[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for spne4:ACF56832.1

[Show Plain Result]


## Summary of Sequence Search
    1::328
    1::328       0.0 100%  328 aa  Y154_STRZP RecName: Full=UPF0176 protein SPP_0154;
    1::328       0.0 100%  328 aa  Y092_STRP4 RecName: Full=UPF0176 protein SPG_0092;
    1::328       0.0  99%  328 aa  Y125_STRZT RecName: Full=UPF0176 protein SPT_0125;
    1::328       0.0  99%  328 aa  Y118_STRZJ RecName: Full=UPF0176 protein SPJ_0118;
    1::328       0.0  99%  328 aa  Y105_STRPJ RecName: Full=UPF0176 protein SPN23F01050;
    1::328       0.0  99%  328 aa  Y095_STRPN RecName: Full=UPF0176 protein SP_0095;
    1::328       0.0  99%  328 aa  Y091_STRP2 RecName: Full=UPF0176 protein SPD_0091;
    1::328       0.0  99%  328 aa  Y090_STRPS RecName: Full=UPF0176 protein SPCG_0090;
    1::328       0.0  99%  328 aa  Y084_STRR6 RecName: Full=UPF0176 protein spr0084;
    1::328       0.0  99%  328 aa  Y194_STRPI RecName: Full=UPF0176 protein SPH_0194;
    1::328       0.0  99%  328 aa  Y154_STRP7 RecName: Full=UPF0176 protein SP70585_0154;
    1::323       0.0  94%  328 aa  Y593_STRSV RecName: Full=UPF0176 protein SSA_0593;
    1::323       0.0  93%  328 aa  Y476_STRGC RecName: Full=UPF0176 protein SGO_0476;
    1::323       0.0  93%  327 aa  Y548_STRT1 RecName: Full=UPF0176 protein str0548;
    1::323       0.0  93%  327 aa  Y548_STRT2 RecName: Full=UPF0176 protein stu0548;
    1::323       0.0  93%  327 aa  Y588_STRTD RecName: Full=UPF0176 protein STER_0588;
    1::325     e-170  86%  327 aa  Y406_STRSY RecName: Full=UPF0176 protein SSU05_0406;
    1::325     e-170  86%  327 aa  Y392_STRS2 RecName: Full=UPF0176 protein SSU98_0392;
    1::328     e-165  81%  328 aa  Y1504_STRA3 RecName: Full=UPF0176 protein gbs1504;
    1::328     e-165  81%  328 aa  Y1469_STRA1 RecName: Full=UPF0176 protein SAK_1469;
    1::328     e-165  81%  328 aa  Y1434_STRA5 RecName: Full=UPF0176 protein SAG1434;
    1::324     e-164  81%  328 aa  Y630_STRP3 RecName: Full=UPF0176 protein SpyM3_0630/SPs1223;
    1::324     e-164  81%  328 aa  Y973_STRP8 RecName: Full=UPF0176 protein spyM18_0973;
    1::324     e-164  81%  328 aa  Y915_STRP1 RecName: Full=UPF0176 protein SPy_0915/M5005_Spy0717;
    1::324     e-164  81%  328 aa  Y811_STRPF RecName: Full=UPF0176 protein MGAS10750_Spy0811;
    1::324     e-164  81%  328 aa  Y743_STRP6 RecName: Full=UPF0176 protein M6_Spy0743;
    1::324     e-164  81%  328 aa  Y726_STRPZ RecName: Full=UPF0176 protein Spy49_0726;
    1::324     e-164  81%  328 aa  Y1090_STRPG RecName: Full=UPF0176 protein SpyM51090;
    1::324     e-163  81%  328 aa  Y776_STRPD RecName: Full=UPF0176 protein MGAS10270_Spy0776;
    1::324     e-163  81%  328 aa  Y789_STRPB RecName: Full=UPF0176 protein MGAS2096_Spy0789;
    1::324     e-163  81%  328 aa  Y773_STRPC RecName: Full=UPF0176 protein MGAS9429_Spy0773;
    1::324     e-163  81%  328 aa  Y697_STRPM RecName: Full=UPF0176 protein M28_Spy0697;
    1::328     e-162  80%  328 aa  Y1138_STRU0 RecName: Full=UPF0176 protein SUB1138;
    1::317     e-137  70%  319 aa  YMDE_LACLA RecName: Full=UPF0176 protein ymdE;
    1::317     e-135  69%  319 aa  Y1287_LACLM RecName: Full=UPF0176 protein llmg_1287;
    1::317     e-133  68%  319 aa  Y1324_LACLS RecName: Full=UPF0176 protein LACR_1324;
    4::300     e-130  69%  316 aa  Y748_ENTFA RecName: Full=UPF0176 protein EF_0748;
    1::318     e-126  65%  322 aa  Y2654_BACSK RecName: Full=UPF0176 protein ABC2654;
    1::315     e-126  66%  322 aa  Y3574_BACLD RecName: Full=UPF0176 protein BLi03574/BL00834;
    3::313     e-125  66%  319 aa  Y1400_LISW6 RecName: Full=UPF0176 protein lwe1400;
    3::316     e-125  66%  319 aa  Y1185_LISMH RecName: Full=UPF0176 protein LMHCC_1185;
    3::316     e-125  66%  319 aa  Y1403_LISMF RecName: Full=UPF0176 protein LMOf2365_1403;
    3::316     e-125  66%  319 aa  Y1393_LISMC RecName: Full=UPF0176 protein Lm4b_01393;
    3::313     e-125  67%  319 aa  Y1384_LISMO RecName: Full=UPF0176 protein Lmo1384;
    3::316     e-125  66%  319 aa  Y1421_LISIN RecName: Full=UPF0176 protein Lin1421;
    2::308     e-125  65%  316 aa  Y127_STAS1 RecName: Full=UPF0176 protein SSP0127;
    5::315     e-124  67%  319 aa  Y1961_BACC1 RecName: Full=UPF0176 protein BCE_1961;
    5::315     e-124  67%  319 aa  Y1989_BACC7 RecName: Full=UPF0176 protein BCAH187_A1989;
    5::315     e-124  67%  319 aa  Y1948_BACC3 RecName: Full=UPF0176 protein BCA_1948;
    5::315     e-124  67%  319 aa  Y1658_BACAH RecName: Full=UPF0176 protein BALH_1658;
    5::315     e-123  67%  319 aa  Y1875_BACCQ RecName: Full=UPF0176 protein BCQ_1875;
    5::315     e-123  66%  319 aa  Y3469_BACC2 RecName: Full=UPF0176 protein BCG9842_B3469;
    2::308     e-123  65%  320 aa  Y299_STAHJ RecName: Full=UPF0176 protein SH0299;
    5::315     e-123  66%  319 aa  Y2712_BACAC RecName: Full=UPF0176 protein BAMEG_2712;
    5::315     e-123  66%  319 aa  Y1948_BACAA RecName: Full=UPF0176 protein BAA_1948;
    5::315     e-123  66%  319 aa  Y1916_BACC0 RecName: Full=UPF0176 protein BCAH820_1916;
    5::315     e-123  66%  319 aa  Y1881_BACAN RecName: Full=UPF0176 protein
    5::315     e-123  66%  319 aa  Y1875_BACC4 RecName: Full=UPF0176 protein BCB4264_A1875;
    5::315     e-123  66%  319 aa  Y1804_BACCR RecName: Full=UPF0176 protein BC_1804;
    5::315     e-123  66%  319 aa  Y1719_BACHK RecName: Full=UPF0176 protein BT9727_1719;
    5::315     e-123  66%  319 aa  Y1694_BACCZ RecName: Full=UPF0176 protein BCE33L1694;
    5::315     e-123  66%  319 aa  Y1736_BACWK RecName: Full=UPF0176 protein BcerKBAB4_1736;
   18::321     e-122  67%  323 aa  Y572_OCEIH RecName: Full=UPF0176 protein OB0572;
    5::315     e-122  65%  324 aa  Y1464_BACCN RecName: Full=UPF0176 protein Bcer98_1464;
    4::308     e-122  65%  318 aa  Y2770_STAA2 RecName: Full=UPF0176 protein SaurJH1_2770;
    4::308     e-122  65%  318 aa  Y2713_STAA9 RecName: Full=UPF0176 protein SaurJH9_2713;
    4::308     e-122  65%  318 aa  Y2689_STAAM RecName: Full=UPF0176 protein SAV2689;
    4::308     e-122  65%  318 aa  Y2673_STAA1 RecName: Full=UPF0176 protein SAHV_2673;
    4::308     e-122  65%  318 aa  Y2481_STAAN RecName: Full=UPF0176 protein SA2481;
    4::308     e-121  64%  318 aa  Y2609_STAAW RecName: Full=UPF0176 protein MW2609;
    4::308     e-121  64%  318 aa  Y2575_STAAS RecName: Full=UPF0176 protein SAS2575;
    4::308     e-121  64%  318 aa  Y3024_STAA8 RecName: Full=UPF0176 protein SAOUHSC_03024;
    4::308     e-121  64%  318 aa  Y2691_STAAT RecName: Full=UPF0176 protein USA300HOU_2691;
    4::308     e-121  64%  318 aa  Y2622_STAA3 RecName: Full=UPF0176 protein SAUSA300_2622;
    4::308     e-121  64%  318 aa  Y2587_STAAE RecName: Full=UPF0176 protein NWMN_2587;
    2::308     e-121  64%  320 aa  Y262_STAES RecName: Full=UPF0176 protein SE_0262;
    1::312     e-121  62%  318 aa  Y1123_ACHLI RecName: Full=UPF0176 protein ACL_1123;
    2::308     e-120  64%  320 aa  Y2316_STAEQ RecName: Full=UPF0176 protein SERP2316;
