKATFLDAWEAMEELVDEGLV
AK1A1_PONAB     VTSKLWNTKHHPEDVEPALQKTLADLQLEYLDLYLMHWPGDNPFPKNADGTIHYKETWKALEALVAKGLV
ALRC_DICDI      YTSKLWNSCHNSNLVVKHCVKTIEDLGIGYLDLYLIHWPNPEPLRDQNGNPISIRETWQEMEKLVELGLV
YBN4_SCHPO      VTSKLWCNAHRAGLVPLALEKTLQDLNLEYIDAYLIHWPGPEELPRNEKGEVPIEETWQAMEELLETGKV
AK1A1_HUMAN     VTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPGDNPFPKNADGTIHYKETWKALEALVAKGLV
DKGA_SALTY      ITTKLWNDDQ--KRPREALQESXXXXXXXXXXXXXMHWPVP----AIDHY----VDAWKGMIALQKEGLV
DKGA_SALTI      ITTKLWNDDQ--KRPREALQESXXXXXXXXXXXXXMHWPVP----AIDHY----VDAWKGMIALQKEGLV
Y1984_MYCSK     VTTKLAVADQGFGTSQDAARASLERLGLDYVDLYLIHWP------AGDHGKYIDS--WGGLMKAKQDGVA
Y1938_MYCSS     VTTKLAVADQGFGTSQDAARASLERLGLDYVDLYLIHWP------AGDHGKYIDS--WGGLMKAKQDGVA
Y2996_MYCBO     VTTKLATPDQGFTRSQEACRASLDRLGLDYVDLYLIHWPAP-PVG-------KYVDAWGGMIQSRGEGHA
Y2993_MYCBP     VTTKLATPDQGFTRSQEACRASLDRLGLDYVDLYLIHWPAP-PVG-------KYVDAWGGMIQSRGEGHA
Y1918_MYCSJ     VTTKLAVADQGFGTSQDAARASLERLGLDYVDLYLIHWP------AGDHGKY--IDSWGGLMKAKQDGVA
Y2999_MYCTA     VTTKLATPDQGFTRSQEACRASLDRLGLDYVDLYLIHWPAP-PVG-------KYVDAWGGMIQSRGEGHA
Y2971_MYCTU     VTTKLATPDQGFTRSQEACRASLDRLGLDYVDLYLIHWPAP-PVG-------KYVDAWGGMIQSRGEGHA
Y1669_MYCLE     VTTKLATPDQGFTKSQDACNASLDRLGMDYVDLYLIHWPAP-PVGQ-------YVDAWGGMIQSRGEGHA
Y1669_MYCLB     VTTKLATPDQGFTKSQDACNASLDRLGMDYVDLYLIHWPAP-PVGQ-------YVDAWGGMIQSRGEGHA
AKCL2_MOUSE     VVSKLWCTCHKKSLVKTACTNTLEALNLDYLDLYLIHWPMGFKPGEKDIPLDRNGKVWEAMEDLVFEGLV
DKGB_ECOLI      ITTKIWIENLSKDKLIPSLKESLQKLRTDYVDLTLIHWPSP-----NDEVSVE--EFMQALLEAKKQGLT
Y3816_MYCA1     VTTKLATSDQGFKGAMDACEASLERLGLDYVDLYLIHWPAPA--------LGTYVNSFGGMIQSRGNGHA
ALDR_HORVU      VTSKIWCTNLAPERVRPALENTLKDLQLDYIDLYHIHWPAHMPPEAGEVLEFDMEGVWKEMENLVKDGLV
DKGB_ECO57      ITTKIWIENLSKDKLIPSLKESLQKLRTDYVDLTLIHWPSP-----NDEVSVE--EFMQALLEAKKEGLT
Y3007_MYCPA     VTTKLATSDQGFKGAMDACEASLERLGLDYVDLYLIHWPAPA--------LGTYVNSFGGMIQSRGNGHA
ALRB_DICDI      YVSKLWNSCHHASLVRKHCEKTXXXXXXXXXXXXXIHWPTTQPLRDSDGEPVLAAETWQEMEKLVEYGLV
AKCL2_RAT       IVSKLWCTYHKQSLVKTACINTLEALNLDYLDLYLIHWPMGFKPGDKDIPLDRSGKVWEAMEDLVIEGLV
Y1744_MYCMM     VTTKVATADHGFTASREACKASLDRLGLDYVDLYLIHWPAPAAGKYVD--------AFGGLIQARGEGFT
6DCS_SOYBN      VTSKLWVTENHPHLVLPALRKSLKTLQLEYLDLYLIHWPLSSPIEVEDLLPFDVKGVWESMEECQKLGLT
Y1987_MYCUA     VTTKVATADHGFTASREACKASLDRLGLDYVDLYLIHWPAPAVGKYVD--------AFGGLIQARGEGFT
AKCL2_PIG       IVSKLWCTCHKKSLVKSACTRSLKALKLQYLDLYLIHWPMGFKPGEVDLPVDRSGDTWEAMEDLVIEGLV
NADO1_ORYSJ     VTSKIWCSDLHAGRVVPAARETLRNLGMDYVDLLLVHWPVPFP-KEVILPSFDMEGVWRGMEECHRLGLA
S6PD_MALDO      ITTKIWNSDHGH--VVEACKNSLEKLQIDYLDLYLVHYPMPKTASLLGEDKVLDIDVWEGMEKTVSLGLV
AK1CD_MOUSE     ITTKLWCTCFRPELVKPALEKSLKKLQLDYVDLYIMHYPVPMKSGDNDQGKVDFCDTWERLEECKDAGLV
ALDR_RAT        IVSKLWCTFHDQSMVKGACQKTXXXXXXXXXXXXXIHWPTPGP----DYFPLDASDTWTAMEQLVDEGLV
YKW2_SCHPO      LTSKLANCSDYYS-TRAAIRSSLHHLGT-YIDLFLIQSPAGGK-------KSRIAS-WKAMEEFVDSGDI
YDG7_SCHPO      VTSKLWCNAHAPEAVPKAXXXXXXXXXXXXXXXXXIHWPVSFKTGEDKFPKDKDGETWKAMEKLLETGKV
Y4483_MYCA1     VTTKLGTSRQGFHSAQESCKESXXXXXXXXXXXXXIHWPAPK--------LGKYVESFEGMIEARERGHV
XYL1_PICST      LTSKLWNNYHHPDNVEKALNRTLSDLQVDYVDLFLIHFPVTVPLEEKDYEDVPILETWKALEKLVKAGKI
NADO2_ORYSJ     VTSKLWCSDLHAGRVVPAARETLRNLGMDYVDLLLVHWPATVPFPKEEMAPAFDMEVWRGMEECHRLGLA
AK1A1_CHICK     VTSKLWNTKHHPEDVEPALRKTXXXXXXXXXXXXXMHWPNPDGTMRYDYTDYK--DTWKAMEKLVEKGLA
ALDR_MOUSE      IVSKLWCTFHDKSMVKGAFQKTXXXXXXXXXXXXXIHWPTPGP----DYFPLDASDTWTAMEQLVDEGLV
ALDR_HUMAN      IVSKLWCTYHEKGLVKGACQKTXXXXXXXXXXXXXIHWPTGFPLDESGNVVPSDTNIWAAMEELVDEGLV
DDBX_BOVIN      YTSKLWSTSLRPELVRPALEKSLNNLQLDYVDLYIIHFPNGKPIFDS----VDLCRTWEALEKCKDAGLT
DKGB_CORSS      VASKIPGRQHGRAEAVDSIRGSLDRLGLDVIDLQLIHWPNPSVGR----W----LDTWRGMIDAREAGLV
DHB5_MOUSE      YTSKVWCTFHRPELVRVCLEQSLKQLQLDYVDLYLIHFPMAMKPGENYLPKDENCDTWEAMEKCKDAGLA
A1A1B_DANRE     VTSKLWNTKHHPDDVEPSXXXXXXXXXXXXXXXXXIHWPTPFPRKEDGTLLYDDIDTWAAMEKLVGKGLV
ALD2_MOUSE      IVSKLWPTCFEKKLLKEAFQXXXXXXXXXXXXXXXIHWPQGQPGKEDDQGRILTSEAWEGMEELVDQGLV
AK1A1_XENTR     VTSKLWNNKHHPDDVECALRKTXXXXXXXXXXXXXMHWPYA--FKRGDQIFPQNPDTWKAMEKLVKQGLT
XYL1_PACTA      ITSKLWNNFHAKENVKKALMKSLSDFNLDYFDLYLMHFPKFVPFEEGDKFIYEDVETWRAMENLVDEGLV
XYL1_CANSH      LTSKLWNNYHDPKNVETALNKTLKDLKVDYVDLFLIHFPIAVPIEEKDNFVYEDVETWKALEKLVKAGKI
DKGB_SALTY      ITTKIWIENLSKDKLIPSLKESLKKLRTDYVDLTLIHWPSPGD-------AVSVEEFMQALLEAKKQGLT
Y4149_MYCPA     VTTKLGTSRQGFHSAQESCKESXXXXXXXXXXXXXIHWPAPT--------LGKYVESFEGMIEARERGHV
XYL2_CANTR      ITSKLWNNFHDPKNVETALNKTLSDLNLDYVDLFLIHFPKFVPIEEGDNFHYEDVDTWKALEKLVEAGKI
ALD1_MOUSE      IVSKLWATFFEKSLVKKAFQNTXXXXXXXXXXXXXVHWPQGFQLPKDNKGKVLLSDAWEAMEELVDQGLV
A1A1A_DANRE     VTSKLWNTKHHPDDVEEACXXXXXXXXXXXXXXXXIHWPHPDGTIQYDDTHYR--DTWAAMEKLVDQGLA
XYL1_ASPNG      IVSKLWNSFHDGDRVEPICRKQLADWGIDYFDLYIVHFPPPGWKSEKDELEFGNAETWTAMESLVDKKLA
I3ACR_SCHPO     ITSKVMHN---VDNIPEALNESLRKLGTDYLDLYLLH--SPIPFYEK---KIPISEGWKAMETALGTGLV
DKGB_SALTI      ITTKIWIENLSKDKLIPSLKESLKKLRTDYVDLTLIHWPSPGD-------AVSVEEFMQALLEAKKQGLT
AKC1H_RAT       YTSKLWSTSHRPELVRPSLENSLRKLNLDYVDLYLIHFPSLKPLLPQDEHTVDLCDTWEAMEKCKDAGLA
DTDH_MUCMU      IVTKLWNTFHSKKHVRALFDRQLKDTGLEYFDLYLIHF--PVPLQYVDPWYVGDAECWAELEKIVDAGLA
XYL1_CANTR      ITSKLWNNFHDPKNVETALNKTLSDLNLDYVDLFLIHFPKFVPIEEGDNFHYEDVDTWKALEKLVEAGKI
ALDR_PIG        IVSKLWCTDHEKNLVKGACQTTXXXXXXXXXXXXXIHWPDPFPL-DGDGNVVPDVETWEAMEELVDEGLV
ALDR_RABIT      IVSKLWCTSHDKSLVKGACQKTXXXXXXXXXXXXXIHWPTG--FKHGSEYFPLDADTWEAMEGLVDEGLV
AK1A1_XENLA     VTSKLWNNKHHPDDVECALRKTXXXXXXXXXXXXXMHWPYA--FKRGDQVFPQNPDTWKAMEKLVEKGLA
ALDR_ENCCU      ITSKLWNT--FHGCPEDGLRRSLNDLQMDYVDLYLIHWPDPAPGKKYNVGKFDAVGVWKKMEALVDLGLA
ALD2_CRIGR      IVSKLWPTCFERKLLKEAFQXXXXXXXXXXXXXXXIHWPQGQPGKEDDQGNVLTSKIWEVMEELVDEGLV
AK1A1_CRIGR     VTSKLWNTKHHPEDVEAALRKTLADLQLEYLDLYLMHWPGDNPFPKNDDGTIRYKETWKALEALVAKGLV
AKCL2_HUMAN     IATKLWCTCHKKSLVETACRKSLKALKLNYLDLYLIHWPHPRPLDESNMVIPSDTDTWEAMEDLVITGLV
AK1C2_HUMAN     YTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPSVKPIPKDENGKILFDTVWEAMEKCKDAGLA
PE2R_RABIT      YTSKLWCTFHRPELVRPSLEDSLKNLQLDYVDLYIIHFPTALPTDEHGKAIFDTVDIWEAMEKCKDAGLA
XYL1_PICGU      VVSKLWNSFHDPKNVEKALDRTLSDLKVDYLDLFLIHFPIAVPFEEKDKFIYEGVPIWRALEKMVEKGKI
AKC1H_MOUSE     YTSKLWSTSHRPELVRPSLENSLRKLNLDYVDLYLIHFPSLKPLLPKDEHTVDLCDTWEAMEKCKDAGLA
AK1C1_PONAB     YTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLVHFPSVKPIPKDENGKILFDTVWEAMEKCKDAGLA
AK1C1_HUMAN     YTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPSVKPIPKDENGKILFDTVWEAVEKCKDAGLA
PGFS1_BOVIN     YTSKLWCNSLQPELVRPALEKSLQNLQLDYVDLYIIH--SPVSLKPGNKFSVDLCHTWEALEKCKDAGLT
ALDR_BOVIN      IVSKLWCTYHDKDLVKGACQKTXXXXXXXXXXXXXIHWPTGKPGKDDEDGNVIPSETWTAMEELVDEGLV
AK1C1_MACFU     YTSKLWCNSHRPEFVRPALERSLKNLQLDYVDLYLIHFPELIPKDENGKLLFDTVDLWEAMEKCKDAGLA
XYL1_CANPA      ITSKLWNSFHDKKNVEVALMKTLSDLNLDYVDLFYIHFPKPVPIEDGDKWSIEEVDTWRALEKLVDQGLA
PGFS2_BOVIN     YTSKLWCNSLQPELVRPALEKSLQNLQLDYVDLYIIH--SPVSLKPGNKFSVDLCHTWEALEKCKDAGLT
AKCL2_MACFA     IASKLWCTCHKKSLVKTACRRSLKALKLNYLDLYLIHWPHDLPLDESDMVIPGDTDTWEAMEDLVITGLV
AK1C4_MACFA     YTSKLWCTFFRPQLVQPALESSLKKLQLDYVDLYLIHFPTPLPKDENGKVMFDTVDIWEAMEKCKDAGLA
AK1C1_MACFA     YTSKLWCNSHRPEFVRPALERSLKNLQLDYVDLYLIHFPELIPKDENGKLLFDTVDLWEAMEKCKDAGLA
DKGB_YERPE      ITTKIWIANLSKDKLIPSLRESIQKLKTDYVDLTLIHWPSP-----NDEVSV--AEFMSELLKAKGLGLT
AK1C4_HUMAN     YTSKLWCTFFQPQMVQPALESSLKKLQLDYVDLYLLHFPTPLPKDENGKVIFDTVDLWEVMEKCKDAGLA
AK1C4_MACFU     YTSKLWCTFFRPQLVQPALESSLKKLQLDYVDLYLIHFPTPLPKDENGKVMFDTVDIWEAMEKCKDAGLA
AK1CN_HORSE     CTSKLWATSLRLQLVRPALEKSLKNLQLDYVDLYIIHFPGEEHLPQDEQGRVDLCATWEAMEKCKDAGLT
AK1C3_PONAB     YTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVWEAMEECKDAGLA
CRO_RANCA       YTGKLWCTYFSPDMVRKGLERSLRDVGMDYLDLFLMHWPSLKPSGASDPSNVDLCATWEALEARKDAGLV
ARA1_YEAST      ITTKVW--PVLWDEVDRSLNESLKALGLEYVDLLLQHWPDPKGISGDDSGKTMYAETYKQLEKIYNDHRV
AK1C3_HUMAN     YTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVWEAMEKCKDAGLA
AK1CO_HORSE     YTSKLWLTFLRPELVRPALEKSLTNLQLDYVDLYIIHFPGEELFPEDEHGKVDLCATWEAMEKCKDAGLA
AK1D1_HUMAN     YCGKLWATNHVPEMVRPTLERTLRVLQLDYVDLYIIEVPEIYPRDENGKWKSNLCATWEAMEACKDAGLV
AK1CL_MOUSE     YTSKVWCTSLHPELVRASLERSLQKLQFDYVDLYLIHYPMAKPGEENDEHRVDLCATWEAMEKCKDAGLT
CRO_RANTE       YTGKLWCTYFSPEMVRKGLERSLRDVGMDYLDLFLMHWPSLKPSGASDPSNVDLCATWEALEARKDAGLV
XYL1_KLULA      VVSKLWNSFHHPDNVPRALERTLSDLQLDYVDIFYIHFPKPVPFDEKEEEQVPLLDTWRALEKLVDQGKI
XYL1_CANTE      LTSKLWNNYHDPKNVETALNKTLADLKVDYVDLFLIHFPKFVPIEENFVYEVPILETWKALEKLVAAGKI
AK1D1_MOUSE     YCGKLWNTEHVPSMVLPALERTLKALKLDYIDLYIIELPEIYPRDENGRIKTNLCATWEALEACKDAGLV
GRE3_YEAST      VVSKLWNNFHHPDHVKLALKKTLSDMGLDYLDLYYIHFPKYVPFEEDDEKKITEAHVYRALEECVDEGLI
DIDH_RAT        YTSKLWSTFHRPELVRTCLEKTLKSTQLDYVDLYIIHFPMALPRDEHGKLLFETVDIWEAMEKCKDAGLA
AK1D1_RABIT     YCGKLWATNHDPVMVRPTLERTLKVLKLDYIDLYIIEIPMAYPRDENGKWKTNLCATWEALEACKDAGLV
AK1D1_RAT       YCGKLWSTDHDPEMVRPALERTLQTLKLDYIDLYIIEMPMAFKPGEEFYPKDENGRVWEALEACKDAGLV
YHH5_SCHPO      LITKIPDSLQGFERTWKAVEQSLRRTGRPKLDVVLIHSP---------KWPVRRIESWRALLQHQKEGRI
KAR_YEAST       LTDKYSPQIKMSDSPADGLDLALKKMGTDYVDLYLLH----SPFVSKEVNGLSLEEAWKDMEQLYKSGKA
AK1CD_MESAU     ITTKLWCTCFQPELVRPSLEXXXXXLQLEHVDLFIMHYPVPMKAGDNDQGKLLLDTVWEALEKXXDAGLV
XYL1_TRIRE      IVSKLWQTFHDEDKVEPITRRQLADWQIDYFDLFLVHFPADPSVRYPPGWEVRWSQTWGAMERLVDKGLA
AK1CL_RAT       YTSKLWCTSLHPELVRSSLECSLKKLQLDYVDLYLIHFPMAKPGDENEHGKLLFDTVWEAMEKCKDAGLA
YEAE_ECOLI      LVSKVYPWNAGGQKAINACEASLRRLNTDYLDLYLLHWSG----------SFAFEETVAAMEKLIAQGKI
AKCL1_HUMAN     YTIKLWATFFRAELVHPALERSLKKLGPDYVDLFIIHVP-------------------------------
GS69_BACSU      LATKTWKNNQLFRHANRAVENSLKRLQTDYIDLYQVHWPDPLPIEET-------AEV---MKELYDAGKI
TRAKR_HUMAN     YTTKVWGTFSRPELVQRGLEMSLKKLQLSYMDLYLFHFPVP-----------------------------
YDJG_ECOLI      VETKVWEDRQLYESIREEVAASLQRLGIDYIDIYMTHWQSVPP------FFTPIAETVAVLNELKSEGKI
YCCK_BACSU      IATKGAHKENSREFLRSEVEKSLKRLKTDYIDLYYVHFPDGKPL----------AEVAGTLKELKDEGKI
YH5B_SCHPO      IATKEWHPCGAPKFLRQEVLMSMRRLGVKQIDLWQLHRIDPKVPRKDQFSEIA------AMK---KEGLI
YI7E_SCHPO      ILSKCFHFLDSPELANQAVEDSVKRLGT-YIDVLQIHRYDPHVSAE---------EVMRALNDVVESGKV
YDHF_ECOLI      IVSKCGIATTAREEIIKSAEQSLINLATDHLDLLLIH--RPDPLMDAD-------EVADAFKHLHQSGKV
YAKC_SCHPO      LATKFGNNEPDYIE--KALDLSLKRLGIDCIDLYYVHFSGETPIE----------KIMGALKKCVEAGKI
Y1669_ARATH     VATKFWRFGR--ESVVTALKDSLSRLELSSVDLYQLHWPG--------LWG--NEGYLDGLGDAVEQGLV
IOLS_BACSU      IATKAAHRKQSPDFLKKSVDESLKRLNTDYIDLFYIHFPDEHTPKD---------EAVNALNEMKKAGKI
YAJO_ECOLI      VATKVFHEGLSRAQILRSIDDSLRRLGMDYVDILQIHWDYNTPIE----------ETLEALNDVVKAGKA
YRPG_BACSU      LATKVYEPISSLYKIRRHLEGSLKRLQTDHIELYQMHH-----IDRRTPWD----EIWEAFETQVRSGKV
AAD4_YEAST      IATKFTGDYKKYESLHVSVRDSLRKLQTDWIDILYVHW-----------WDYMSSEVMDSLHILVQQGKV
TAS_SHIFL       IASKVSGPSRNNDKGREALHDSLKRLQTDYLDLYQVHWPQ-RPTKLGYSWAVSLLDTLDALAEYQRAGKI
TAS_ECOLI       IASKVSGPSRNNDKGREALHDSLKRLQTDYLDLYQVHWPQ-RPTKLGYSWAVSLLDTLDALAEYQRAGKI
AAD14_YEAST     IATKFTGDYKKYESLHVSVRDSLRKLQTDWIDILYIHW-----------WDYMSSEVMDSLHILVQQGKV
YCSN_BACSU      LVTKCYNTSKSHILA--SVEQSLMNLRTDYIDMLLIHRPDPLMDPEG---------VAEAFQALKCSGKV
YQKF_BACSU      LATKAWDPSKAY--IKEAVKKSLTRLKTDYIDLYQLHGGT---IEDNID------ETIEAFEELKQEGVI
Y2320_MYCBO     VASKVFPVAPFPAVIKNRERASARRLQLNRIPLYQIHQPNP---------VVPDSVIMPGMRDLLDSGDI
Y2298_MYCTU     VASKVFPVAPFPAVIKNRERASARRLQLNRIPLYQIHQPNP---------VVPDSVIMPGMRDLLDSGDI
KCAB_SCHPO      ITTKVFFGAGTKKHIIEGLNASLKRLGLPYVDVIMAHRPDPSVPME---------EVVRAFTQLIQDGKA
STCV_EMENI      LATKYTNFQGSHSKSRLSVEASLAKLRTDYIDLLYVH-----------MWDFSTSEVMQSLHHLVAAGKV
KCAB_ORYSJ      VSTKLWGGQGPNDKGLEGLRGSLKRLDMDYVDVVYCHRPDATTPVE---------ETVRAMNWVIDHGMA
IN22_MAIZE      LATKFGVSFADGKRVRTACEGSFKRLGVDCIDLYYQHRIDKRVPIEVTIGELKK---------LVEEGKI
YGHZ_ECOLI      ISTKMWPGPYGSGGSRKSLDQSLKRMGLEYVDIFYSHRVDENTPME---------ETASALAHAVQSGKA
YGHZ_ECO57      ISTKMWPGPYGSGGSRKSLDQSLKRMGLEYVDIFYSHRVDENTPME---------ETASALAHAVQSGKA
KCAB2_HUMAN     ITTKIWGGKAETERGLEGLKASLERLQLEYVDVVFANRPDPNTPME---------ETVRAMTHVINQGMA
YDBC_ECOLI      ------------------------------------------------------------LAEMQQQGLV
KCAB2_BOVIN     ITTKIWGGKAETERGLEGLKASLERLQLEYVDVVFANRPDPNTPME---------ETVRAMTHVINQGMA
KCAB2_XENLA     ITTKIWGGKAETERGLEGLKASLERLQLDYVDVVFANRPDPNTPME---------ETVRAMTHVINQGMA
KCAB2_RAT       ITTKIWGGKAETERGLEGLKASLERLQLEYVDVVFANRPDPNTPME---------ETVRAMTHVINQGMA
KCAB2_MOUSE     ITTKIWGGKAETERGLEGLKASLERLQLEYVDVVFANRPDPNTPME---------ETVRAMTHVINQGMA
KCAB1_RAT       ITTKLWGGKAETERGLEGLKGSLQRLQLEYVDVVFANRPDSNTPME---------EIVRAMTHVINQGMA
KCAB1_RABIT     ITTKLWGGKAETERGLEGLKGSLQRLQLEYVDVVFANRPDSNTPME---------EIVRAMTHVINQGMA
KCAB1_MUSPU     ITTKLWGGKAETERGLEGLKGSLQRLQLEYVDVVFANRPDSNTPME---------EIVRAMTHVINQGMA