    4::308     e-120  64%  318 aa  Y2713_STAAC RecName: Full=UPF0176 protein SACOL2713;
    4::308     e-120  64%  318 aa  Y2771_STAAR RecName: Full=UPF0176 protein SAR2771;
    1::320     e-119  62%  322 aa  YBFQ_BACSU RecName: Full=UPF0176 protein ybfQ;
    4::308     e-119  63%  318 aa  Y2565_STAAB RecName: Full=UPF0176 protein SAB2565;
    2::317     e-119  62%  317 aa  Y2303_STACT RecName: Full=UPF0176 protein Sca_2303;
    1::313     e-118  62%  322 aa  Y205_BACP2 RecName: Full=UPF0176 protein BPUM_0205;
    1::320     e-116  59%  322 aa  Y274_BACA2 RecName: Full=UPF0176 protein RBAM_002740;
   11::303     5e-98  55%  308 aa  Y085_ONYPE RecName: Full=UPF0176 protein PAM_085;
   11::303     4e-96  54%  308 aa  Y630_AYWBP RecName: Full=UPF0176 protein AYWB_630;
    2::289     8e-67  43%  312 aa  Y2691_CYTH3 RecName: Full=UPF0176 protein CHU_2691;
    8::299     1e-52  37%  305 aa  Y2281_BRUO2 RecName: Full=UPF0176 protein BOV_A0081;
   11::302     1e-52  37%  308 aa  Y3086_BRUSU RecName: Full=UPF0176 protein BRA0086;
    8::299     1e-52  37%  305 aa  Y2589_BRUC2 RecName: Full=UPF0176 protein BCAN_B0089;
    8::299     5e-52  37%  305 aa  Y800_BRUA1 RecName: Full=UPF0176 protein BAbS19_II00800;
    2::233     5e-52  41%  254 aa  Y2897_LEGPA RecName: Full=UPF0176 protein lpp2897;
   19::310     5e-52  37%  316 aa  Y2585_BRUA2 RecName: Full=UPF0176 protein BAB2_0085;
    8::299     5e-52  37%  305 aa  Y2390_BRUMB RecName: Full=UPF0176 protein BMEA_B0090;
    8::299     5e-52  37%  305 aa  Y2386_BRUAB RecName: Full=UPF0176 protein BruAb2_0086;
    1::296     7e-52  37%  325 aa  Y996_CHLFF RecName: Full=UPF0176 protein CF0996;
   19::245     7e-52  41%  305 aa  Y007_BRUME RecName: Full=UPF0176 protein BMEII0007;
    8::234     1e-51  40%  305 aa  Y4255_OCHA4 RecName: Full=UPF0176 protein Oant_4255;
    8::299     1e-51  37%  305 aa  Y2591_BRUSI RecName: Full=UPF0176 protein BSUIS_B0091;
    2::233     3e-51  41%  254 aa  Y3122_LEGPC RecName: Full=UPF0176 protein LPC_3122;
    1::296     5e-51  37%  331 aa  Y010_CHLCV RecName: Full=UPF0176 protein CCA_00010;
    2::233     8e-51  41%  254 aa  Y2838_LEGPH RecName: Full=UPF0176 protein lpg2838;
    1::293     1e-50  37%  326 aa  Y010_CHLAB RecName: Full=UPF0176 protein CAB010;
    1::296     2e-50  37%  327 aa  Y680_CHLTA RecName: Full=UPF0176 protein CTA_0680;
    1::296     2e-50  37%  327 aa  Y627_CHLTR RecName: Full=UPF0176 protein CT_627;
    3::307     2e-50  36%  321 aa  Y2780_TERTT RecName: Full=UPF0176 protein TERTU_2780;
    2::233     2e-50  41%  254 aa  Y2750_LEGPL RecName: Full=UPF0176 protein lpl2750;
    1::296     3e-50  36%  328 aa  Y916_CHLMU RecName: Full=UPF0176 protein TC_0916;
    1::296     4e-50  37%  327 aa  Y891_CHLT2 RecName: Full=UPF0176 protein CTL0891;
    1::296     4e-50  37%  327 aa  Y885_CHLTB RecName: Full=UPF0176 protein CTLon_0885;
    1::234     1e-49  39%  305 aa  Y1091_BARBK RecName: Full=UPF0176 protein BARBAKC583_1091;
    7::238     2e-48  38%  309 aa  Y2992_RHILO RecName: Full=UPF0176 protein mll2992;
    6::286     3e-48  37%  328 aa  Y3407_PSYIN RecName: Full=UPF0176 protein Ping_3407;
   13::240     8e-48  40%  309 aa  Y3401_RHILW RecName: Full=UPF0176 protein Rleg2_3401;
    6::306     8e-48  34%  334 aa  Y2130_SHEPC RecName: Full=UPF0176 protein Sputcn32_2130;
    6::306     8e-48  34%  334 aa  Y1881_SHESW RecName: Full=UPF0176 protein Sputw3181_1881;
    1::234     1e-47  38%  304 aa  Y1007_BARQU RecName: Full=UPF0176 protein BQ10070;
    9::235     2e-47  40%  305 aa  Y6152_NOSP7 RecName: Full=UPF0176 protein Npun_F6152;
    4::232     2e-47  40%  323 aa  Y2319_METFK RecName: Full=UPF0176 protein Mfla_2319;
    9::235     2e-47  40%  309 aa  Y384_ANASP RecName: Full=UPF0176 protein all0384;
    6::306     4e-47  34%  334 aa  Y2481_SHEB9 RecName: Full=UPF0176 protein Sbal195_2481;
    6::306     5e-47  34%  334 aa  Y2366_SHEB8 RecName: Full=UPF0176 protein Shew185_2366;
   25::249     7e-47  41%  314 aa  Y771_ACIBY RecName: Full=UPF0176 protein ABAYE0771;
   25::249     7e-47  41%  314 aa  Y768_ACIBS RecName: Full=UPF0176 protein ABSDF0768;
   13::240     9e-47  39%  309 aa  Y4166_RHIL3 RecName: Full=UPF0176 protein RL4166;
    6::306     9e-47  34%  334 aa  Y2378_SHEB5 RecName: Full=UPF0176 protein Sbal_2378;
    9::235     2e-46  39%  305 aa  Y2825_ANAVT RecName: Full=UPF0176 protein Ava_2825;
   40::245     2e-46  41%  315 aa  Y2782_SINMW RecName: Full=UPF0176 protein Smed_2782;
    3::306     3e-46  33%  330 aa  Y2261_SHESA RecName: Full=UPF0176 protein Shewana3_2261;
    6::306     3e-46  34%  334 aa  Y1981_SHEB2 RecName: Full=UPF0176 protein Sbal223_1981;
    6::306     3e-46  32%  327 aa  Y2524_SHEPA RecName: Full=UPF0176 protein Spea_2524;
    1::234     4e-46  37%  304 aa  Y1276_BARHE RecName: Full=UPF0176 protein BH12760;
    1::320     1e-45  32%  324 aa  Y734_CHLPN RecName: Full=UPF0176 protein
   13::240     1e-45  39%  309 aa  Y3638_RHIEC RecName: Full=UPF0176 protein RHE_CH03638;
   49::249     1e-45  42%  314 aa  Y2917_ACIAD RecName: Full=UPF0176 protein ACIAD2917;
   19::245     1e-45  39%  315 aa  Y2887_RHIME RecName: Full=UPF0176 protein R02887;
    3::306     1e-45  33%  330 aa  Y1760_SHESM RecName: Full=UPF0176 protein Shewmr4_1760;
    3::233     1e-45  36%  333 aa  Y2290_SHEON RecName: Full=UPF0176 protein SO_2290;
    9::294     2e-45  35%  320 aa  Y378_PARUW RecName: Full=UPF0176 protein pc0378;
   18::244     2e-45  39%  314 aa  Y2937_RHISN RecName: Full=UPF0176 protein NGR_c29370;
    3::306     2e-45  33%  333 aa  Y1838_SHESR RecName: Full=UPF0176 protein Shewmr7_1838;
    6::235     3e-45  35%  326 aa  Y2660_SHESH RecName: Full=UPF0176 protein Ssed_2660;
    4::301     4e-45  35%  309 aa  Y1312_SACD2 RecName: Full=UPF0176 protein Sde_1312;
    2::232     5e-45  35%  298 aa  Y1496_SYNP2 RecName: Full=UPF0176 protein SYNPCC7002_A1496;
    9::232     5e-45  38%  310 aa  Y1075_ACAM1 RecName: Full=UPF0176 protein AM1_1075;
    8::268     8e-45  37%  296 aa  Y584_ROSDO RecName: Full=UPF0176 protein RD1_0584;
   31::268     8e-45  40%  301 aa  Y091_SILPO RecName: Full=UPF0176 protein SPO0091;
    6::233     1e-44  36%  326 aa  Y6657_VIBHB RecName: Full=UPF0176 protein VIBHAR_06657;
    6::233     2e-44  36%  326 aa  Y5597_VIBPA RecName: Full=UPF0176 protein VPA1597;
    6::306     2e-44  32%  326 aa  Y1781_SHELP RecName: Full=UPF0176 protein Shew_1781;
    4::270     3e-44  37%  329 aa  Y789_FRATN RecName: Full=UPF0176 protein FTN_0789;
   21::256     3e-44  35%  352 aa  Y370_PSYA2 RecName: Full=UPF0176 protein Psyc_0370;
    6::233     3e-44  35%  327 aa  Y1885_SHEPW RecName: Full=UPF0176 protein swp_1885;
    1::233     4e-44  37%  247 aa  Y960_RICRS RecName: Full=UPF0176 protein A1G_00960;
   41::321     4e-44  34%  367 aa  Y674_LEPBL RecName: Full=UPF0176 protein LBL_0674;
   10::233     4e-44  38%  331 aa  Y522_HAHCH RecName: Full=UPF0176 protein HCH_00522;
   21::256     4e-44  35%  352 aa  Y411_PSYCK RecName: Full=UPF0176 protein Pcryo_0411;
    1::233     4e-44  37%  247 aa  Y4030_RICPU RecName: Full=UPF0176 protein RPR_04030;
   41::321     4e-44  34%  367 aa  Y2438_LEPBJ RecName: Full=UPF0176 protein LBJ_2438;
    1::233     4e-44  37%  247 aa  Y208_RICRO RecName: Full=UPF0176 protein RrIowa_0208;
    5::230     5e-44  39%  281 aa  Y716_WOLPP RecName: Full=UPF0176 protein WP0716;
    1::233     5e-44  38%  312 aa  Y3658_PSEU2 RecName: Full=UPF0176 protein Psyr_3658;
    6::233     5e-44  35%  332 aa  Y1973_SHEWM RecName: Full=UPF0176 protein Swoo_1973;
    1::233     5e-44  37%  247 aa  Y175_RICM5 RecName: Full=UPF0176 protein RMA_0175;
   10::238     5e-44  38%  317 aa  Y1734_PSESM RecName: Full=UPF0176 protein PSPTO_1734;
    8::274     5e-44  37%  332 aa  Y1391_FRATW RecName: Full=UPF0176 protein FTW_1391;
    4::270     5e-44  37%  328 aa  Y1229_FRATM RecName: Full=UPF0176 protein FTM_1229;
    8::274     5e-44  37%  332 aa  Y1178_FRATF RecName: Full=UPF0176 protein FTA_1178;
    4::270     5e-44  37%  328 aa  Y1118_FRATH RecName: Full=UPF0176 protein FTL_1118;
    4::270     5e-44  37%  328 aa  Y1091_FRATO RecName: Full=UPF0176 protein FTH_1091;
    8::274     5e-44  37%  332 aa  Y1085_FRATT RecName: Full=UPF0176 protein FTT1085;
    8::274     5e-44  37%  332 aa  Y1085_FRAT1 RecName: Full=UPF0176 protein FTF1085;
    1::233     7e-44  38%  312 aa  Y3678_PSE14 RecName: Full=UPF0176 protein PSPPH_3678;
    5::276     9e-44  35%  293 aa  Y2744_RENSM RecName: Full=UPF0176 protein RSal33209_2744;
    6::232     9e-44  40%  311 aa  Y1677_MARMM RecName: Full=UPF0176 protein Mmar10_1677;
   33::266     1e-43  38%  331 aa  Y2535_MARMS RecName: Full=UPF0176 protein Mmwyl1_2535;
    6::233     2e-43  36%  329 aa  Y4604_VIBSL RecName: Full=UPF0176 protein VS_II1404;
   10::243     2e-43  37%  277 aa  Y315_ANAMM RecName: Full=UPF0176 protein AM315;
   10::243     2e-43  37%  277 aa  Y234_ANAMF RecName: Full=UPF0176 protein AMF_234;
    6::235     2e-43  34%  326 aa  Y2100_SHEDO RecName: Full=UPF0176 protein Sden_2100;
    5::236     2e-43  38%  275 aa  Y1135_WOLPM RecName: Full=UPF0176 protein WD_1135;
   17::301     3e-43  36%  341 aa  Y4798_COLP3 RecName: Full=UPF0176 protein CPS_4798;
   10::285     3e-43  36%  309 aa  Y240_CORJK RecName: Full=UPF0176 protein jk0240;
    1::233     3e-43  37%  247 aa  Y167_RICCN RecName: Full=UPF0176 protein RC0167;
  169::459     3e-43  38%  495 aa  CI097_MOUSE RecName: Full=Uncharacterized protein C9orf97 homolog;
    1::233     5e-43  37%  313 aa  Y4090_PSEPF RecName: Full=UPF0176 protein Pfl01_4090;
    4::270     5e-43  37%  330 aa  Y1846_FRAP2 RecName: Full=UPF0176 protein Fphi_1841;
    1::233     5e-43  36%  247 aa  Y156_RICAE RecName: Full=UPF0176 protein RAF_ORF0156;
   16::280     5e-43  35%  335 aa  Y1433_PSEHT RecName: Full=UPF0176 protein PSHAa1433;
    1::233     8e-43  37%  310 aa  Y1758_PSEPK RecName: Full=UPF0176 protein PP_1758;
    1::233     1e-42  37%  310 aa  Y1365_PSEPW RecName: Full=UPF0176 protein PputW619_1365;
    3::243     1e-42  36%  279 aa  Y962_ANAPZ RecName: Full=UPF0176 protein APH_0962;
   34::263     1e-42  38%  323 aa  Y8368_RHOBA RecName: Full=UPF0176 protein RB8368;
    6::232     2e-42  35%  327 aa  Y1259_VIBCH RecName: Full=UPF0176 protein VC_1259;
    1::233     2e-42  37%  247 aa  Y925_RICAH RecName: Full=UPF0176 protein A1C_00925;
   15::244     2e-42  36%  314 aa  Y4491_AGRT5 RecName: Full=UPF0176 protein Atu4491;
    1::233     2e-42  37%  310 aa  Y3956_PSEP1 RecName: Full=UPF0176 protein Pput_3956;
    1::233     3e-42  37%  310 aa  Y1477_PSEE4 RecName: Full=UPF0176 protein PSEEN1477;
   31::231     4e-42  39%  278 aa  Y765_SYNY3 RecName: Full=UPF0176 protein sll0765;
    1::233     4e-42  37%  313 aa  Y4311_PSEFS RecName: Full=UPF0176 protein PFLU4311;
    1::233     7e-42  37%  313 aa  Y4325_PSEF5 RecName: Full=UPF0176 protein PFL_4325;
    5::305     7e-42  34%  312 aa  Y2830_COREF RecName: Full=UPF0176 protein CE2830;
    9::285     7e-42  34%  297 aa  Y1760_CORU7 RecName: Full=UPF0176 protein cu1760;
    5::230     7e-42  38%  269 aa  Y038_WOLTR RecName: Full=UPF0176 protein Wbm0038;
    5::237     9e-42  38%  309 aa  Y2448_CORA7 RecName: Full=UPF0176 protein cauri_2448;
    5::238     1e-41  39%  315 aa  Y1113_CAUCN RecName: Full=UPF0176 protein CCNA_01113;
    5::238     1e-41  39%  315 aa  Y1060_CAUCR RecName: Full=UPF0176 protein CC_1060;
    6::240     2e-41  39%  281 aa  Y255_NEOSM RecName: Full=UPF0176 protein NSE_0255;
    1::233     2e-41  36%  247 aa  Y114_RICTY RecName: Full=UPF0176 protein RT0114;
    8::240     3e-41  37%  313 aa  Y895_GLUOX RecName: Full=UPF0176 protein GOX0895;
    1::234     3e-41  35%  249 aa  Y635_RICCK RecName: Full=UPF0176 protein A1E_00635;
    5::281     3e-41  35%  297 aa  Y3365_ARTS2 RecName: Full=UPF0176 protein Arth_3365;
    1::233     3e-41  36%  248 aa  Y1435_RICB8 RecName: Full=UPF0176 protein A1I_01435;
    6::233     3e-41  35%  255 aa  Y1241_PHOPR RecName: Full=UPF0176 protein PBPRA1241;
    6::233     4e-41  35%  326 aa  Y3316_ALISL RecName: Full=UPF0176 protein VSAL_II0216;
    5::266     4e-41  35%  312 aa  Y2992_CORGL RecName: Full=UPF0176 protein Cgl2992/cg3319;
    1::233     4e-41  36%  310 aa  Y1349_PSEPG RecName: Full=UPF0176 protein PputGB1_1349;
  170::460     6e-41  36%  516 aa  CI097_PONAB RecName: Full=Uncharacterized protein C9orf97 homolog;
    5::266     7e-41  35%  312 aa  Y2881_CORGB RecName: Full=UPF0176 protein cgR_2881;
   43::237     7e-41  42%  300 aa  Y1100_DEIRA RecName: Full=UPF0176 protein DR_1100;
  170::460     1e-40  36%  516 aa  CI097_HUMAN RecName: Full=Uncharacterized protein C9orf97;
    5::297     2e-40  34%  312 aa  Y2301_CORDI RecName: Full=UPF0176 protein DIP2301;
   33::232     3e-40  39%  312 aa  Y4661_PSEA7 RecName: Full=UPF0176 protein PSPA7_4661;
   33::232     4e-40  39%  312 aa  Y858_PSEAE RecName: Full=UPF0176 protein PA0858;
   33::232     4e-40  39%  312 aa  Y4460_PSEA8 RecName: Full=UPF0176 protein PLES_44601;
    1::233     4e-40  35%  247 aa  Y125_RICPR RecName: Full=UPF0176 protein RP125;
    1::232     4e-40  36%  247 aa  Y1169_RICBR RecName: Full=UPF0176 protein RBE_1169;
   33::232     5e-40  39%  312 aa  Y5318_PSEAB RecName: Full=UPF0176 protein PA14_53180;
   32::230     5e-40  38%  307 aa  Y2351_IDILO RecName: Full=UPF0176 protein IL2351;
   44::247     2e-39  36%  319 aa  Y654_PROMT RecName: Full=UPF0176 protein PMN2A_0654;
    4::229     4e-39  35%  301 aa  Y011_JANSC RecName: Full=UPF0176 protein Jann_0011;
    1::233     7e-39  35%  312 aa  Y1693_PSEMY RecName: Full=UPF0176 protein Pmen_1693;
   44::247     7e-39  37%  319 aa  Y1486_PROM1 RecName: Full=UPF0176 protein NATL1_14861;
    5::272     9e-39  33%  297 aa  Y3153_ARTCA RecName: Full=UPF0176 protein Achl_3153;
    9::236     1e-38  36%  319 aa  Y1961_RHOFD RecName: Full=UPF0176 protein Rfer_1961;
    5::277     3e-38  34%  296 aa  Y794_KOCRD RecName: Full=UPF0176 protein KRH_07940;