KCAB1_MOUSE     ITTKLWGGKAETERGLEGLKGSLQRLQLEYVDVVFANRPDSNTPME---------EIVRAMTHVINQGMA
KCAB1_HUMAN     ITTKLWGGKAETERGLEGLKGSLQRLQLEYVDVVFANRPDSNTPME---------EIVRAMTHVINQGMA
KCAB1_BOVIN     ITTKLWGGKAETERGLEGLKGSLQRLQLEYVDVVFANRPDSNTPME---------EIVRAMTHVINQGMA
AAD_PHACH       VATKVYKRGASFEEIPQSVHDSLRKLRTSYIDIFYVHW----------DYTCTIEEVMNGLHNLVAQGKV
KCAB1_CHICK     ITTKLWGGKAETERGLEGLRASLQRLQLEYVDVVFANRPNNTPME----------EIVRAMTHVINQGMA
GSH0_HUMAN      VSAKLFIVESNSSSSRSAVDMACSVLGVAQLDSVIIASP---PIEDGVNLSLEHLQYWEELENLVQSKKI
ARK74_HUMAN     IATKIGNSLKP-DSVRSQLETSLKRLQCPUVDLFYLHAPDHSAPVE---------ETLRACHQLHQEGKF
KCAB3_XENLA     VTTKIWGGQAETERGLEGLRGSLERLQLDYVDIVFANRMDPNSPME---------EIVRAMTFVINQGMA
GSH0_RAT        VSAKLFIGSNSSSSTRNAVDMACSVLGVAQLDSVIMASP---PIEDGVNLSLEHLQYWEELENLVQSKKI
GSH0_MOUSE      VSAKLFIGSNSSSSTRSAVDMACSVLGVAQLDSVIMASP---PIEDGVNLSLEHLQYWEELENLVQSKKI
NORA_ASPPA      LSTKYTNFQGNHAKSRLSVKASLQKLQTDYIDLLYVH-----------MWDFTTSEVMRSLNHLVANGKV
GSH0_BOVIN      VSAKLFIGSNSSSSTRNAVDMACSVLGVAQLDSVIIASP---PVEDGVNLSLEHLQYWEELQNLVQSKKI
AAD10_YEAST     --------------------DSLRKLQTDWIDILYVHW-----------WDYMSSEVMDSLHILVQQGKV
NORA_ASPFL      LSTKYTNYQGNHAKSRLSVKASLQKLQTDYIDLLYVH-----------MWDFTTSEVMRSLNHLVANGKV
ARK73_HUMAN     IDTKLFGNSLKPDSLRFQLETSLKRLQCPRVDLFYLHMPDHSTPVE---------ETLRACHQLHQEGKF
ARK72_MOUSE     IATKAWEGKSLKDSVRSQLETSLKRLQCPRVDLFYLHAPDHSTPVE---------ETLRACHQLHQEGKF
ARK73_RAT       KAAPMFGKTLKPADVRFQLETSLKRLQCPRVDLFYLHFPDHTPIEETLQ----------ACHQLHQEGKF
ARK72_HUMAN     TKANPWDGKSLKDSVRSQLETSLKRLQCPQVDLFYLHAPDHGTPVE---------ETLHACQRLHQEGKF
YZ38_AQUAE      IRTEMMHSLKVYSNIKQVFEEAAKLLGLDYVRV-LIHRGKLKAVKEEGKWKIPLSEVVKNFE--------
AAD6_YEAST      IATKFTTDYKKYDSLHVSVRDSLRKLQTDWIDILYVHW--------------------------------
GSH0_SCHPO      ------------------------------------------PPQEIQSW----VDTWKLLEEKVGEGKI
ARK72_RAT       ------------DSVRSQLETSLKRLQCPRVDLFYLHAPDHTPI----------VETLQACQQLHQEGKF
IF2_ALKMQ       ----------------------------------------------------------------------
CLS2_BACCR      VVRFLYDAVGSFKLSKSYIEE-LNDAGVEMIPFFPVRFP-------------------------------
MHR1_CANAL      VFRNLFSGQVLYSQVPAYHENQINQQFLSP------NWQNRKPSRRQDLWKI------------------
ALKE_BABBO      ----------------KAVDGSLSRLNTDYIDLLQLHWPDRVPMNANGDFH----EVFHDTENMIDEGKI
CROB_LEPLU      ----------------QAPPGKVEKIKLDYLDLYLIHFPGFKVIPSNTDIR----DTWEGMEDLVDAGLV
CLS2_BACAN      VVRFLYDAVGSFKLSKSYIEE-LNDAGVEMIPFFPVRFP-------------------------------


                         +         .         .         .         .         *         .:210
query           RAIGVSNFLPHHLDALLETAKILPAVNQVRLAPGVYQDQVVAYCREKGILLEAWGPFGQGELFDSKQVQE
GR_BACSU        RAIGVSNFQVHHLEELLKDAEIKPMVNQVEFHPRLTQKELRDYCKGQGIQLEAWSPLMQGQLLDNEVLTQ
P100_LEIMA      RAIGVSNFHIHHLEDVLAMCTVTPMVNQVELHPLNNQADLRAFCDAKQIKVEAWSPLGQGKLLSNPILSA
YPR1_YEAST      KAVGVSNFSINNIKELLESPKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANLLKEQAIID
Y2408_MYCS2     RSIGVSNFEPEHLTTLIEETGIVPAVNQIELHPLLPQQELRDVHAKLGIATEAWSPLGQGSLLADPVITG
GCY_YEAST       KAVGVSNFSINNLKDLLASQKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDLLKEPVILE
YTBE_BACSU      KAIGVSNFQIHHLEDLMTAAEIKPMINQVEFHPRLTQKELIRYCQNQGIQMEAWSPLMQGQLLDHPVLAD
Y1919_MYCSJ     RSIGVSNFEPEHLRVLIDSTGIVPAVNQIELHPLLPQRELRELHAQLGIATEAWSPLGQGSLLAHPTVTG
Y1985_MYCSK     RSIGVSNFEPEHLRVLIDSTGIVPAVNQIELHPLLPQRELRELHAQLGIATEAWSPLGQGSLLAHPTVTG
DKGA_ECOLI      KSIGVCNFQIHHLQRLIDETGVTPVINQIELHPLMQQRQLHAWNATHKIQTESWSPLAQGGVFDQKVIRD
DKGA_ECO57      KSIGVCNFQIHHLQRLIDETGVTPVINQIELHPLMQQRQLHAWNATHKIQTESWSPLAQGGVFDQKVIRD
ALDX_SPOSA      KAIGVSNFDAKMVDAIIEATGVTPSVNQIERHPLLLQPELIAHHKAKNIHITAYSPLGNNTLVQHPEIKR
Y2407_MYCS2     RSIGVCNFGAEDLETIVSLTYFTPAVNQIELHPLLNQAALREVNAGYNIVTEAYGPLGVGRLLDHPAVTA
ALRA_DICDI      KSIGLSNFNVQGLMEVLSYARIKPAANQVELHPFLSQPELKKFCDKHNIHLTAYSPLGNGAFVDNEEVGA
YER5_SCHPO      RAIGVSNFGPHHIQELLDSPKIIPCVNQIELHPFCSQQKVVDYCESKGIQLAAYAPLVHGEKFGNKQLLA
Y4205_MYCGI     RSIGVANFHGHHLDDIISLSFFTPAVNQIELHPLLNQAELRAVNAEHGIATEAYGPLGVGNLLSHSAVNA
DKGA_CORSC      RSIGVSNHLVPHLERIVAATGVVPAVNQIELHPAYQQREITDWAAAHDVKIESWGPLGQGDLFGAEPVTX
AK1A1_PIG       RALGLSNFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDLLEEPVVQA
AK1A1_BOVIN     RALGLSNFNSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARNLEVTAYSPLGSSDLLKEPVVLA
Y2161_MYCVP     RSIGVSNFHAQHLDDIIGLSFFTPAVNQIELHPLLNQAELRAVNAEHGIVTEAYSPLGVGSLLSNPAVTA
MORA_PSEPU      RAIGVCNFLEDQLDELIAASDVVPAVNQIELHPYFAQKPLLAKNRALGIVTEAWSPXXRKHPLTDPVITT
YJ66_YEAST      KSIGVSNYGKKHIDELLNWPELKPVVNQIEISPWIMRQELADYCKSKGLVVEAFAPLCHGYKMTNPDLLK
YOF5_CAEEL      RSIGVSNYSIEDLDELLEFASILPHANQVELHPWFHQADLKNYCDELGILTMGYCPLAKGKYLEDETLCK
AK1A1_RAT       KALGLSNFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDXXXXXXXXX
DKGA_YERPE      RSIGVCNFHIPHLQRLIDETGIAPTVNQIELHPLLQQRQLHAWNATHHIATESWSPLAQGGVFDQEIIRK
AK1A1_MOUSE     KALGLSNFNSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCHARGLEVTAYSPLGSSDXXXXXXXXX
AK1BA_HUMAN     KALGVSNFSHFQIEKLLNKLKYKPVTNQVECHPYLTQEKLIQYCHSKGITVTAYSPLGSPDLLEDPKIKE
AK1A1_PONAB     RALGLSNFNSRQIDDILSVASVRPAVLQVECHPYLAQNELIAHCQARGLAVTAYSPLGSSDXXXXXXXXX
ALRC_DICDI      KSIGVSNFNVQNLVDLLTYAKIKPVVNQVEIHPYLTQFKLQEYCDKYEIKLVAYSPLGQGDFFSNKILKS
YBN4_SCHPO      RYIGISNFNNEYLDRVLKIAKVKPTIHQMELHPYLPQTEYLEKHKKLQIHVSAYSPLANSKLIEHKTLVD
AK1A1_HUMAN     QALGLSNFNSRQIDDILSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDXXXXXXXXX
DKGA_SALTY      KSIGVCNFQIHHLQRLIDETGVTPVINQIELHPLMQQRQLHAWNATHKIQTESWSPLAQGGVFDQKVIRE
DKGA_SALTI      KSIGVCNFQIHHLQRLIDETGVPPVINQIELHPLMQQRQLHAWNATHKIQTESWSPLAQGGVFDQKVIRE
Y1984_MYCSK     RSIGVCNFNAEHLSNIIDLSFFTPAINQIELHPLLNQAELREVNAGYGIVTEAYGPLGVGRLLDHAAVTG
Y1938_MYCSS     RSIGVCNFNAEHLSNIIDLSFFTPAINQIELHPLLNQAELREVNAGYGIVTEAYGPLGVGRLLDHAAVTG
Y2996_MYCBO     RSIGVSNFTAEHIENLIDLTFVTPAVNQIELHPLLNQDELRKANAQHTVVTQSYCPLALGRLLDNPTVTS
Y2993_MYCBP     RSIGVSNFTAEHIENLIDLTFVTPAVNQIELHPLLNQDELRKANAQHTVVTQSYCPLALGRLLDNPTVTS
Y1918_MYCSJ     RSIGVCNFNAEHLSNIIDLSFFTPAINQIELHPLLNQAELREVNAGYGIVTEAYGPLGVGRLLDHAAVTG
Y2999_MYCTA     RSIGVSNFTAENIENLIDLTFVTPAVNQIELHPLLNQDELRKANAQHTVVTQSYCPLALGRLLDNPTVTS
Y2971_MYCTU     RSIGVSNFTAENIENLIDLTFVTPAVNQIELHPLLNQDELRKANAQHTVVTQSYCPLALGRLLDNPTVTS
Y1669_MYCLE     RSIGVCNFTEEHLSAIIDLTFVTPAVNQIELHPLLNQDEMRKSNAQHNVITQSYTPLVLGRLMDNSTLTA
Y1669_MYCLB     RSIGVCNFTEEHLSAIIDLTFVTPAVNQIELHPLLNQDEMRKSNAQHNVITQSYTPLVLGRLMDNSTLTA
AKCL2_MOUSE     KNLGVSNFNHEQLERLLDKLRVRPITNQIECHPYLNQKKLIDFCHKRNVSVTAYRPLGGSHLMDDTVIRK
DKGB_ECOLI      REIGISNFIPLMEKAIAAVGAENIATNQIELSPYLQNRKVVAWAKQHGIHITSYMTLAYGKALKDEVIAR
Y3816_MYCA1     RSIGVSNFTEEYLTTVIDLTFVTPAVNQIELHPLLNQEALRKTNAEHNVVTQSYTPLALGKLNDHPTVNS
ALDR_HORVU      KDIGVCNYTVTKLNRLLRSAKIPPAVCQMEMHPGWKNDKIFEACKKHGIHVTAYSPLGSSELAHDPVVEK
DKGB_ECO57      REIGISNFIPLMEKAIAAVGAENIATNQIELSPYLQNRKVVAWAKQHGIHITSYMTLAYGKALKDEVIAR
Y3007_MYCPA     RSIGVSNFTEEYLTTVIDLTFVTPAVNQIELHPLLNQEALRKTNAEHNVVTQSYTPLALGKLNDHPTVNS
ALRB_DICDI      KSIGVSNFNVQNLVDLLTYAKIKPAINQVEVHPYLSQPNLKYFCDRYGIVLTAYSPLGQGDLLSNETLKS
AKCL2_RAT       KNIGVSNFNHEQLDRLLNKLRIKPITNQIECHPYLNQKSLIDFCHGRNVSVTAYRPLGGSHLMDDIVIRK
Y1744_MYCMM     RSIGVSNFTEEHVSNVIDLTFVTPAVNQVELHPLLNQDELRKANAQHNVVTQSYTPLALGQLADNPTVTS
6DCS_SOYBN      KAIGVSNFSVKKLQNLLSVATIRPVVDQVEMNLAWQQKKLREFCKENGIIVTAFSPLGPNEVMENDVLKE
Y1987_MYCUA     RSIGVSNFTEEHVSNVIDLTFVTPAVNQVELHPLLNQDELRKANAQHNVVTQSYTPLALGQLADNPTVTS
AKCL2_PIG       RAIGVSNFNHEQLERLLNNLRVKPVTNQIECHPYLTQKKLISFCQSRNVSVTAYRPLGGSSLLEDPVIQT
NADO1_ORYSJ     RAIGVSNFSAKKLEQLLSLAAVRPAVNQVEVNPMWQQRTLREVCRREGVQLCGYSPWGSAAVMDSGVLQE
S6PD_MALDO      RSIGLSNYELFLTRDCLAYSKIKPAVSQFETHPYFQRDSLVKFCMKHGVLPTAHTPFGSVSPLDDPVLND
AK1CD_MOUSE     KSIGVSNFNHRQLERILNKLKYKPVCNQVECHLYLNQRKLLDYCESKDIVLVAYGALGTQRLLNDPVLCD
ALDR_RAT        KAIGVSNFNPLQIERILNKPKYKPAVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDLLEDPRIKE
YKW2_SCHPO      RSVGVSNYGVKHLQELYASPKFYPCVNQIELHPFLSQDDIVKYCQSHDIAIEAYSPLTHGIRLNDEKLVP
YDG7_SCHPO      RHIGLSNFNDTNLERILKVAKVKPAVHQMELHPFLPQTEFVEKHKKLGIHVTAYSPFGQNTIYESKTIQK
Y4483_MYCA1     RSIGVSNFTEDLLATVIEETDEVPAVNQVELHPRLNQAELRQVHAQHDVTTQSYSPLGVGRLIEEPTVTT
XYL1_PICST      RSIGVSNFPGALLLDLLRGATIKPSVLQVEHHPYLQQPRLIEFAQSRGIAVTAYSSFGQGRLFENETIKA
NADO2_ORYSJ     RAIGVSNFSAKKLEQLLSFAVVRPAANQVEMNPMWQQRTLREVCRREGVQLCGYSPWGSAAVMDSGVLHD
AK1A1_CHICK     KAIGLSNFNSRQIDDVLSVATVKPAVLQVECHPYLAQNELIAHCQKRGLVVTAYSPLGSPDLLEEPGIKK
ALDR_MOUSE      KTIGVSNFNPLQIERILNKPKYKPAVNQIECHPYLTQEKLIEYCHSKGIVVTAYSPLGSPDLLEDPRIKA
ALDR_HUMAN      KAIGISNFNHLQVEMILNKPKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDLLEDPRIKA
DDBX_BOVIN      KSIGVSNFNHKQLEKILNKLKYKPVCNQVECHPYFNQSKLLDFCKSHDIVLVAYGALGSQRLLEDPVLSA
DKGB_CORSS      RSIGVSNFTEPMLKTLIDETGVTPAVNQVELHPYFPQAALRAFHDEHGIRTESWSPLARSXXXXXXXXXX
DHB5_MOUSE      KSIGVSNFNRRQLEKILKKLKYKPVCNQVECHPYLNQGKLLDFCRSKDIVLVAYSALGSHRLLDNPVLGS
A1A1B_DANRE     RAIGLSNFNSRQIDDILSVASIKPTVLQVESHPYLAQVELLSHCRDRGLVMTAYSPLGSPDLLEEPAIAA
ALD2_MOUSE      KALGVSNFNHFQIERLLNKPKHKPVTNQVECHPYLTQEKLIQYCHSKGISVTAYSPLGSPDLLEDPKIKE
AK1A1_XENTR     KAIGLSNFNKRQIDDIISIATVKPAVLQVECHPYLAQNELIAYCHAHGLVFTGYSPLGSPDLLEEPGIIA
XYL1_PACTA      KSIGVSNVSGGLLEDLIKAARIKPASLQIEHHPYLQQNKLVEYAQLKGIVVTGYSNFGTQPLYENKTITT
XYL1_CANSH      RSIGVSNFPGALLLDLFRGATIKPAVLQVEHHPYLQQPKLIEYAQKVGITVTAYSSFGQGRLFEHDVIKA
DKGB_SALTY      REIGISNFIPLMEKAIAAVGADNIATNQIELSPYLQNRKVVDWAKAHGIHITSYMTLAYGKALKDEVIAR
Y4149_MYCPA     RSIGVSNFTEDLLATVIEETNEVPAVNQVELHPRLNQAELRQVHAQHDVTTQSYSPLGVGRLIEEPTVTT
XYL2_CANTR      KSIGISNFTGALIYDLIRGATIKPAVLQIEHHPYLQQPKLIEYVQKAGIAITGYSSFGPQSLFEHETIKS
ALD1_MOUSE      KALGISNFNHFQIERLLNKPKHKPVTNQIESHPYLTQEKLIQYCQSKGIAVTAYSPLGSPDVMEIPKIKE
A1A1A_DANRE     KAIGLSNFNAKQIDDILSIAKHKPVVNQVECHPYLVQAELVSHCWSRNLTVTAYSPLGSPDLLDDPRVVG
XYL1_ASPNG      RSIGISNFSAQLVMDLLRYARIRPATLQIEHHPYLTQTRLVEYAQKEGLTVTAYSSFGSPPLFEHQLVKS
I3ACR_SCHPO     HSVGVSNFRIPDLEELLKTSTITPRVNQIEFHPQVYKKPLVEFCQSKGIIVEGYGPLAQGPV--AEFTKS
DKGB_SALTI      REIGISNFIPLMEKAIAAVGADHIATNQIELSPYLQNRKVVDWAKAHGIHITSYMTLAYGKALKDEVIAR
AKC1H_RAT       KSIGVSNFNRRQLEKILNKLKHRPVCNQVECHLYLNQSKLLAYCKMNDIVLVAYGALGTQRLLDDPILCT
DTDH_MUCMU      RNIGVANFNCQAILDLLTYARIKPAVLQIELHPYLPQERLVKWVKEQGIQITAYSSFGYTSLLEHASVKS
XYL1_CANTR      KSIGISNFTGALIYDLIRGATIKPAVLQIEHHPYLQQPKLIEYVQKAGIAITGYSSFGPQSLFEHETIKL
ALDR_PIG        KAIGVSNFNHLQVEKILNKPKYKPAVNQIEVHPYLTQEKLIEYCKSKGIVVTAYSPLGSPDLLEDPRIKA
ALDR_RABIT      KSIGVSNFNHLQIERILNKPKYKPAVNQIECHPYLTQEKLIQYCHSKGIVVTAYSPLGSPDLLEDPRIKA
AK1A1_XENLA     KAIGLSNFNKRQMDDILSIATVKPAVLQVECHPYLAQNELIACCRSHGLVLTGYSPLGSPDLLEEPGIIA
ALDR_ENCCU      KSIGISNFGKANTEKILGTCRICPAAIQIELHPYLNQKELVEFMKSKGIQVXXXXXXXXXKVRDDKTIKA
ALD2_CRIGR      KALGVSNFNHFQIERILNKPKHKPVTNQVECHPYLTQEKLIEYCHSKGITVTAYSPLGSPNLLEDPKIKE
AK1A1_CRIGR     KALGLSNFNSRQIDDILSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSD---------
AKCL2_HUMAN     KNIGVSNFNHEQLERLLNKLRFKPLTNQIECHPYLTQKNLISFCQSRDVSVTAYRPLGGSDLIDNPVIKR
AK1C2_HUMAN     KSIGVSNFNHRLLEMILNKLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHRLLEDPVLCA
PE2R_RABIT      KSIGVSNFNRRQLEMILNKLKYKPVCNQVECHPYLNQGKLLEFCKSKGIVLVAYSALGSHRLLEDPLIGA
XYL1_PICGU      RSIGISNFPGALIQDLLRGAKIKPAVLQIEHHPYLQQPRLIEYVQSQGIAITAYSSFGPQSLFEHDVIKS
AKC1H_MOUSE     KSIGVSNFNRRQLEMILNKLKYKPVCNQVECHLYLNQSKLLAYCKMNDIVLVAYGALGTQRLLDDPVLCA
AK1C1_PONAB     KSIGVSNFNRRQLEMILNKLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHRLLEDPVLCA
AK1C1_HUMAN     KSIGVSNFNRRQLEMILNKLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHRLLEDPVLCA
PGFS1_BOVIN     KSIGVSNFNHKQLEKILNKLKYKPVCNQVECHPYLNQSKLLEFCKSHDIVLVAYAALGNPVLLEDPVLCA
ALDR_BOVIN      KAIGVSNFNHLQVEKILNKPKYKPAVNQIECHPYLTQEKLIQYCNSKGIVVTAYSPLGSPDILEDPRIKA
AK1C1_MACFU     KSIGVSNFNRRQLEMILNKLKYKPVCNQVECHPYLNQRKLLDFCKSKDIVLVAYSALGSHRLLEDPVLCA
XYL1_CANPA      KSIGISNFSAQLIYDLIRGCTIKPVALQIEHHPYLTQPKLVEYVQLHDIQITGYSSFGPQSLLEEPTVKS
PGFS2_BOVIN     KSIGVSNFNHKQLEKILNKLKYKPVCNQVECHPYLNQSKLLEFCKSHDIVLVAYAALGNPVLLEDPVLCA
AKCL2_MACFA     KNIGVSNFNHEQLERLLNKPRFKPVTNQIECHPYLTQKNLISFCQSRGVSVTAYRPLGGSDLIDDPVIQR
AK1C4_MACFA     KSIGVSNFNRRQLEMILNNLKYKPVCNQVECHPYLNQSKLLDFCKSKDIVLVAWVDQNSPALLEDPVLCA
AK1C1_MACFA     KSIGVSNFNRRQLEMILNKLKYKPVCNQVECHPYLNQRKLLDFCKSKDIVLVAFSALGSHRLLEDPVLCA
DKGB_YERPE      RQIGISNFIDLMKQAIAAVGAEEIATNQIELSPLLQNRNVVDFAKQNGIAVTSYMTLAYGKALAEPVIKT
AK1C4_HUMAN     KSIGVSNFNCRQLEMILNKLKYKPVCNQVECHPYLNQSKLLDFCKSKDIVLVAHSALGTQRLLEDPVLCA
AK1C4_MACFU     KSIGVSNFNRRQLEMILNNLKYKPVCNQVECHPYLNQSKLLDFCKSKDIVLVAWVDQNSPALLEDPVLCA
AK1CN_HORSE     KSIGVSNFNRRQLEMILNKLKHKPVCNQVECHPYLNQSKLLDFCKSKDIVLVAYSALGSQRLLEDPVLCA