    4::244     6e-38  36%  305 aa  Y1395_SYNS9 RecName: Full=UPF0176 protein Syncc9902_1395;
    8::232     8e-38  35%  269 aa  Y2203_SYNP6 RecName: Full=UPF0176 protein syc2203_c;
    8::232     8e-38  35%  269 aa  Y1892_SYNE7 RecName: Full=UPF0176 protein Synpcc7942_1892;
   10::256     2e-37  35%  327 aa  Y1635_SYNSC RecName: Full=UPF0176 protein Syncc9605_1635;
    5::234     2e-37  34%  275 aa  Y896_EHRCR RecName: Full=UPF0176 protein ECH_0896;
   41::321     3e-37  32%  367 aa  Y976_LEPIC RecName: Full=UPF0176 protein LIC_10976;
   41::321     3e-37  32%  367 aa  Y3128_LEPIN RecName: Full=UPF0176 protein LA_3128;
    2::234     3e-37  34%  255 aa  Y2998_NITWN RecName: Full=UPF0176 protein Nwi_2998;
   13::249     3e-37  37%  321 aa  Y1101_PROMA RecName: Full=UPF0176 protein Pro_1101;
   29::308     6e-37  32%  355 aa  Y2579_YERPB RecName: Full=UPF0176 protein YPTS_2579;
   29::308     6e-37  32%  355 aa  Y2488_YERPS RecName: Full=UPF0176 protein YPTB2488;
   29::308     6e-37  32%  355 aa  Y2451_YERPE RecName: Full=UPF0176 protein YPO2451/y1738/YP_2271;
   29::308     6e-37  32%  355 aa  Y2048_YERPN RecName: Full=UPF0176 protein YPN_2048;
   29::308     6e-37  32%  355 aa  Y1866_YERPP RecName: Full=UPF0176 protein YPDSF_1866;
   29::308     6e-37  32%  355 aa  Y1668_YERPY RecName: Full=UPF0176 protein YPK_1668;
   29::308     6e-37  32%  355 aa  Y1560_YERP3 RecName: Full=UPF0176 protein YpsIP31758_1560;
   25::307     8e-37  32%  349 aa  Y1569_ENT38 RecName: Full=UPF0176 protein Ent638_1569;
    5::263     1e-36  36%  286 aa  Y3187_RHOE4 RecName: Full=UPF0176 protein RER_31870;
    5::237     1e-36  33%  274 aa  Y206_EHRCJ RecName: Full=UPF0176 protein Ecaj_0206;
   29::312     2e-36  31%  352 aa  Y1816_PHOLL RecName: Full=UPF0176 protein plu1816;
    2::252     2e-36  33%  255 aa  Y1078_NITHX RecName: Full=UPF0176 protein Nham_1078;
   29::307     4e-36  31%  350 aa  YCEA_SALNS RecName: Full=UPF0176 protein yceA;
    5::263     5e-36  34%  285 aa  Y857_RHOSR RecName: Full=UPF0176 protein RHA1_ro00857;
   29::307     5e-36  34%  350 aa  Y2059_ERWT9 RecName: Full=UPF0176 protein ETA_20590;
    9::241     7e-36  35%  310 aa  Y1185_PROM5 RecName: Full=UPF0176 protein P9515_11851;
   11::249     9e-36  35%  321 aa  Y932_SYNPX RecName: Full=UPF0176 protein SYNW0932;
   29::308     9e-36  32%  350 aa  Y1619_YERE8 RecName: Full=UPF0176 protein YE1619;
   29::307     1e-35  31%  350 aa  YCEA_ESCF3 RecName: Full=UPF0176 protein yceA;
    5::263     1e-35  34%  285 aa  Y595_RHOOB RecName: Full=UPF0176 protein ROP_05950;
   29::307     2e-35  31%  350 aa  YCEA_SALAR RecName: Full=UPF0176 protein yceA;
    9::316     2e-35  33%  350 aa  Y2131_BDEBA RecName: Full=UPF0176 protein Bd2131;
    9::241     2e-35  34%  310 aa  Y1094_PROMP RecName: Full=UPF0176 protein PMM1094;
   29::307     2e-35  31%  350 aa  YCEA_SALPB RecName: Full=UPF0176 protein yceA;
   29::307     3e-35  31%  350 aa  YCEA_SALPK RecName: Full=UPF0176 protein yceA;
   29::307     3e-35  31%  350 aa  YCEA_SALPA RecName: Full=UPF0176 protein yceA;
   29::307     3e-35  31%  350 aa  YCEA_SALEP RecName: Full=UPF0176 protein yceA;
   29::307     3e-35  31%  350 aa  YCEA_SALDC RecName: Full=UPF0176 protein yceA;
   29::307     3e-35  31%  350 aa  YCEA_SALA4 RecName: Full=UPF0176 protein yceA;
    5::233     3e-35  34%  272 aa  Y201_EHRRG RecName: Full=UPF0176 protein ERGA_CDS_02010;
   29::308     3e-35  34%  356 aa  Y1886_SERP5 RecName: Full=UPF0176 protein Spro_1886;
   29::307     3e-35  31%  350 aa  YCEA_SALSV RecName: Full=UPF0176 protein yceA;
   29::307     3e-35  31%  350 aa  YCEA_SALG2 RecName: Full=UPF0176 protein yceA;
   51::307     5e-35  33%  350 aa  YCEA_ECOSM RecName: Full=UPF0176 protein yceA;
    9::240     5e-35  34%  255 aa  Y2403_BRAJA RecName: Full=UPF0176 protein bll2403;
    5::278     5e-35  31%  296 aa  Y153_CORK4 RecName: Full=UPF0176 protein ckrop_0153;
   45::248     5e-35  37%  310 aa  Y1055_PROMM RecName: Full=UPF0176 protein PMT_1055;
   29::307     6e-35  30%  350 aa  YCEA_SALHS RecName: Full=UPF0176 protein yceA;
   29::307     8e-35  31%  350 aa  YCEA_SHIDS RecName: Full=UPF0176 protein yceA;
   27::319     8e-35  33%  324 aa  Y359_BUCAT RecName: Full=UPF0176 protein BUAPTUC7_359;
   27::319     8e-35  33%  324 aa  Y358_BUCA5 RecName: Full=UPF0176 protein BUAP5A_358;
   51::307     1e-34  32%  350 aa  YCEA_SHISS RecName: Full=UPF0176 protein yceA;
   51::307     1e-34  32%  350 aa  YCEA_SHIFL RecName: Full=UPF0176 protein yceA;
   51::307     1e-34  32%  350 aa  YCEA_SHIF8 RecName: Full=UPF0176 protein yceA;
   51::307     1e-34  32%  350 aa  YCEA_ECOLI RecName: Full=UPF0176 protein yceA;AltName:
   51::307     1e-34  32%  350 aa  YCEA_ECODH RecName: Full=UPF0176 protein yceA;
   51::307     1e-34  32%  350 aa  YCEA_ECOBW RecName: Full=UPF0176 protein yceA;
   51::307     1e-34  32%  350 aa  YCEA_ECO8A RecName: Full=UPF0176 protein yceA;
   51::307     1e-34  32%  350 aa  YCEA_ECO7I RecName: Full=UPF0176 protein yceA;
   51::307     1e-34  32%  350 aa  YCEA_ECO55 RecName: Full=UPF0176 protein yceA;
   56::307     1e-34  33%  350 aa  YCEA_ECO27 RecName: Full=UPF0176 protein yceA;
   51::307     1e-34  32%  350 aa  YCEA_ECO24 RecName: Full=UPF0176 protein yceA;
   45::248     1e-34  37%  310 aa  Y997_PROM3 RecName: Full=UPF0176 protein P9303_09971;
    8::244     1e-34  36%  253 aa  Y2095_XANC8 RecName: Full=UPF0176 protein XC_2095;
    8::244     1e-34  36%  253 aa  Y2086_XANCP RecName: Full=UPF0176 protein XCC2086;
   51::307     1e-34  32%  350 aa  YCEA_ECOSE RecName: Full=UPF0176 protein yceA;
   56::307     1e-34  33%  350 aa  YCEA_ECOLU RecName: Full=UPF0176 protein yceA;
   51::307     1e-34  32%  350 aa  YCEA_ECOL6 RecName: Full=UPF0176 protein yceA;
   51::307     1e-34  32%  350 aa  YCEA_ECOL5 RecName: Full=UPF0176 protein yceA;
   51::307     1e-34  32%  350 aa  YCEA_ECOK1 RecName: Full=UPF0176 protein yceA;
   51::307     1e-34  32%  350 aa  YCEA_ECO45 RecName: Full=UPF0176 protein yceA;
   56::307     1e-34  33%  354 aa  Y3487_KLEP3 RecName: Full=UPF0176 protein KPK_3487;
   29::306     1e-34  30%  312 aa  Y330_BUCBP RecName: Full=UPF0176 protein bbp_330;
    5::233     1e-34  34%  272 aa  Y204_EHRRW RecName: Full=UPF0176 protein Erum2040/ERWE_CDS_02060;
   51::307     2e-34  32%  350 aa  YCEA_ECO81 RecName: Full=UPF0176 protein yceA;
    8::235     2e-34  37%  253 aa  Y2387_XANCB RecName: Full=UPF0176 protein xcc-b100_2387;
   29::307     3e-34  30%  350 aa  YCEA_SALCH RecName: Full=UPF0176 protein yceA;
   27::306     3e-34  33%  324 aa  Y365_BUCAI RecName: Full=UPF0176 protein BU365;
   29::308     3e-34  32%  355 aa  Y1781_ERWCT RecName: Full=UPF0176 protein ECA1781;
   29::307     4e-34  30%  350 aa  YCEA_SALTY RecName: Full=UPF0176 protein yceA;
   29::307     4e-34  30%  350 aa  YCEA_SALTI RecName: Full=UPF0176 protein yceA;
   29::308     4e-34  32%  351 aa  Y1048_SODGM RecName: Full=UPF0176 protein SG1048;