AK1C3_PONAB     KSIGVSNFNRRQLEMILNKLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRLLEDPVLCA
CRO_RANCA       RSLGVSNFNRRQLERILNKLKYKPVCNQVECHVYLNQNKLHSYCKSKDIVLRNWXXXXXXXXXXXXXXNK
ARA1_YEAST      RAIGVSNFSIEYLERLIKECRVKPTVNQVETHPHLPQMELRKFCFMHDILLTAYSPLGSHGAPNLKLVKK
AK1C3_HUMAN     KSIGVSNFNRRQLEMILNKLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRLLEDPVLCA
AK1CO_HORSE     KSIGVSNFNRRQLEMILNKLKYKPVCNQVECHPYLNQSKLLDFCKSKDIVLVAYGALGTQRLLEDPVLCA
AK1D1_HUMAN     KSLGVSNFNRRQLELILNKLKHKPVSNQVECHPYFTQPKLLKFCQQHDIVITAYSPLGTSRLLKDALLNS
AK1CL_MOUSE     KSIGVSNFNYRQLEMILNKLKYKPVCNQVECHPYLNQMKLLDFCKSKDIVLVAYGVLGTQRLLDEPVLGS
CRO_RANTE       RSLGVSNFNRRQLERILNKLKYKPVCNQVECHVYLNQNKLHSYCKSKDIVLRNWXXXXXXXXXXXXXXNK
XYL1_KLULA      KSLGISNFSGALIQDLLRGARIKPVALQIEHHPYLTQERLIKYVKNAGIQVVAYSSFGTPTLFEHDTIKS
XYL1_CANTE      KSIGVSNFPGALLLDLLRGATIKPAVLQVEHHPYLQQPKLIEFAQKAGVTITAYSSFGQGRLFAHDTIKA
AK1D1_MOUSE     KSLGVSNFNRRQLELILNKLKYKPVTNQVECHPYFTQTKLLKFCQQHDIVIVAHSPLGSPPLLNDELLTS
GRE3_YEAST      KSIGVSNFQGSLIQDLLRGCRIKPVALQIEHHPYLTQEHLVEFCKLHDIQVVAYSSFGPQSLFENDVIKK
DIDH_RAT        KSIGVSNFNCRQLERILNKLKYKPVCNQVECHLYLNQSKMLDYCKSKDIILVSYCTLGSSRLLDDPVLCA
AK1D1_RABIT     KSLGVSNFNRQQLELLLNKLKHKPVCNQVECHPYFTQPKLLKFCQQHDIIIVAYSPLGTPPLLKDTLLNS
AK1D1_RAT       KSLGVSNFNRRQLEVILNKLKYKPVTNQVECHPYFTQTKIVAYSPLGTCRNPLWVNVSSPPLLKDELLTS
YHH5_SCHPO      NKIGVSNYNIHHLEEIISLGLPLPAINQVEFSAFNNRPTFLSYCFNHGILVQAFSPLTRGYXXXXXXXXX
KAR_YEAST       KNIGVSNFAVEDLQRILKVAEVKPQVNQIEFSP-FLQNQIYKFCQEHDILVEAYSPLGKKTAQDDSQVKE
AK1CD_MESAU     KSIGVSNFNMRQLERILNKLKYKPVCNQVECHVYNNQSKLLDYCKSKDIVLVAFGALGTQRLLNDPVLCG
XYL1_TRIRE      RSIGVSNYQAQSVYDALIYARIKPATLQIEHHPYLQQPDLVSLAQTEGIVVTAYSSFGPAPLMDSPVIKA
AK1CL_RAT       KSIGVSNFNRRQLEKILNKLKYKPVCNQVECHLYLNQMKLLDFCKTNGIILVAYGVLGTQRLLNEPVLSS
YEAE_ECOLI      RRWGVSNLDYADMQELWQ----LPGGNQCATNQVLYEYDLLPWCQQQQMPVMAYSPLAQNGLLKNAVVNE
AKCL1_HUMAN     ----------------------------------------------------------------------
GS69_BACSU      RAIGVSNFSIEQMDTFRAVAPLHTIQPPYNLFEREMEESVLPYAKDNKITTLLYGSLCRG-LLTGKMTEE
TRAKR_HUMAN     ----------------------------------------------------------------------
YDJG_ECOLI      RAIGAANVDADHIREYLQYGELDIIQAKYSILDRAMENELLPLCRDNGIVVQVYSPLEQGLLTGTEQWQP
YCCK_BACSU      KAIGASNLDYQQLQDFNADGYLEVFQAEYSLIQRDAEKELLPYCEKQGISFIPYGKFTQDTVFDDDKLKA
YH5B_SCHPO      RHVGLSEVT---VDDIKEAEQYFPVVSVQNLFNLVNREKVLEYCEQKGIAFIPWYPLASGALAKPGTILD
YI7E_SCHPO      RYIGASTMRCYQFIELQNTAKFISMQNYHNLLYREEEREMIPYCQKTGVGLIPWSPLARGLLTRSSRVEE
YDHF_ECOLI      RHFGVSNFTPAQFALLQSRLPFTLATNQVEISPXXXXXXXXXXXXXXRVRPMAWSCLGGGRLFNDDYFQP
YAKC_SCHPO      RYIGLSEC---SANTIRRAAAVYPSAVQVEYSPFSLEIEVMKACRENNITIVCYAPLGRGFLTGATKIEK
Y1669_ARATH     KAVGVSNYSEKRLRDAYERLKIPLASNQVNYSL-IYQTGVKAACDELGVTLIAYSPIAQGALTGKNRIKQ
IOLS_BACSU      RSIGVSNFSLEQLKEANKDGLVDVLQGEYNLLNREAEKTFFPYTKEHNISFIPYFPFPEGDLFKGERFKE
YAJO_ECOLI      RYIGASSMHASQFAQALELAQFVSMQDHYNLIYREEEREMLPLCYQEGVAVIPWSPLARGRLTNDAQIAE
YRPG_BACSU      DYIGSSNFAGWHLKAQAEAEKLVTEQHKYSLLERTAEMEVLPAARDLGLGVVAWSPXXRADLIEKHRLQD
AAD4_YEAST      LYLGVSD-----TPAWVVSAANYYATSHGKTPFSIYQGKIIPMARHFGMALAPWDVMGGGRFQSKKAMEE
TAS_SHIFL       RYIGVSNETAFHLADKHDLPRIVTIQNPYSLLNRSFEVGLAEVSQYEGVELLAYSCLGFGTLYSGEQTQD
TAS_ECOLI       RYIGVSNETAFHLADKHDLPRIVTIQNPYSLLNRSFEVGLAEVSQYEGVELLAYSCLGFGTLYSGEQTQD
AAD14_YEAST     LYLGVSD-----TPAWVVSAANYYATSHGKTPFSVYQGKIIPMARHFGMALAPWDVMGGGRFQSKKAMEE
YCSN_BACSU      RYFGVSNFKDHQYRMLESYLPEKLVTNQIELSAYELEDGTLNLCQEKRIPPMAWSPLAGGKVFDRRVRTA
YQKF_BACSU      RYYGISSIRPNVIKEYVKKSNIVSIMMQFSL---------------------------------------
Y2320_MYCBO     GAAGVSNYSLRKADAALGRPVVSNQVHFSLAHPDALED-LVPFAELENRIVIAYSPLAQGPLFGTENLRR
Y2298_MYCTU     GAAGVSNYSLRKADAALGRPVVSNQVHFSLAHPDALED-LVPFAELENRIVIAYSPLAQGPLFGTENLRR
KCAB_SCHPO      FYWGTSEWSAFEIEHAHHIATIAPVADQPQILTGKYNDGIPEGSRLSTTFTSLAGPEGKTQLDQVRQISK
STCV_EMENI      LNIGISDAPAWVVAKCNEYARFHGCVYQGRWACSYFEREILPMCQSEGLALAPWGALGRGQYKSAEEFQQ
KCAB_ORYSJ      FYWGTSEWSAQQITEAWSVANRLDLV-----GPIVEQPEYNLFSRHKGLGLTTWSPLASGVLADSRFALE
IN22_MAIZE      KYIGLSEASA----STIRRAHAVHPITAVQLEWSLWEEDIIPTCRELGIGIVAYSPLGRG----------
YGHZ_ECOLI      LYVGISSYSPERTQKMVELLKIPLLIHQPSLNRWVDKSGLLDTLQNNGVGCIAFTPLAQGLLTDSRMLNE
YGHZ_ECO57      LYVGISSYSPERTQKMVELLKIPLLIHQPSLNRWVDKSGLLDTLQNNGVGCIAFTPLAQGLLTDSRMLNE
KCAB2_HUMAN     MYWGTSRW------SSMEIMEAYSVARQFNLTPPIEQAEYHMFQREKGVGAMTWSPLACGIVYDSKELQA
YDBC_ECOLI      KHIGLSNVTPTQVAEARKIAEIVCVQNEYNIAHRA-DDAMIDALAHDGIAYVPFFPLGGFTPLQSSTLSD
KCAB2_BOVIN     MYWGTSRW------SSMEIMEAYSVARQFNLIPPIEQAEYHMFQREKGVGAMTWSPLACGIVYDSKELQA
KCAB2_XENLA     MYWGTSRW------SSMEIMEAYSVARQFNLIPPIEQAEYHMFQREKGVGAMTWSPLGRRQQAKLKEFQA
KCAB2_RAT       MYWGTSRW------SSMEIMEAYSVARQFNLIPPIEQAEYHMFQREKGVGAMTWSPLACGIVYDSKELQA
KCAB2_MOUSE     MYWGTSRW------SSMEIMEAYSVARQFNLIPPIEQAEYHMFQREKGVGAMTWSPLACGIVYDSKELQA
KCAB1_RAT       MYWGTSRW------SAMEIMEAYSVARQFNMIPPVEQAEYHLFQREK-----------------------
KCAB1_RABIT     MYWGTSRW------SAMEIMEAYSVARQFNMIPPVEQAEYHLFQREK-----------------------
KCAB1_MUSPU     MYWGTSRW------SAMEIMEAYSVARQFNMIPPVEQAEYHLFQREK-----------------------
KCAB1_MOUSE     MYWGTSRW------SAMEIMEAYSVARQFNMIPPVEQAEYHLFQREK-----------------------
KCAB1_HUMAN     MYWGTSRW------SAMEIMEAYSVARQFNMIPPVEQAEYHLFQREK-----------------------
KCAB1_BOVIN     MYWGTSRW------SAMEIMEAYSVARQFNMIPPVEQAEYHLFQREK-----------------------
AAD_PHACH       LYLGVSDWVVSKANNYARMAGKTPFVGEWNITMRDMERDIIPMCIHEGMAIAPWNVLCAGKIFDSKALEK
KCAB1_CHICK     MYWGTSRW------SAMEIMEAYSVARQFNLIPPVEQAEYHLFQREK-----------------------
GSH0_HUMAN      VAIGTSDLDKTQLEQLYQWAQVKPNSNQVNLA--------------------------------------
ARK74_HUMAN     VELGLSNYAAWEVAEICTLCKILPTVYQGMYSATTRQVETELFLRHFGLRFYAYNPLAGGLL--------
KCAB3_XENLA     MYWGTSRW------SAMEIMEAYSVARQFNLIPPVEQAEYHLFQREK-----------------------
GSH0_RAT        VAIGTSDLDKTQLEQLYQWAQVKPNSNQVNLA--------------------------------------
GSH0_MOUSE      VAIGTSDLDKTQLEQLYQWAQVKPNSNQVNLA--------------------------------------
NORA_ASPPA      LYLGVSDWLVVKCNAFARANGLTPSVYQGHWSSAFFERDILPMCESEGMGLAPWGVLGRGQFRSAEEFDE
GSH0_BOVIN      VAIGTSDLDKTQLEQLYQWAQVKPNSNQVNLA--------------------------------------
AAD10_YEAST     LYLGVSD-----TPAWVVSAANYYATSHGKTPFSIYQGKIIPMARHFGMALAPWDVMGGGRFQSKKAVEE
NORA_ASPFL      LYLGVSDWLVVKCNAFARANGLTPSVYQGHWSCAFFERDILPMCESEGMGLAPWGVLGRGQFRSAEEFDE
ARK73_HUMAN     VELGLSNYAAWEVAEICTLCKILPTVYQ-----GMYETELFPCLRHFGLRFYAFNPLAGGLL--------
ARK72_MOUSE     VELGLSNYASWEVAEICTLCKILPTVYQ-----GMYEAELLPCLRHFGLRFYAYNPLAGGLL--------
ARK73_RAT       VELGLSNYVSWEVAEICTLCKIMPTVYQ-----GMYETELFPCLRHFGLRFYAFNPLAGGLLTGRYKYQD
ARK72_HUMAN     VELGLSNYASWEVAEICTLCKILPTVYQ-----GMYETELFPCLRHFGLRFYAYNPLAGGLL--------
YZ38_AQUAE      ----------------------------------------------------------------------
AAD6_YEAST      ----------------------------------------------------------------------
GSH0_SCHPO      GTLGVSEFGVNELQRLISSVNVVPESTQINI---------------------------------------
ARK72_RAT       VELGLSNYASWEVAEIYTLCKILPTVYQ-----GMYETELLPCLRYFGLRFYAYNPLAGGLL--------
IF2_ALKMQ       ---------------------IIVAINKID-KPGANQDRVKQELSDHGILIEAWG----GDVI-AVPVSA
CLS2_BACCR      ----------------------------------------------------------------------
MHR1_CANAL      ----------------------------------------------------------------------
ALKE_BABBO      RHWGLSNETPWGTLRFYKLAKAAPASVQLHLCRNEVEKGFVELCRPQGIAILAYAPLAGGIL--------
CROB_LEPLU      K---------------------------------------------------------------------
CLS2_BACAN      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           IAANHGKSIAQIALAWSLAEGFLPLPKSVTTSRIQANLDCFGIELSHEERETLKTIAVQSGAPRVDDVDF
GR_BACSU        IAEKHNKSVAQVILRWDLQHGVVTIPKSIKEHRIIENADIFDFELSQEDMDKIDAL--------------
P100_LEIMA      IGAKYNKTAAQVILRWNIQKNLITIPKSVHRERIEENADIFDFELGAEDVMSIDALNTNSRGPDPDEAQF
YPR1_YEAST      MAKKHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIF--TLPEDDFKTISNLSKVHGTKRVVDM--
Y2408_MYCS2     IAEQHGKTPAQVLIRWHIQLGNIVIPKSVNPERIASNFDVFDFELSGQDITSIASL--------------
GCY_YEAST       IAKKNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIF--TLSTEDFEAINNISKEKGEKRV-----
YTBE_BACSU      IAQTYNKSVAQIILRWDLQHGIITIPKSTKEHRIKENASVFDFELTQDDMNRIDALNENRVGPDPDNFDF
Y1919_MYCSJ     VAESHGKTAAQALIRWHMQLGNIVIPKSVNPQRIESNFDVFDFELSEQDMASISSL--------------
Y1985_MYCSK     VAESHGKTAAQALIRWHMQLGNIVIPKSVNPQRIESNFDVFDFELSEQDMASISSL--------------
DKGA_ECOLI      LADKYGKTPAQIVIRWHLDSGLVVIPKSVTPSRIAENFDVWDFRLDKDE---------------------
DKGA_ECO57      LADKYGKTPAQIVIRWHLDSGLVVIPKSVTPSRIAENFDVWDFRLDKDE---------------------
ALDX_SPOSA      IAEKNGCTPAQVLIAWAIVGGHSVIPKSVTPSRIGENFK--QVSLSQEDVDAVSKLGEGSGRRR------
Y2407_MYCS2     IAEAHGRTAAQVLLRWSIQLGNVVISRSANPERIASNLDVFGFELTADEMETL-----------------
ALRA_DICDI      IAKKYNKTIPNVLCKWAIQKNFSVIPKSSTPSRVAENFDLFNFEIEEAD---------------------
YER5_SCHPO      IASKYNKSEAQIMIRYCLQRGFIVLPKSSTPRRIKENGDVFDFEISKEDMEKL-----------------
Y4205_MYCGI     IAEAHGRTPAQVLIRWSLQLGNXXXXXXXXXXXXXXXXDVFGFELSEEQMSTL-----------------
DKGA_CORSC      XXXXHGKTPAQAVLRWHLQKGFVVFPKSVRRERLEENLDVFDFDLTDTEIAAIDAMDPGDGSGRVDEVD-
AK1A1_PIG       LAEKYNRSPAQILLRWQVQRKVICIPKSVTPSRIPQNIQVFDFTFSPEEMKQLDAL--------------
AK1A1_BOVIN     LAEKHGRSPAQILLRWQVQRKVSCIPKSVTPSRILENIQVFDFTFSPEEMKQLDAL--------------
Y2161_MYCVP     IADAQDRTPAQVLIRWSLQLGNVVISRSSSPERIKSNLDVFDFELTADQMAAL-----------------
MORA_PSEPU      IAEAHGRSAAQVILRWHFQNDVVAIPKSVNPERIAKNIDVFDFALSDAEMAQLDELGVRIG-PDPRDVD-
YJ66_YEAST      VCKEVDRNPGQVLIRWSLQHGYLPLPKTKTVKRLEGNLAAYNFELSDEQMKFL-----------------
YOF5_CAEEL      IASKYQKSPAQICLRWSIQQNVPTVPKSTDCRRLKENTNVFDFELSAEDMNTLNSFSSQN----------
AK1A1_RAT       XXXKHGRSPAQILLRWQVQRKVICIPKSITPSRILQNIQVFDFTFSPEEMKQLDAL--------------
DKGA_YERPE      LAQQYNKTPAQIVIRWHLDSGLIVIPKSVTPARIRENFEVFDFKLQKEE---------------------
AK1A1_MOUSE     XXXKHGRSPAQILLRWQVQRKVICIPKSINPSRILQNIQVFDFTFSPEEMKQLDAL--------------
AK1BA_HUMAN     IAAKHKKTAAQVLIRFHIQRNVIVIPKSVTPARIVENIQVFDFKLSDEEMATI-----------------
AK1A1_PONAB     XXXKYGGSPAQILLRWQVQRKVICIPKSITPSRILQNIKVFDFTFSPEEMKQLNAL--------------
ALRC_DICDI      IAGKYKKSVANVIFKWLNQRGIAAIPKSGNHSRIIENFNIFDFQLSNDDIEKINSL--------------
YBN4_SCHPO      IANARGEGIANIAISWAVKRGTSVLPKSVNESRIVSNF--LYIPLTDKEMEAINNIGV------------
AK1A1_HUMAN     XXXKYGRSPAQILLRWQVQRKVICIPKSITPSRILQNIKVFDFTFSPEEMKQLNAL--------------
DKGA_SALTY      LADKYGKTPAQIVIRWHLDCGLVVIPKSVTPSRIAENFAVWDFRLDKDE---------------------
DKGA_SALTI      LADKYGKTPAQIVIRWHLDCGLVVIPKSVTPSRIAENFAVWDFRLDKDE---------------------
Y1984_MYCSK     VAQAHGKTPAQVLLRWSIQLGNVVIARSANPDRITSNLEVFDFELTDDEMATL-----------------
Y1938_MYCSS     VAQAHGKTPAQVLLRWSIQLGNVVIARSANPDRITSNLEVFDFELTDDEMATL-----------------
Y2996_MYCBO     IASEYVKTPAQVLLRWNLQLGNAVVVRSARPERIASNFDVFDFELAAEHMDAL-----------------
Y2993_MYCBP     IASEYVKTPAQVLLRWNLQLGNAVVVRSARPERIASNFDVFDFELAAEHMDAL-----------------
Y1918_MYCSJ     VAQAHDKTPAQVLLRWSIQLGNVVIARSANPDRITSNLEVFDFELTDDEMATL-----------------
Y2999_MYCTA     IASEYVKTPAQVLLRWNLQLGNAVVVRSARPERIASNFDVFDFELAAEHMDAL-----------------
Y2971_MYCTU     IASEYVKTPAQVLLRWNLQLGNAVVVRSARPERIASNFDVFDFELAAEHMDAL-----------------
Y1669_MYCLE     IAAEYGKTPAQVLLRWNLQLGNAVVFRSAKAEHIASNFDVFDFELAVNHMDAMNEL--------------
Y1669_MYCLB     IAAEYGKTPAQVLLRWNLQLGNAVVFRSAKAEHIASNFDVFDFELAVNHMDAMNEL--------------
AKCL2_MOUSE     IAKKHGKSPAQILIRFQIQRNLIVIPKSVTPSRIRENIQVFDFELTEKDMEELLSL--------------
DKGB_ECOLI      IAAKHNATPAQVILAWAMGEGYSVIPSSTKRKNLESNLKAQNLQLDAEDKKAIAAL--------------
Y3816_MYCA1     VAAEYGKTASQVLLRWNLQLGNAVIFRSANAEHIASDFDVFDFELAAEHMDAINAL--------------
ALDR_HORVU      VANKLNKTPGQVLIKWALQRGTSVIPKSSKDERIKENIQVFGWEIPEEDFKVLCSI--------------
DKGB_ECO57      IAAKHNATPAQVILAWAMGEGYSVIPSSTKRENLESNLKAQNLQLDAEDKKAIAAL--------------
Y3007_MYCPA     VAAEYGKTASQVLLRWNLQLSNAVIFRSANAEHIASDFDVFDFELAAEHMDAINAL--------------
ALRB_DICDI      IADKHNKTVANVIFKWLNQRGIVTIPKSSNPARIIENFNIFDFQLSNEDMDKINSL--------------
AKCL2_RAT       IAKKHGKSPAQILIRFQIQRNLIVIPKSVNPSRIRENIQVFDFELTEKDMEELLSL--------------
Y1744_MYCMM     IAGEYGKTPTQVLLRWNLQLGNAVIFGSSNAEHIATNLDVFEFELASQHMDAI-----------------
6DCS_SOYBN      IAEAHGKSIAQVSLRWLYEQGVTFVPKSYDKERMNQNLHIFDWALTEQDHHKISQIS-------------
Y1987_MYCUA     IAGEYGKTPTQVLLRWNLQLGNAVIFGSSNAEHIVTNLDVFEFELASQHMDAI-----------------
AKCL2_PIG       IAQKHGKSAAQILIRFQIQRNVIVIPKSVNPKRILENFQVFDFELSEQDMTDL-----------------
NADO1_ORYSJ     IAGAKGKTLAQICLRWLYEQGDVLLVKTYNEKRMKENLDIFNWELTDEERERISQLPQLRGLPGLE----
S6PD_MALDO      VAKKYGKSVAQICLRWGIQRKTAVIPKSSKIQRLKENLEVLEFQLSDEDMQLIYSI--------------