   29::307     5e-34  31%  355 aa  Y2519_PECCP RecName: Full=UPF0176 protein PC1_2519;
   25::308     7e-34  32%  355 aa  Y081_HAMD5 RecName: Full=UPF0176 protein HDEF_0081;
   29::286     1e-33  31%  350 aa  Y2011_CITK8 RecName: Full=UPF0176 protein CKO_02011;
   51::307     1e-33  33%  350 aa  YCEA_ECOLC RecName: Full=UPF0176 protein yceA;
   51::307     1e-33  33%  350 aa  YCEA_ECOHS RecName: Full=UPF0176 protein yceA;
   51::307     2e-33  33%  350 aa  YCEA_ECO5E RecName: Full=UPF0176 protein yceA;
   51::307     2e-33  33%  350 aa  YCEA_ECO57 RecName: Full=UPF0176 protein yceA;
   38::241     2e-33  34%  310 aa  Y1201_PROM0 RecName: Full=UPF0176 protein P9301_12011;
    4::241     6e-33  32%  310 aa  Y1105_PROM9 RecName: Full=UPF0176 protein PMT9312_1105;
    8::235     1e-32  36%  253 aa  Y2930_XANOM RecName: Full=UPF0176 protein XOO2930;
   51::308     1e-32  31%  349 aa  Y2292_ENTS8 RecName: Full=UPF0176 protein ESA_02292;
    8::235     1e-32  36%  253 aa  Y1514_XANOP RecName: Full=UPF0176 protein PXO_01514;
   38::241     1e-32  32%  310 aa  Y1230_PROM2 RecName: Full=UPF0176 protein P9215_12301;
    3::236     3e-32  37%  263 aa  Y4043_DELAS RecName: Full=UPF0176 protein Daci_4043;
   27::311     4e-32  32%  312 aa  Y353_BUCAP RecName: Full=UPF0176 protein BUsg_353;
   38::241     5e-32  33%  310 aa  Y1200_PROMS RecName: Full=UPF0176 protein A9601_12001;
    8::242     6e-32  35%  248 aa  Y2109_XANAC RecName: Full=UPF0176 protein XAC2109;
    9::238     2e-31  38%  282 aa  Y899_RALEH RecName: Full=UPF0176 protein H16_A0899;
   32::227     9e-31  33%  301 aa  Y1074_PELUB RecName: Full=UPF0176 protein SAR11_1074;
   21::315     3e-30  28%  315 aa  Y065_WIGBR RecName: Full=UPF0176 protein WIGBR0650;
   10::237     4e-30  34%  244 aa  Y839_BORBR RecName: Full=UPF0176 protein BB0839;
   10::237     4e-30  34%  244 aa  Y179_BORPE RecName: Full=UPF0176 protein BP0179;
   10::232     8e-30  34%  239 aa  Y754_BORPA RecName: Full=UPF0176 protein BPP0754;
    9::238     1e-29  37%  282 aa  Y753_RALME RecName: Full=UPF0176 protein Rmet_0753;
    6::240     2e-29  38%  284 aa  Y2353_BURCM RecName: Full=UPF0176 protein Bamb_2353;
    6::240     2e-29  38%  284 aa  Y2233_BURA4 RecName: Full=UPF0176 protein BamMC406_2233;
    9::236     2e-29  36%  282 aa  Y810_CUPTR RecName: Full=UPF0176 protein RALTA_A0810;
   29::314     3e-29  29%  324 aa  Y454_BAUCH RecName: Full=UPF0176 protein BCI_0454;
    6::240     4e-29  38%  299 aa  Y3126_BURM9 RecName: Full=UPF0176 protein BMA10229_A0826;
    6::240     4e-29  38%  299 aa  Y2842_BURMS RecName: Full=UPF0176 protein BMASAVP1_A1042;
    6::240     4e-29  38%  299 aa  Y2825_BURM7 RecName: Full=UPF0176 protein BMA10247_0325;
    9::238     4e-29  35%  282 aa  Y2535_RALEJ RecName: Full=UPF0176 protein Reut_A2535;
    6::240     4e-29  38%  299 aa  Y1914_BURMA RecName: Full=UPF0176 protein BMA1914;
    6::240     4e-29  38%  299 aa  Y1354_BURP1 RecName: Full=UPF0176 protein BURPS1710b_1354;
    6::240     4e-29  38%  299 aa  Y1204_BURP0 RecName: Full=UPF0176 protein BURPS1106A_1204;
    6::240     4e-29  38%  299 aa  Y1196_BURP6 RecName: Full=UPF0176 protein BURPS668_1196;
    6::240     4e-29  36%  299 aa  Y1116_BURPS RecName: Full=UPF0176 protein BPSL1116;
    9::236     1e-28  36%  282 aa  Y2206_RALSO RecName: Full=UPF0176 protein RSc2206;
    6::240     2e-28  36%  284 aa  Y2370_BURCJ RecName: Full=UPF0176 protein BceJ2315_23700;
    6::240     2e-28  38%  284 aa  Y2337_BURCC RecName: Full=UPF0176 protein Bcenmc03_2337;
    6::240     2e-28  38%  284 aa  Y2314_BURCH RecName: Full=UPF0176 protein Bcen2424_2314;
   10::234     3e-28  33%  252 aa  Y4097_BORPD RecName: Full=UPF0176 protein Bpet4097;
    6::240     4e-28  38%  296 aa  Y983_BURTA RecName: Full=UPF0176 protein BTH_I0983;
    6::240     7e-28  38%  284 aa  Y2403_BURVG RecName: Full=UPF0176 protein Bcep1808_2403;
    6::240     1e-27  36%  284 aa  Y5656_BURS3 RecName: Full=UPF0176 protein Bcep18194_A5656;
    9::240     2e-27  36%  287 aa  Y1252_BURPP RecName: Full=UPF0176 protein Bphyt_1252;
   30::236     4e-27  36%  242 aa  Y471_BORA1 RecName: Full=UPF0176 protein BAV0471;
    9::240     5e-27  35%  287 aa  Y1152_BURXL RecName: Full=UPF0176 protein Bxeno_A1152;
    9::235     1e-26  36%  248 aa  Y683_THIDA RecName: Full=UPF0176 protein Tbd_0683;
    8::235     3e-25  32%  248 aa  Y2421_XANC5 RecName: Full=UPF0176 protein XCV2421;
    9::236     3e-25  33%  257 aa  Y2090_XYLF2 RecName: Full=UPF0176 protein XfasM23_2090;
    9::236     3e-25  33%  257 aa  Y1985_XYLFT RecName: Full=UPF0176 protein PD_1985;
    9::236     7e-25  33%  257 aa  Y2609_XYLFA RecName: Full=UPF0176 protein XF_2609;
    2::231     1e-24  33%  263 aa  Y3119_VARPS RecName: Full=UPF0176 protein Vapar_3119;
    5::106     2e-06  27%  106 aa  GLPE_PSEA6 RecName: Full=Thiosulfate sulfurtransferase glpE;       
    6::95      2e-06  30%  107 aa  GLPE_COXBU RecName: Full=Thiosulfate sulfurtransferase glpE;       
    6::95      2e-06  30%  107 aa  GLPE_COXBR RecName: Full=Thiosulfate sulfurtransferase glpE;       
    6::95      2e-06  30%  107 aa  GLPE_COXB2 RecName: Full=Thiosulfate sulfurtransferase glpE;       
    6::95      2e-06  30%  107 aa  GLPE_COXB1 RecName: Full=Thiosulfate sulfurtransferase glpE;       
    8::91      3e-06  32%  109 aa  GLPE_PSEFS RecName: Full=Thiosulfate sulfurtransferase glpE;       
   14::95      8e-06  30%  105 aa  GLPE_PSEHT RecName: Full=Thiosulfate sulfurtransferase glpE;       
    8::91      3e-05  30%  109 aa  GLPE_PSEF5 RecName: Full=Thiosulfate sulfurtransferase glpE;       
    8::91      5e-05  26%  106 aa  GLPE_PSEU2 RecName: Full=Thiosulfate sulfurtransferase glpE;       
    8::106     1e-04  29%  106 aa  GLPE_PSE14 RecName: Full=Thiosulfate sulfurtransferase glpE;       
  142::285     1e-04  30%  315 aa  CALU_XENLA RecName: Full=Calumenin;Flags: Precursor;
   52::143     2e-04  31%  143 aa  YIBN_ECOLI RecName: Full=Uncharacterized protein yibN;
   52::143     2e-04  31%  143 aa  YIBN_ECOL6 RecName: Full=Uncharacterized protein yibN;
   52::143     2e-04  31%  143 aa  YIBN_ECO57 RecName: Full=Uncharacterized protein yibN;
    7::99      2e-04  25%  107 aa  GLPE_PASMU RecName: Full=Thiosulfate sulfurtransferase glpE;       
    6::96      2e-04  24%  101 aa  GLPE_SHEON RecName: Full=Thiosulfate sulfurtransferase glpE;       
  326::389     5e-04  42%  399 aa  Y1743_ERWT9 RecName: Full=Putative reductase ETA_17430;       
    8::104     5e-04  27%  109 aa  GLPE_PSEU5 RecName: Full=Thiosulfate sulfurtransferase glpE;       
    8::91      5e-04  30%  109 aa  GLPE_PSEPW RecName: Full=Thiosulfate sulfurtransferase glpE;       
    6::90      7e-04  24%  105 aa  GLPE_HAEIN RecName: Full=Thiosulfate sulfurtransferase glpE;       
    6::90      7e-04  24%  105 aa  GLPE_HAEIG RecName: Full=Thiosulfate sulfurtransferase glpE;       
    6::90      7e-04  24%  105 aa  GLPE_HAEI8 RecName: Full=Thiosulfate sulfurtransferase glpE;       
   73::159     0.001  29%  171 aa  YAY7_SCHPO RecName: Full=Uncharacterized protein C4H3.07c;
    1::328

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MAKDIRVLLYYLYTPIENAEQFAADHLAFCKSIGLKGRILVADEGINGTVSGDYETTQKYMDYVHSLPGM
Y154_STRZP      MAKDIRVLLYYLYTPIENAEQFAADHLAFCKSIGLKGRILVADEGINGTVSGDYETTQKYMDYVHSLPGM
Y092_STRP4      MAKDIRVLLYYLYTPIENAEQFAADHLAFCKSIGLKGRILVADEGINGTVSGDYETTQKYMDYVHSLPGM
Y125_STRZT      MAKDIRVLLYYLYTPIENAEQFAADHLAFCKSIGLKGRILVADEGINGTVSGDYETTQKYMDYVHSLPGM
Y118_STRZJ      MAKDIRVLLYYLYTPIENAEQFAADHLAFCKSIGLKGRILVADEGINGTVSGDYETTQKYMDYVHSLPGM
Y105_STRPJ      MAKDIRVLLYYLYTPIENAEQFAADHLAFCKSIGLKGRILVADEGINGTVSGDYETTQKYMDYVHSLPGM
Y095_STRPN      MAKDIRVLLYYLYTPIENAEQFAADHLAFCKSIGLKGRILVADEGINGTVSGDYETTQKYMDYVHSLPGM
Y091_STRP2      MAKDIRVLLYYLYTPIENAEQFAADHLAFCKSIGLKGRILVADEGINGTVSGDYETTQKYMDYVHSLPGM
Y090_STRPS      MAKDIRVLLYYLYTPIENAEQFAADHLAFCKSIGLKGRILVADEGINGTVSGDYETTQKYMDYVHSLPGM
Y084_STRR6      MAKDIRVLLYYLYTPIENAEQFAADHLAFCKSIGLKGRILVADEGINGTVSGDYETTQKYMDYVHSLPGM
Y194_STRPI      MAKDIRVLLYYLYTPIENAEQFAADHLAFCKSIGLKGRILVADEGINGTVSGDYETTQKYMDYVHSLPGM
Y154_STRP7      MAKDIRVLLYYLYTPIENAEQFAADHLAFCKSIGLKGRILVADEGINGTVSGDYETTQKYMDYVHSLPGM
Y593_STRSV      MAKDIRVLLYYKYVPIENAEKFAADHLAFCKSIGLKGRILVADEGINGTVSGDYETTQKYMDYVHSLPGM
Y476_STRGC      MAKDIRVLLYYKYVPIENAEKFAADHLAFCKSIGLKGRILVADEGINGTVSGDYETTQKYMDYVHSLPGM
Y548_STRT1      MAKPIRVLLYYKYVPIENAEQFAADHLAFCKSIGLKGRILVADEGINGTVSGDYETTQKYMDYVHSLPGM
Y548_STRT2      MAKPIRVLLYYKYVPIENAEQFAADHLAFCKSIGLKGRILVADEGINGTVSGEYETTQKYMDYVHSLPGM
Y588_STRTD      MAKPIRVLLYYKYVPIENAEQFAADHLAFCKSIGLKGRILVADEGINGTVSGDYETTQKYMDYVHSLPGM
Y406_STRSY      MSKDIRVLLYYKYVPIENAKEYAAEHLAFCKSIGLKGRILIADEGINGTVSGDYETTQKYMDYVHANPLF
Y392_STRS2      MSKDIRVLLYYKYVPIENAKEYAAEHLAFCKSIGLKGRILIADEGINGTVSGDYETTQKYMDYVHANPLF
Y1504_STRA3     MSEKIRVLLYYKYVSIENAEEYAAKHLEFCKSIGLKGRILIADEGINGTVSGDYETTQKYMDWVHSDERF
Y1469_STRA1     MSEKIRVLLYYKYVSIENAEEYAAKHLEFCKSIGLKGRILIADEGINGTVSGDYETTQKYMDWVHSDERF
Y1434_STRA5     MSEKIRVLLYYKYVSIENAEEYAAKHLEFCKSIGLKGRILIADEGINGTVSGDYETTQKYMDWVHSDERF
Y630_STRP3      MSEKIRVLLYYKYVSIENAQEYAAKHLEFCKSIGLKGRILIADEGINGTVSGDYETTQKYMDWVHSDERF
Y973_STRP8      MSEKIRVLLYYKYVSIENAQEYAAKHLEFCKSIGLKGRILIADEGINGTVSGDYETTQKYMDWVHSDERF
Y915_STRP1      MSEKIRVLLYYKYVSIENAQEYAAKHLEFCKSIGLKGRILIADEGINGTVSGDYETTQKYMDWVHSDERF
Y811_STRPF      MSEKIRVLLYYKYVSIENAQEYAAKHLEFCKSIGLKGRILIADEGINGTVSGDYETTQKYMDWVHSDERF
Y743_STRP6      MSEKIRVLLYYKYVSIENAQEYAAKHLEFCKSIGLKGRILIADEGINGTVSGDYETTQKYMDWVHSDERF
Y726_STRPZ      MSEKIRVLLYYKYVSIENAQEYAAKHLEFCKSIGLKGRILIADEGINGTVSGDYETTQKYMDWVHSDERF
Y1090_STRPG     MSEKIRVLLYYKYVSIENAQEYAAKHLEFCKSIGLKGRILIADEGINGTVSGDYETTQKYMDWVHSDERF
Y776_STRPD      MSEKIRVLLYYKYVSIENAQEYAAKHLEFCKSIGLKGRILIADEGINGTVSGDYETTQKYMDWVHSDERF
Y789_STRPB      MSEKIRVLLYYKYVSIENAQEYAAKHLEFCKSIGLKGRILIADEGINGTVSGDYETTQKYMDWVHSDERF
Y773_STRPC      MSEKIRVLLYYKYVSIENAQEYAAKHLEFCKSIGLKGRILIADEGINGTVSGDYETTQKYMDWVHSDERF
Y697_STRPM      MSEKIRVLLYYKYVSIENAQEYAAKHLEFCKSIGLKGRILIADEGINGTVSGDYETTQKYMDWVHSDERF
Y1138_STRU0     MSEKIRVLLYYKYVPIEDAQAYAAKHLEFCKSIGLKGRIIIADEGINGTVSGDYETTQKYMDWVHSDERF
YMDE_LACLA      MTQDYRVLLYYQYVPIEDGETFAQKHLADCKELGLKGRILVADEGINGTVSGTIEQTNAYMELMKNDPRF
Y1287_LACLM     MTQDYRVLLYYQYVPIEDGESFAQKHLSDCKALGLKGRILVADEGINGTVSGTVEQTNAYMSLMKNDSRF
Y1324_LACLS     MTQDYRVLLYYQYVPIEDGESFAQKHLSDCKALGLKGRILVADEGINGTVSGTVEQTNAYMSLMKNDSRF
Y748_ENTFA      -----QVLLYYKYTTIEDPEAFAKEHLAFCKSLNLKGRILVATEGINGTLSGTVEETEKYMEAMQADERF
Y2654_BACSK     MSKDYRVLLYYYYTTIEDPEGFAKEHLAFCKSLQLKGRVLVAKEGINGTVSGLKEHTDAYMEAMKANPLF
Y3574_BACLD     MKNQYRVLLYYKYVHIDNPEQFAEDHLKFCKDLGLKGRILVAGEGINGTVSGTVEQTDRYMSEMKSDPRF
Y1400_LISW6     ---DYQVLLYYKYTTIDDPETFAKEHLAACKEMELKGRILVASEGINGTVSGTVEATNKYMDYMANDARF
Y1185_LISMH     ---DYQVLLYYKYTTIDDPETFAKEHLAACKEMELKGRILVATEGINGTVSGTVEATNKYMDYMANDARF
Y1403_LISMF     ---DYQVLLYYKYTTIDDPETFAKEHLAACKEMELKGRILVATEGINGTVSGTVEATNKYMDYMANDARF
Y1393_LISMC     ---DYQVLLYYKYTTIDDPETFAKEHLAACKEMELKGRILVATEGINGTVSGTVEATNKYMDYMANDARF
Y1384_LISMO     ---DYQVLLYYKYTTIDDPETFAKEHLAACKEMELKGRILVATEGINGTVSGTVEATNKYMDYMANDARF
Y1421_LISIN     ---DYQVLLYYKYTTIDDPETFAKEHLAACKEMELKGRILVATEGINGTVSGTVEATNKYMDYMANDARF
Y127_STAS1      ---DYRVLLYYKYTTIDDPELFATEHLAFCKDLELKGRILVSTEGINGTVSGTVEATDKYMEALKNDARF
Y1961_BACC1     --KPYRVLLYYMYTTIENPEEFAAEHLAFCNSLELKGRILVAKEGINGTCSGTVEQTEKYMEAMNNDPRF
Y1989_BACC7     --KPYRVLLYYMYTTIENPEEFAAEHLAFCNSLELKGRILVAKEGINGTCSGTVEQTEKYMEAMNNDPRF
Y1948_BACC3     --KPYRVLLYYMYTTIENPEEFAAEHLAFCNSLELKGRILVAKEGINGTCSGTVEQTEKYMEAMNNDPRF
Y1658_BACAH     --KPYRVLLYYMYTTIENPEEFAAEHLAFCNSLELKGRILVAKEGINGTCSGTVEQTEKYMEAMNNDPRF
Y1875_BACCQ     --KPYRVLLYYMYTTIENPEEFAAEHLAFCNSLELKGRILVAKEGINGTCSGTVEQTEKYMEAMNNDPRF
Y3469_BACC2     --KPYRVLLYYMYTTIENPEEFAAEHLEFCNSLELKGRILVAKEGINGTCSGTVEQTEKYMEAMNNDPRF
Y299_STAHJ      ---DYRVLLYYKYTTIDDPETFAAEHLEFCKSNNLKGRILVSTEGINGTLSGTKEDTDKYIEHMHSDERF
Y2712_BACAC     --KPYRVLLYYMYTTIENPEEFAAEHLEFCNSLELKGRILVAKEGINGTCSGTVEQTEKYMEAMNNDPRF
Y1948_BACAA     --KPYRVLLYYMYTTIENPEEFAAEHLEFCNSLELKGRILVAKEGINGTCSGTVEQTEKYMEAMNNDPRF
Y1916_BACC0     --KPYRVLLYYMYTTIENPEEFAAEHLEFCNSLELKGRILVAKEGINGTCSGTVEQTEKYMEAMNNDPRF
Y1881_BACAN     --KPYRVLLYYMYTTIENPEEFAAEHLEFCNSLELKGRILVAKEGINGTCSGTVEQTEKYMEAMNNDPRF
Y1875_BACC4     --KPYRVLLYYMYTTIENPEEFAAEHLEFCNSLELKGRILVAKEGINGTCSGTVEQTEKYMEAMNNDPRF
Y1804_BACCR     --KPYRVLLYYMYTTIENPEEFAAEHLEFCNSLELKGRILVAKEGINGTCSGTVEQTEKYMEAMNNDPRF
Y1719_BACHK     --KPYRVLLYYMYTTIENPEEFAAEHLEFCNSLELKGRILVAKEGINGTCSGTVEQTEKYMEAMNNDPRF
Y1694_BACCZ     --KPYRVLLYYMYTTIENPEEFAAEHLEFCNSLELKGRILVAKEGINGTCSGTVEQTEKYMEAMNNDPRF
Y1736_BACWK     --KPYRVLLYYMYTTIENPEEFAEQHLEFCKSLELKGRILVATEGINGTCSGTVEQTEKYVEAMNNDPRF
Y572_OCEIH      ---------------IDDPEAFAEEHLRYCKEIGLKGRILVANEGINGTVSGTIEQTTAYMDHMHNDERF
Y1464_BACCN     --KPYRVLLYYMYTTIENPEEFAAEHLQFCNSLELKGRILVAKEGINGTASGTTEQTEKYMEAMKNDPRF
Y2770_STAA2     -----QVLLYYKYTTIDDPEQFAQDHLAFCKAHHLKGRILVSTEGINGTLSGTKEETEQYMAHMHADERF
Y2713_STAA9     -----QVLLYYKYTTIDDPEQFAQDHLAFCKAHHLKGRILVSTEGINGTLSGTKEETEQYMAHMHADERF
Y2689_STAAM     -----QVLLYYKYTTIDDPEQFAQDHLAFCKAHHLKGRILVSTEGINGTLSGTKEETEQYMAHMHADERF
Y2673_STAA1     -----QVLLYYKYTTIDDPEQFAQDHLAFCKAHHLKGRILVSTEGINGTLSGTKEETEQYMAHMHADERF
Y2481_STAAN     -----QVLLYYKYTTIDDPEQFAQDHLAFCKAHHLKGRILVSTEGINGTLSGTKEETEQYMAHMHADERF
Y2609_STAAW     -----QVLLYYKYTTIDDPEQFAQDHLAFCKAHHLKGRILVSTEGINGTLSGTKEETEQYMAHMHADERF
Y2575_STAAS     -----QVLLYYKYTTIDDPEQFAQDHLAFCKAHHLKGRILVSTEGINGTLSGTKEETEQYMAHMHADERF
Y3024_STAA8     -----QVLLYYKYMTIDDPEQFAQDHLAFCKAHHLKGRILVSTEGINGTLSGTKEETEQYMAHMHADERF
Y2691_STAAT     -----QVLLYYKYMTIDDPEQFAQDHLAFCKAHHLKGRILVSTEGINGTLSGTKEETEQYMAHMHADERF
Y2622_STAA3     -----QVLLYYKYMTIDDPEQFAQDHLAFCKAHHLKGRILVSTEGINGTLSGTKEETEQYMAHMHADERF
Y2587_STAAE     -----QVLLYYKYMTIDDPEQFAQDHLAFCKAHHLKGRILVSTEGINGTLSGTKEETEQYMAHMHADERF
Y262_STAES      ---DYRVLLYYKYVTIDDPETFAAEHLKFCKEHHLKGRILVSTEGINGTLSGTKEDTDKYIEHMHADNRF
Y1123_ACHLI     MQKNYRVLLYYKYTAIENPEKFKDEHLAYCKSQDLLGRILVSSEGINGTLSGTFEQTENYMDYLKSLQGF
Y2316_STAEQ     ---DYRVLLYYKYVTIDDPETFAAEHLKFCKEHHLKGRILVSTEGINGTLSGTKEDTDKYIEHMHADSRF