AK1CD_MOUSE     VAKKNKRSPALIALRYLIQRGIVPLAQSFKENEMRENLQVFGFQLSPEDMKTL-----------------
ALDR_RAT        IAAKYNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATL-----------------
YKW2_SCHPO      IAKKLNISVAQLLIRWSLQKGYIPIIKSTKKEHMLSDLDVFNFTIPDDVVQELSS---------------
YDG7_SCHPO      IAKSKGEGVATIAVSWAITRGTSVIPKSVNEQRIKSNFKY--IPLTKEDMDEINSIGIRA----------
Y4483_MYCA1     IAAEYGRTPAQVLVRWNLQLDNVVVSRSSKPERVAENLDVFDFTLEPEHMEAIE----------------
XYL1_PICST      IAAKHGKSPAQVLLRWSSQRGIAIIPKSNTVPRLLENKDVNSFDLDEQD---------------------
NADO2_ORYSJ     IAQTKGKTLAQICLRWMYEQGDVLLVKTYNENRMKENLDIFDWELTEEERDKISKLPQQRG---------
AK1A1_CHICK     LAEKYKKSPAQILLRWQAQRKVVTIPKSVTPARILQNLQVFDFSLTEEE---------------------
ALDR_MOUSE      IAAKYNKTTAQVLIRFPIQRNLVVIPKSVTPVRIAENLKVFDFEVSSEDMATL-----------------
ALDR_HUMAN      IAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTL-----------------
DDBX_BOVIN      IAKKHRQTPALVALRYQIQRGVVVLAKSYNKKRIKENIQVFDFELTPEDMKAI-----------------
DKGB_CORSS      XAVVYGVTPTQVVLRWHVQLGSTPIPKSADPDRQRENADVFGFALTADQVDAI-----------------
DHB5_MOUSE      MAKKYNRTPALIALRYQLQRGVVVLAKSFSEKRIKENMQVFEFQLTSEDMKVLKNIRYISGSSFKDHPDF
A1A1B_DANRE     LAKKYNKTPAQIIIRWQTQRGVVTIPKSITQSRIKENIQVFDFTLESEE---------------------
ALD2_MOUSE      IAAKHEKTSAQVLIRFHIQRNVVVIPKSVTPSRIQENIQVFDFQLSDEEMATI-----------------
AK1A1_XENTR     MAKKYGKSEAQILLRWQVQRKVVSIPKSVTPTRILQNFQVFDFSLSEEEMQLI-----------------
XYL1_PACTA      IAAKHGKTPFQVLLRWVNQRGIAIIPKSTFPNTLAVNLHVDEFDLTKEDFEEI-----------------
XYL1_CANSH      IAAKHNKVPAEVLLRWSAQRGIAVIPKSNLPERLVQNRSFNDFELTKEDFEEISKLDI------------
DKGB_SALTY      IAAKHNATPAQVILAWAMGEGYSVIPSSTRRENLASSLLAQDLHLDAEDKNAIAAL--------------
Y4149_MYCPA     IAAEYGRTPAQVLVRWNLQLDNVVVSRSSKPERVAENLDVFDFTLEPEHMEAIE----------------
XYL2_CANTR      IADKHGKSPAQVLLRWATQRNIAVIPKSNNPERLAQNLSVVDFDLTKDDLDNIAKLDI------------
ALD1_MOUSE      IAAKHKKTVAQVLIRFHVQRNVVVIPKSVTPSRIQENLQVFDFQLSEED---------------------
A1A1A_DANRE     IAKSYNKTPAQVIIRWHIQRGVVCIPKSVTPSRIKQNIEVFDFKLSDEDMRLIES---------------
XYL1_ASPNG      IAEKHGRTPAQVLLRWATQRGIAVIPKSNNPQRLKQNLDVTGWNLEEEE---------------------
I3ACR_SCHPO     LESKYHVSDTQILLKWAYSKGVIPI---TTTSKIERMKECLNFDLDKADIDELGTLGVQ-----------
DKGB_SALTI      IAVKHNATPVQVILAWAMGEGYSVIPSSTRRENLASNLLAQDLHLDAEDKNAIAAL--------------
AKC1H_RAT       MAKKYKRTPALIALRYQLERGIVTLVKSFNEERIRENLQVFDFQLASDDMEILDNL--------------
DTDH_MUCMU      VADKHNVSTGQVLLRWALDREFAVIPKSVNAGRMKANLEILDIKLDAEDNKTLDSL--------------
XYL1_CANTR      IADKHGKSPAQVLLRWATQRNIAVIPKSNNPERLAQNLSVVDFDLTKDDLDNIAKLDI------------
ALDR_PIG        IAAKYNKTTAQVLIRFPMQRNLIVIPKSVTPERIAENFQVFDFELSPEDMNTL-----------------
ALDR_RABIT      IADKHKKTTAQVLIRFPMQRNLVVIPKSVTPARIAENFQVFDFELSSEDMTTL-----------------
AK1A1_XENLA     MAKKYNISEAQILLRWQVQRRVVTIPKSVTPARILQNLQVFDFSLSEEEMQLI-----------------
ALDR_ENCCU      IAKKYGCAPSQIILSYITAQGICVIPKSRSKEHLRENIDL--KELSREDISAID--ALNTGHRYVDPPGF
ALD2_CRIGR      IAAKHKKTSAQVLIRFHIQRNVVVIPKSVTPARIHENFQVFDFQLSDQEMATI-----------------
AK1A1_CRIGR     ----------------------------------------------------------------------
AKCL2_HUMAN     IAKEHGKSPAQILIRFQIQRNVIVIPGSITPSHIKENIQVFDFELTQHDMDNILSL--------------
AK1C2_HUMAN     LAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAI-----------------
PE2R_RABIT      LAKKHQQTPALIALRYQLQRGIVVLAKSFTEKRIKENIQVFEFQLPSEDMKVIDSL--------------
XYL1_PICGU      VAEKANKTPAQVLLRWATQRGLAVIPKSNNPDRLLSNLKVNDFDLSQEDFKEISKLDIE-----------
AKC1H_MOUSE     MAKKYKRTPALIALRYQLDRGIVALAKSFNEERIRENMQVFDFQLASDDMKIL-----------------
AK1C1_PONAB     LAKKHKQTPALIALRYQLQRGVVVLAKSYNEQRIRQNMQVFDFQLTSEDMKTI-----------------
AK1C1_HUMAN     LAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAI-----------------
PGFS1_BOVIN     IAKKHKQTPALVALRYQVQRGVVVLAKSFNKKRIKENMQVFDFELTPEDMKAI-----------------
ALDR_BOVIN      IADKYNKTTAQVLIRFPIQRNLIVIPKSVTPERIAENFQVFDFELDKEDMNTL-----------------
AK1C1_MACFU     LAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRENMKVFEFQLTSEDMKAI-----------------
XYL1_CANPA      IADKHGKSPAQVLLRYQTQRGIAVIPRSNSPDRMAQNLSVIDFELTQDDLQAI-----------------
PGFS2_BOVIN     IAKKHKQTPALVALRYQVQRGVVVLAKSFNKKRIKENMQVFDFELTPEDMKAI-----------------
AKCL2_MACFA     IAKEHSKSPAQILIRFQTQRNVIVIPGSITPSHIKENIQVFDFELTQHDMDNILSL--------------
AK1C4_MACFA     LAKKHKRSPALIALRYQLQRGVVVLAKSYNEQRIRENVQVFEFQLTSEDMKVL-----------------
AK1C1_MACFA     LAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRENMKVFEFQLTSEDMKAI-----------------
DKGB_YERPE      IAEQHGATPAQVILSWAMQLGYGVIPSSTKAANLASNL--------------------------------
AK1C4_HUMAN     LAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRENIQVFEFQLTSEDMKVL-----------------
AK1C4_MACFU     LAKKHKRSPALIALRYQLQRGVVVLAKSYNEQRIRENVQVFEFQLTSEDMKVL-----------------
AK1CN_HORSE     MAKKYKRTPALIALRYQLQRGVVVLAKSYNEKRIKENVQAFGFQLTSEDMKVL-----------------
AK1C3_PONAB     LAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRENVQVFEFQLTAEDMRAI-----------------
CRO_RANCA       IAAKYNRTSAEVAMRFILQKGIVVLAKSFTPARIKQNLGVFEFELKPEDMKTLESL--------------
ARA1_YEAST      LAEKYNVTGNDLLISYHIRQGTIVIPRSLNPVRISSSIE-------------------------------
AK1C3_HUMAN     LAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAI-----------------
AK1CO_HORSE     MAKKYKRTPALIALRYLLQRGVVVLAKSYNEKRIKENMQVFEFQLTSEDMKDL-----------------
AK1D1_HUMAN     LGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIEAL--------------
AK1CL_MOUSE     MAKKYNRTPALIALRYQLQRGIVVLNTSLKEERIKENMQVFEFQLSSEDMKVL-----------------
CRO_RANTE       VAAKYNRTSAEIAMRFILQKGIVVLAKSFTPARIKQNLGVFEFELKPEDMKSLESL--------------
XYL1_KLULA      IASKHKVTPQQVLLRWATQNGIAIIPKSSKKERLLDNL--------------------------------
XYL1_CANTE      IAAKYNKTPAEVLLRWAAQRGIAVIPKSNLPERLVQNRSFNTFDLTKEDFEEIAKLDI------------
AK1D1_MOUSE     LGKKYNKTQAQIVLRFNIQRGIVVIPKSFTPERIKENFQIFDFSLTEEEMKDIDAL--------------
GRE3_YEAST      VSQNHGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLE-------------------------------
DIDH_RAT        IAKKYKQTPALVALRYQLQRGVVPLIRSFNAKRIKELTQVFEFQLASEDMKAL-----------------
AK1D1_RABIT     LGKKYKKTAAQIVLRFNVQRGVVVIPKSFNPERIKENFQIFDFSLTEEEMKDIEAL--------------