Y2713_STAAC     -----QVLLYYKYMTIDDPEQFAQDHLAFCKAHHLKGRILVSTEGINGTLSGTKEETEQYMAHMHADERF
Y2771_STAAR     -----QVLLYYKYTTIDDPEQFAQDHLAFCKAHHLKGRILVSTEGINGTLSGTKEETEQYMAHMHADERF
YBFQ_BACSU      MEKQYRVLLYYKYVPIEDPEAFREQHLAFCKELGLLGRILVSSEGINGTVSGTVEQTEKYMETMKADPRF
Y2565_STAAB     -----QVLLYYKYMTIDDPEQFAQDHLAFCKAHHLKGRILVSTEGINGTLSGTKEETEQYMAHMHADERF
Y2303_STACT     ---DYRVLLYYKYVTIDDPETFAAEHLEFCKENNLKGRILVSTEGINGTLSGTKEDTDQYIAHMRADERF
Y205_BACP2      MEKQYRVLLYYQYVPIEDPETFTAEHLAFCKELGLLGRILISSEGINGTVSGTIEQTDKYMEALKEDPRF
Y274_BACA2      MEKQYRVLLYYKYVKIDEPEEFTAQHLKFCKELGLLGRILISEEGINGTVSGTVEQTEQYMNALKADPRF
Y085_ONYPE      ------VILYYQYAPIKDPQTFRDQHFKYCESIGLLGRIIVAQEGINGTLSGPEEQIHKYMDQLKQDPRF
Y630_AYWBP      ------VILYYQYVPIKDPQTFRNQHFKYCESLGLLGRIIVAQEGINGTLSGPKEQIHKYIDQLKQDVRF
Y2691_CYTH3     --KDYQILLYYCYTHIADPDAYREEHHLKCLELGLLGRIIIASEGLNGTVSGTEEGCRQYMEYVKADPRF
Y2281_BRUO2     ------VAALYCFAPLPQYESLREPLAQLCCANGIKGTLLLAAEGINGTVAGSAGAIEKLIAHITAIPGL
Y3086_BRUSU     ------VAALYCFAPLPQYESLREPLAQLCCANGIKGTLLLAAEGINGTVAGSAGAIEKLIAHITAIPGL
Y2589_BRUC2     ------VAALYCFAPLPQYESLREPLAQLCCANGIKGTLLLAAEGINGTVAGSAGAIEKLIAHITAIPGL
Y800_BRUA1      ------VAALYCFAPLPQYESLREPLAQLCCANGIKGTLLLAAEGINGTVAGSAGAIEKLIAHITAIPGL
Y2897_LEGPA     --KDIIIASFYKFIPLNDFESLREPILTKMHEIGIKGTIILAHEGVNGGFAGNREQMNVFYDYLRSDSRF
Y2585_BRUA2     ------VAALYCFAPLPQYESLREPLAQLCCANGIKGTLLLAAEGINGTVAGSAGAIEKLIAHITAIPGL
Y2390_BRUMB     ------VAALYCFAPLPQYESLREPLAQLCCANGIKGTLLLAAEGINGTVAGSAGAIEKLIAHITAIPGL
Y2386_BRUAB     ------VAALYCFAPLPQYESLREPLAQLCCANGIKGTLLLAAEGINGTVAGSAGAIEKLIAHITAIPGL
Y996_CHLFF      MKKNYYALAYYHFTRVDNPQEEIALHKELFKKLDVSCRIYISEQGINGQFSGYQPDAEYYMNWLKQRPGF
Y007_BRUME      ------VAALYCFAPLPQYESLREPLAQLCCANGIKGTLLLAAEGINGTVAGSAGAIEKLIAHITAIPGL
Y4255_OCHA4     ------VAALYCFAPLPQYESLREPLAKLCCSNGIKGTLLLAAEGINGTVAGTPQAIEKLVQHITAIPGL
Y2591_BRUSI     ------VAALYCFAPLPQYESLREPLAQLCCANGIKGTLLLAAEGINGTVAGSAGAIEKLIAHITAIPGL
Y3122_LEGPC     --KDIIIASFYKFIPLNDFESLREPILTKMHEIGIKGTIILAHEGVNGGFAGNREQMNVFYDYLRSDSRF
Y010_CHLCV      MKKNXXXXXXXXXTRVDNPQLEIALHKELFKDLDVSCRIYISEQGINGQFSGYQPDAEHYMNWLRQRPGF
Y2838_LEGPH     --KDIIIASFYKFIPLNDFESLREPILTKMHEIGIKGTIILAHEGVNGGFAGNREQMNVFYDYLRSDSRF
Y010_CHLAB      MKKNXXXXXXXXXTRVDNPQQEIALHKELFKDLDVSCRIYISEQGINGQFSGYQPDAEYYMNWLRQRPGF
Y680_CHLTA      MEKNYYALAYYYFGPVSNPHEEIALHKQLFKTMDVSCRIYISEEGINGQFSGYQPDAERYMAWLKQRPDF
Y627_CHLTR      MEKNYYALAYYYFGPVSNPHEEIALHKQLFKTMDVSCRIYISEEGINGQFSGYQPDAERYMAWLKQRPDF
Y2780_TERTT     ---DYLVAALYKFVSLPNYESLREPLIDFCQSREIKGTLLLAAEGINGTVAGTPEAIQALLEELRRQPGL
Y2750_LEGPL     --KDIIIASFYKFIPLNDFESLREPILTKMHEIGIKGTIILAHEGVNGGFAGNREQMYIFYDYLRSDSRF
Y916_CHLMU      MEKNYYALAYYYFGPVSNPHEEIALHKQLFKTMDVSCRIYISEEGINGQFSGYQPDAERYMAWLKQRPDF
Y891_CHLT2      MEKNYYALAYYYFGPVSNPYEEIALHKQLFKTMDVSCRIYISEEGINGQFSGYQPDAERYMAWLKQRPDF
Y885_CHLTB      MEKNYYALAYYYFGPVSNPYEEIALHKQLFKTMDVSCRIYISEEGINGQFSGYQPDAERYMAWLKQRPDF
Y1091_BARBK     MEKKFKVAALYCFADLKHYQKLQKPLLDLCQENGIKGTLLLAKEGINGTVAGSCAAIETLVRFITAEPAF
Y2992_RHILO     -SQPVRVAALYRFARLDAFEALRAPLAAFCCGRGIKGTLLLAHEGINGTVAGSEEAIAELIDHIEAIDGL
Y3407_PSYIN     ------VCALYRFVSLENYQEIQAPLLKMMQANNIKGTLLLAQEGINGTVAGSREDINTLIAWLKSDPRL
Y3401_RHILW     ------VAALYHFVSVPRFENLQALLQTLCEQSGVKGTLLLAHEGINGTIAGPDAGIAAVLSFLRAQPEF
Y2130_SHEPC     ------VCALYKFVSLPHFESIRAPLLAMMEQAEVKGTLLLASEGINGTVAGNQEAIEALLAWLNNQNGL
Y1881_SHESW     ------VCALYKFVSLPHFESIRAPLLAMMEQAEVKGTLLLASEGINGTVAGNQEAIEALLAWLNNQNGL
Y1007_BARQU     MEKNFKVAALYCFADLKHYRQLQKPLLDLCQAKDIKGTLLLAQEGINGTIAGSCRAIEELVNFIKTEPAF
Y6152_NOSP7     ------VAALYKFVKLPDFAQKRDPLLSYCQAQGVKGTILLAQEGINGTIAGSRQAIDSVLWFLRSDPRL
Y2319_METFK     ----IVVAALYKFVSLPDYQELQPGLLALCNAQGIKGTLLLAEEGINGTVAGSRAAIDALLTYLRQDSRM
Y384_ANASP      ------VAAFYKFVSLPDFAEKQEPLLAYCLAQNIKGTILLAKEGINGTIAGSRLSIDNVLSYLRSDLRL
Y2481_SHEB9     ------VCALYKFVSLPHFESIRAPLLAMMEQAEIKGTLLLASEGINGTVAGTQEAIEALLVWLNSQNGL
Y2366_SHEB8     ------VCALYKFVSLPHFESIRAPLLAMMEQAEIKGTLLLASEGINGTVAGTQEAIEALLLWLNSQNGL
Y771_ACIBY      ------VAALYQFKEVQDPADLQQRLLDLVKTINLCGTLIVAGEGINGTVAGDREA----IDTIHQFEGF
Y768_ACIBS      ------VAALYQFKEVQDPADLQQRLLDLVKTINLCGTLIVAGEGINGTVAGDREA----IDTIHQFEGF
Y4166_RHIL3     ------VAALYHFVSVPRFADLQAPLQTLCEENGVKGTLLLAHEGINGTIAGPDAGIHAVLAFLRAQPEF
Y2378_SHEB5     ------VCALYKFVSLPHFESIRAPLLAMMEQAEIKGTLLLASEGINGTVAGTQEAIEALLVWLNSQNGL
Y2825_ANAVT     ------VAAFYKFVSLPDFTEKQVPLLAYCLAQDIKGTILLAKEGINGTIAGSRLSIDNVLSYLRADLRL
Y2782_SINMW     ---------------------------AICDANGVKGTLLLAHEGINGTIAGSEEGIATVLAFLRAQPEF
Y2261_SHESA     ---NVVVCALYKFVSLPHFESLREPLLSMMEQADIKGTLLLANEGINGTVAGSQAAIDALLAWLNNQNGL
Y1981_SHEB2     ------VCALYKFVSLPHFESIRAPLLAMMEQAEIKGTLLLASEGINGTVAGTQEAIEALLVWLNGQNGL
Y2524_SHEPA     ------VCAMYKFVTLAEFEKLQSPLQKVMETSGVKGSLLLAQEGINGTVAGSQSAIDNLLAWLATQPGL
Y1276_BARHE     MEKNFKVAALYCFADLKHYRQLQKPLLDLCQAKDIKGTLLLAQEGINGTVAGSCAAIETLVDFITAEPAF
Y734_CHLPN      MEKKYYALAYYYITRVDNPHEEIALHKKFLEDLDVSCRIYISEQGINGQFSGYEPHAELYMQWLKERPNF
Y3638_RHIEC     ------VAALYHFVSVPRFASLQAPLQALSEENGVKGTLLLAHEGINGTIAGPDAGIHAVLAFLRAQPEF
Y2917_ACIAD     ------------------------------KTINLCGTLIVASEGINGTVAGDRHAIDTIREFLLN-EGF
Y2887_RHIME     ------VAALYHFVSFPRFADFREPLQAICDANGVKGTLLLAHEGINGTIAGTEEGIAAVLACVRAQPEF
Y1760_SHESM     ---NVVVCALYKFVSLPHFESLREPLLSMMEQAEIKGTLLLASEGINGTVAGTQAAIDALLAWLNNQNGL
Y2290_SHEON     ---NVVVCALYKFVSLPHFESLREPLLSMMEQAEIKGTLLLASEGINGTVAGNQAAIDALLIWLNQQNGL
Y378_PARUW      ------VLAYYHFTAIADPHQEVKAHKEFFKDRNITSRIYLSEQGINGQMSGKREDAEAYMKWLHANPLF
Y2937_RHISN     ------VAALYHFVAFPRFAEFRGPLQAVCDANGVKGTLLLAHEGINGTIAGTEAGIATVLAYLTAQPEF
Y1838_SHESR     ---NVVVCALYKFVSLPHFESLREPLLSMMEQAEIKGTLLLASEGINGTVAGTQAAIDALLAWLNNQNGL
Y2660_SHESH     ------VCALYKFVSLPHFESIQKPLLALMEESGVKGTLLLASEGINGTVAGSQAAIDSLLMWLYQQPGL
Y1312_SACD2     ----IVIAALYKFVSLPDFEALREPLQAFCIENEIKGTLLLAQEGINGTVAGRREAIDALLAYFGKDARL
Y1496_SYNP2     --KDFVVITFYKFFDFPDYKERQQPIFNFADEQKIIGTILLAHEGINATIAGTQTALDAMVNFLHQDPRL
Y1075_ACAM1     ---------FYKFVELQDYAELKAPLLACCQDNDVQGTILLATEGINGAIAGLPHNIHTVLDFLCGDPRF
Y584_ROSDO      ----------YHFTRFENPAALKPALLELCKAQGVTGTLLLAPEGVNGTITGSRAGIDAVLAHLKALPGC
Y091_SILPO      ---------------------------------GVKGTLLLAKEGINGTIAGPRAGIDAVLAHIRALPGC
Y6657_VIBHB     ------VCALYKFVELENYQELREPLLALMEAHGVHGTLLLASEGINGTVAAKREGIDTLLAWLNDEPRL
Y5597_VIBPA     ------VCALYKFVELNNYQELREPLLALMEKHHIRGTLLLAGEGINGTVASDRAGIDTLLEWLNTEPRL
Y1781_SHELP     ------VCALYKFVSLPAFEALQQPLLKEMESLEIKGTLLLASEGINGTVAGSQAGIDSLLAWLDAQPGL
Y789_FRATN      ----IVVCAMYKFVTLEDFEAMRQPLLDTMIKNNVKGTLLLANEGINGTVAGTRESIDNLLAYLKSDPRL
Y370_PSYA2      VTNNIVVAALYKFTRFADFEEYREPILNIMLDNEVKGTLLIASEGINGTISGTRQGIDNVLEYLRSIDAI
Y1885_SHEPW     ------VCAMYKFVSLPDFERIQKPLLIVMEKSGIKGTLLLAKEGINGTVAGSQSAIDALLAWLATQPGL
Y960_RICRS      MNEKIAILSAYSFVNIEEPANLIPKLLLLGKRKYIRGTILLANEGFNGSFSGSYENVNLVLEELIKLTGP
Y674_LEPBL      -------LSFYRYVILENVQELRNRLYVEWEALGVLGRIYVAREGINAQLSIPSHNLNSFKENLNSRIQF
Y522_HAHCH      ----------YKFVALDNFEALRAPLLEVMEKNEVKGTLLLAREGVNGTVSGTREGMDALLAWLKSDPRL
Y411_PSYCK      VTNNIVVAALYKFTRFADFEKYRDPILNTMLDNDVKGTLLIASEGINGTISGTRQGIDNVLDYLRSIEEI