AK1D1_RAT       LGKKYNKTQAQIVLRFDIQRGLVVIPKSTTPERIKENFQIFDFSLTKEEMKDIEAL--------------
YHH5_SCHPO      XXXKYNKTPANILLRYCLQKGVSPIFKASSFVHIHENVKAEQFMLDPSDMDVMDT---------------
KAR_YEAST       LSEKYIKSEAQIILRWVTKRGVLPVTTSSKPQRISDAQNLFSFDLTAEEVDKITELGLE-----------
AK1CD_MESAU     GAKXXXRSPALIALRYLVQRGVVPLAQSFYESEMKENLQVFEFQLSPEDMKIL-----------------
XYL1_TRIRE      LADKHRRTPAQVLLRWATQRGIAVIPKTSRPEVMAQNLDNTSFDLDSED---------------------
AK1CL_RAT       MAKKYNQTPALIALRHQLQRGIVVLNTSLKEERIKENM-----KLSPEDMKVL-----------------
YEAE_ECOLI      IAHAHNISAAQVLLAWVISQGVMAIPKAATIAHVQQNAAVLEVELSSAELAMLKAYPAPKGKTALDMV--
AKCL1_HUMAN     ----------------------------------------------------------------------
GS69_BACSU      ----------------------------------------------------------------------
TRAKR_HUMAN     ----------------------------------------------------------------------
YDJG_ECOLI      LCARYQCTIPTLALAWILKQSDLILSGATAPEQVRENVAALNINLSDADATLMREMA-------------
YCCK_BACSU      VAEEKQADTAHVALAWLLTRPAIDIPGAKRPEQLQDNLKTLNIELTEDE---------------------
YH5B_SCHPO      VSKDLDRSTSQIALSWVLQRSMLPIPGTSKVDHLEENVKAAGIQLSSE----------------------
YI7E_SCHPO      LAKKYNVSMATLATAWSLHKGDYPIVGISKVERLKDALAAVELKLSEEDIKYLE----------------
YDHF_ECOLI      LRDENAGSIEQVVYAWVLRLPSQPLPGSGKIERVRAAVEAETLKMTRQQWFRIRKAALGYDVP-------
YAKC_SCHPO      IATANNITPGQLSLAWLLAQGILPIPGTKRVKYLEENFGALKVKLS------------------------
Y1669_ARATH     IGENYSKTPTQIALNWLVAQGVIPIPGAKNAEQAKEFAGAIGWSLTDNEVSELRSLA-------------
IOLS_BACSU      IAEKHNVDIPHIVLAWYLAEIDILIPGAKRADQLIDNIKTADVTLSQED---------------------
YAJO_ECOLI      VSEELGATRAQVALAWLLSKPGIAAPIIGTSREEQLDLNAVDITLKPEQIAELET---------------
YRPG_BACSU      LCKELGEKEANVALAWVLANPVLTAP--------------------------------------------
AAD4_YEAST      VAEEHGESVTAIAIAYSKAKNVFPLVGGRKIEHLKQNIEALSIKLTPEQIEYLESI--------------
TAS_SHIFL       IARRHGLDPAQMALAFVRRQPFVTLLGATTMDQLKTNIESLHLELSED----------------------
TAS_ECOLI       IARRHGLDPAQMALAFVRRQPFVTLLGATTMDQLKTNIESLHLELSED----------------------
AAD14_YEAST     IAEEHGESVTAIAIAYSKAKNVFPLIGGRKIEHLKQNIEALSIKLTPEQIEYLESI--------------
YCSN_BACSU      LESVQGESLDEVMYAWLYTHGIMPIVGSGKRERISAAINALSYKLDQDQ---------------------
YQKF_BACSU      ----------------------------------------------------------------------
Y2320_MYCBO     IAVDVDAKPAQVALAWLISPGVVAIPGASSVEQLEFNVAAADIELSAQSRDALTDAA-------------
Y2298_MYCTU     IAVDVDAKPAQVALAWLISPGVVAIPGASSVEQLEFNVAAADIELSAQSRDALTDAA-------------
KCAB_SCHPO      IAEQIGATPSQLALAWTLKNPYV-----------------------------------------------
STCV_EMENI      EGTRNGAKLTEVGXXXHKSPYVFPVIGCRTVEQLEANITSLGVELSDEEYEIEDTIPFDVGFP-------
KCAB_ORYSJ      IASELGVSLAQLAIAWCASN---PNVSSVITGATKEN---------------------------------
IN22_MAIZE      ----------------------------------------------------------------------
YGHZ_ECOLI      MAQQRGQSMAQMALSWLLKD--------------------------------------------------
YGHZ_ECO57      MAQQRGQSMAQMALSWLLKD--------------------------------------------------
KCAB2_HUMAN     IAERLGCTLPQLAIAWCL----------------------------------------------------
YDBC_ECOLI      VAASLGATPMQVALAWLLSPNILLIPGTSSVAHLRENMAAEKLHLSEEVLSTLDGIS-------------
KCAB2_BOVIN     IAERLGCTLPQLAIAWCL----------------------------------------------------
KCAB2_XENLA     IAERLGCTLPQLAIAWCL----------------------------------------------------
KCAB2_RAT       IAERLGCTLPQLAIAWCL----------------------------------------------------
KCAB2_MOUSE     IAERLGCTLPQLAIAWCL----------------------------------------------------
KCAB1_RAT       ----------------------------------------------------------------------
KCAB1_RABIT     ----------------------------------------------------------------------
KCAB1_MUSPU     ----------------------------------------------------------------------
KCAB1_MOUSE     ----------------------------------------------------------------------
KCAB1_HUMAN     ----------------------------------------------------------------------
KCAB1_BOVIN     ----------------------------------------------------------------------
AAD_PHACH       VAEEIGKSITSVAIAYLMQKYVFPIVGGRKVEHLYANLEALDISLSPEQMQFLNTVPFNKGFP-------
KCAB1_CHICK     ----------------------------------------------------------------------
GSH0_HUMAN      ----------------------------------------------------------------------
ARK74_HUMAN     ----------------------------------------------------------------------
KCAB3_XENLA     ----------------------------------------------------------------------
GSH0_RAT        ----------------------------------------------------------------------
GSH0_MOUSE      ----------------------------------------------------------------------
NORA_ASPPA      KHRRLGEKLDQMAKATSIAQAYVPVIGGRKVEHLKENIEALGLVLSEEE---------------------
GSH0_BOVIN      ----------------------------------------------------------------------
AAD10_YEAST     VAEEHGESVTAIAIAYSKAKHVFPLVGGRKIEHLKQNIEALSIKLTPEQIKYLESI--------------
NORA_ASPFL      KHRRLGEKLDQMAKATSIAQAYVPVIGGRKVEHLKENIEALGLVLSEEE---------------------
ARK73_HUMAN     ----------------------------------------------------------------------
ARK72_MOUSE     ----------------------------------------------------------------------
ARK73_RAT       ----------------------------------------------------------------------
ARK72_HUMAN     ----------------------------------------------------------------------
YZ38_AQUAE      ----------------------------------------------------------------------
AAD6_YEAST      ----------------------------------------------------------------------
GSH0_SCHPO      ----------------------------------------------------------------------
ARK72_RAT       ----------------------------------------------------------------------
IF2_ALKMQ       IEGTNINELLEMILLVSEVEEFKANPRQAIGVVIEAKLD--------KGKGTVATVLIQNGTLHVGD---
CLS2_BACCR      ----------------------------------------------------------------------
MHR1_CANAL      ----------------------------------------------------------------------
ALKE_BABBO      ----------------------------------------------------------------------
CROB_LEPLU      ----------------------------------------------------------------------
CLS2_BACAN      ----------------------------------------------------------------------