Y4030_RICPU     MNEKIAILSTYSFVNIEEPANLIPKLLLIGKRKYIRGTILLANEGFNGSFSGSYENVNLVLEELIKLTGP
Y2438_LEPBJ     -------LSFYRYVILENVQELRNRLYVEWEALGVLGRIYVAREGINAQLSIPSHNLNSFKENLNSRIQF
Y208_RICRO      MNEKIAILSAYSFVNIEEPANLIPKLLLLGKRKYIRGTILLANEGFNGSFSGSYENVNLVLEELIKLTGP
Y716_WOLPP      ------IATFYHFVKLSNYYDMKDEIKVACDNVELKGTILLAEEGINATVSGERNAIDKIFDFLRSDYRL
Y3658_PSEU2     MTQPIVVAALYKFVTLSDYVELREPLLQAMVDNGIKGTLLIADEGINGTVSGSREGIDGLMAWLKSDPRL
Y1973_SHEWM     ------VCALYKFVSLPNFESIQKPLLAHMESAGIKGTLLLASEGINGTVAGSQLAIDNLLQWLAKQDGL
Y175_RICM5      MNEKIAILSAYSFVNIEEPANLIPKLLLIGKRKYVRGTILLANEGFNGSFSGSYENVNLVLEELIKLTGP
Y1734_PSESM     ----IVVAALYKFVTLSDYVAFREPLLQAMVDNGIKGTLLIADEGINGTVSGSREGIDGLMAWLKSDPRL
Y1391_FRATW     ----IVVCAMYKFVTLEDFEAMRQPLLDTMIKNNVKGTLLLANEGINGTVAGTRESIDNLLAYLKADPRL
Y1229_FRATM     ----IVVCAMYKFVTLEDFEAMRQPLLDTMIKNNVKGTLLLANEGINGTVAGTRESIDNLLAYLKADPRL
Y1178_FRATF     ----IVVCAMYKFVTLEDFEAMRQPLLDTMIKNNVKGTLLLANEGINGTVAGTRESIDNLLAYLKADPRL
Y1118_FRATH     ----IVVCAMYKFVTLEDFEAMRQPLLDTMIKNNVKGTLLLANEGINGTVAGTRESIDNLLAYLKADPRL
Y1091_FRATO     ----IVVCAMYKFVTLEDFEAMRQPLLDTMIKNNVKGTLLLANEGINGTVAGTRESIDNLLAYLKADPRL
Y1085_FRATT     ----IVVCAMYKFVTLEDFEAMRQPLLDTMIKNNVKGTLLLANEGINGTVAGTRESIDNLLAYLKADPRL
Y1085_FRAT1     ----IVVCAMYKFVTLEDFEAMRQPLLDTMIKNNVKGTLLLANEGINGTVAGTRESIDNLLAYLKADPRL
Y3678_PSE14     MTQPIVVAALYKFVTLSDYVELREPLLQAMVDNGIKGTLLIADEGINGTVSGSREGIDGLMAWLKSDPRL
Y2744_RENSM     -----RIVLFYAFAPVADPESVRLWQRALCEKHGLTGRILISRDGINATVGGELSAVKQYVKATKEYPAF
Y1677_MARMM     ------VAALYKFAPLDADGKLQADLKSACEHHNVFGTLLLAPEGINGTIAGPSAGVHVILAELRALPGF
Y2535_MARMS     ---------------------------------GIRGTLLLASEGINGTVAGSREGIDAMLAWLDQQPGL
Y4604_VIBSL     ------VCALYKFVALDDYQEIRQPLTEVLEANQIRGTLLLASEGINGTVAGKRESIDALLQWFKQDSRL
Y315_ANAMM      ------IAAFYRFVHLHNYYDMKPVILEFCLSRGIKGTVILAEQGINATIAGSRQSIGEFFSFLDSDDRL
Y234_ANAMF      ------IAAFYRFVHLHNYYDMKPVILEFCLSRGIKGTVILAEQGINATIAGSRQSIGEFFSFLDSDDRL
Y2100_SHEDO     ------VCALYKFVTLPHYESLRAPLLAVMEASDIRGTLLLAQEGINGTVAGTQAAIDGLLAWFDTQEGL
Y1135_WOLPM     ------IATFYHFVELSNYYDMKDEIKAACNNVELKGTILLAEEGVNATISGERNAIDKIFDFLRSDYRL
Y4798_COLP3     -ASTITICALYKFVRLDAYEALREPLSNKMASVDVKGTLLLAAEGINGTIAGPQTGIDTVLAFLGEQPGL
Y240_CORJK      ---ETRILLYYCFTPIDDPTAVMLWQRALCEQLELKGRILISKHGINGTVGGSLASCKQYVRRTREFPGF
Y167_RICCN      MNEKIAILSAYSFVNIEEPANLIPKLLLIGKRKYVRGTILLANEGFNGSFSGSYENVNLVLEELIKLTGP
CI097_MOUSE     ------VLLYYCYCDLEDPHWVCAWQTALCHHLHLTGKIRIATEGINGTVGGSKVATRLYVEVMLSCPLF
Y4090_PSEPF     MTQPIVVAALYKFVTLEDYVNLREPLLQAMVDNGIKGTLLIAEEGINGTVSGSREGIDGLLAWLRNDPRM
Y1846_FRAP2     ----IVVCAMYKFVTLEDYEAMRQPLLDTMIKNNVKGTLLLANEGINGTVAGSREGVNALLAYLKSDSRL
Y156_RICAE      MNEKIAILSAYSFVNIEEPANLIPKLLLIGKRKYVRGTILLANEGFNGSFSGSYENVNLVLEELIKLTGP
Y1433_PSEHT     ------VCALYKFVALPEFEALRKPLLDVMEANEVRGTLLIASEGINGTVSAKRAGIDNLLKWLEQQPSL
Y1758_PSEPK     MSQAIVVAALYKFVTLEDYVELREPLLKTMLDNNVKGTLLLAQEGINGTVSGTREGIDGLLAWLRSDPRL
Y1365_PSEPW     MTQPIVVAALYKFVTLEDYAELREPLLKAMLDNGVKGTLLLANEGINGTVSATREGIDGLLTWLRSDPRL
Y962_ANAPZ      MSMGFVVAAFYRFVHLHNYYDMRSVILEFCQEHGIKGTVILAEQGINATISGERDAINKFFSFLDLDHRL
Y8368_RHOBA     ----------YCFTPLPQFESLREPFRQRMSDDGIRGSLLLAGEGINGTIAGPRELMEPFIDWLRSMEGM
Y1259_VIBCH     ------VCALYKFVELNHYQELRAPLLALMEENHIRGTLLLAQEGINGTVASSRQGIDALLAWLENEPSL
Y925_RICAH      MSEKIAILSAYSFVNIEEPANLIPKLLLIGKRKYVRGTILLANEGFNGSFSGSYENVNLVLEELIKLTGP
Y4491_AGRT5     ---DFLVAALYHFARLPRFESLREQLFELCQKNGVKGTLLLAAEGINGTIAGPDAGVQAVLSFLRAQPEF
Y3956_PSEP1     MSQAIVVAALYKFVTLEDYVELREPLLKTMLDNNVKGTLLLAHEGINGTVSGTREGIDGLLAWLRNDPRL
Y1477_PSEE4     MSQPIVVAALYKFVTLEDYVELRDPLLKAMTDNGVKGTLLLANEGINGTVSATREGIDALLAWLRNDPRL
Y765_SYNY3      --------------------------------LGLKGTILLAEEGVNATIAGESAAIEEMVKIMAADLGL
Y4311_PSEFS     MTQPIVVAALYKFVTLEDYVALREPLLQAMVDNGIKGTLLIAEEGINGTVSGSREGIDGLMAWLKTDPRM
Y4325_PSEF5     MAQPIVVAALYKFVTLEDYVNLREPLLQAMLDNGIKGTLLIAEEGINGTVSGSREGIDGLLAWLKNDPRM
Y2830_COREF     -----KILLYYAFTPLSDPKAVQLWQRDLCESLNLRGRILISEHGINGTVGGDINDCKAYIRKTREYPGF
Y1760_CORU7     --KESRILLYYCFTPIADPTAIMLWQKQLCESLGLTGRILISEHGINGTVGGSLHACKQYARRTREYPGF
Y038_WOLTR      ------IATFYHFVKLSNYYDMKDEIKAACDNFELKGTILLAEEGINATISGERNAINKIFNFLCSDYRL
Y2448_CORA7     -----KILLYYCFTPIEDPTAIMLWQRSLCEKLGLKGRILISEHGINGTVGGDMDACKRYVRETREYPGF
Y1113_CAUCN     -----RVAALYRFTRFEDPAAIQGPLAALCCSLGVKGTLLLAREGINGTIAGEDAAIEAVLAHIRALPGC
Y1060_CAUCR     -----RVAALYRFTRFEDPAAIQGPLAALCCSLGVKGTLLLAREGINGTIAGEDAAIEAVLAHIRALPGC
Y255_NEOSM      ------LVTFYHFVQLENYEDMRDELLSCCIEKGLKGTVLLALEGINGSVAGHDGEIRDFLDFVRRDERL
Y114_RICTY      MNERIAILSAYSFVNIIEPANLIPKFLLIGKKKYIRGTILLANEGFNCSFSGSYENVNLVLKQLIELTGS
Y895_GLUOX      ----IRIVALYHFTPFEDPAALRGPLLELCEKEGIKGILLLAREGINGTIAGTDEGMERVMAHIRALPGC
Y635_RICCK      MNEKIAILSTYSFVNIEEPANLIPKLLLIAKRKYVRGTILLSKEGFNGSFSGSYENVNLVLEELIKLTVP
Y3365_ARTS2     -----RIVLFYGFTPITDPDAVRLWQRALCEKLGLTGRILISKDGINATVGGELNAVKQYVKTTREYKGF
Y1435_RICB8     MSEKIAILSAYSFVNIEEPESLIPKLLFVGKRKYVKGTILLSKEGFNGSFSGSYESVNLVLEELKKLTNT
Y1241_PHOPR     ------VCALYKFVALEDFEAIRQPLTDVMEKNKIRGTLLLASEGINGTVASTREGIDALLAWFKQDQRL
Y3316_ALISL     ------VCALYKFVSLEDYTEIRQPLTQVMEDNQIRGTLLLASEGINGTVAGSRKAIDTLLTWFKEDSRL
Y2992_CORGL     -----KILLYYAFTPLSDPKAVQLWQRELCESLNLRGRILISTHGINGTVGGDIDDCKAYIKKTREYPGF
Y1349_PSEPG     MSQAIVVAALYKFVTLEDYIELREPLLQAMLDNNVKGTLLLAHEGINGTVSATREGIDGLLAWLRNDPRL
CI097_PONAB     ------VLLYYCYRDLEDPQWICAWQTALCQQLHLTGKIRIAAEGINGTVGGSKLATRLYVEVMLSFPXX
Y2881_CORGB     -----KILLYYAFTPLSDPKAVQLWQRELCESLNLRGRILISTHGINGTVGGDIDDCKAYIKKTREYPGF
Y1100_DEIRA     ------------------------------------GTLIVADEGINGTVAGSAAAIAELHAFLLA-SGF
CI097_HUMAN     ------VLLYYCYHDLEDPQWICAWQTALCQHLHLTGKIRIAAEGINGTVGGSKLATRLYVEVMLSFPXX
Y2301_CORDI     -----KILLYYKFTPIADPKAMMLWQRDMCELLGLKGRILISEHGINGTVGGDMDACKRYVRKMREYPGF
Y4661_PSEA7     ---------------------------------GVKGTLLLAEEGINGTVSGSREGIDALFAWLRSDPRL
Y858_PSEAE      ---------------------------------GVKGTLLLAEEGINGTVSGSREGIDALFAWLRSDPRL
Y4460_PSEA8     ---------------------------------GVKGTLLLAEEGINGTVSGSREGIDALFAWLRSDPRL
Y125_RICPR      MNERITILSAYSFVNIIEPANLIPKLLLVGKKKYIRGTILLANEGFNSSFSGSYENVNIVLKQLIALTGS
Y1169_RICBR     MSEKIAILSAYSFVNIEEPESLIPKLLFVGKRKYVKGTILLSKEGFNGSFSGSYESVNLVLEELKKLTNT
Y5318_PSEAB     ---------------------------------GVKGTLLLAEEGINGTVSGSREGIDALFAWLRSDPRL
Y2351_IDILO     ----------------------------------VKGTLLLAREGINGTICGTREAIDNVLNYLRSDERF
Y654_PROMT      ----------------------------------IKGTILLASEGVNGTICGPENAIVQFIETLEKLLKV
Y011_JANSC      ------VAALYHFTRFADPDALRAPLRSIAEAGNVRGSLLLAPEGINGTIAGPRAGIDAVLAHIKGLPGC
Y1693_PSEMY     MTDKIVVAALYKFVSLPDYQALREPLLQTLLDNGIKGTLLLAEEGINGTVSGSRAAIDALLAWFRQDARL
Y1486_PROM1     ----------------------------------IKGTILLASEGVNGTICGTENAIVLFIETLENLLKV
Y3153_ARTCA     -----RIVLFYGFTPIPDPDAVRLWQRALCEKLGLTGRIIISKDGINATVGGEIGAVKQYVKTTREYKGF
Y1961_RHOFD     ---------FYKFVELPDFAQLKAPLLTCCEANDVKGTILLATEGINSTIAGPAVGVHAVLAYLRRDPRL
Y794_KOCRD      -----KIVLFYVFTPLADPEAVKLWQLNLAQRSGVKGRIIVSEQGINATVGGDIHDVKAYVRGLKEYAPF
Y1395_SYNS9     ----LQVAAFYAFTPLNEQQRASSDLPDMAMTNSVLGSILVAHEGVNGTISGPEAGVEALLQSLRTSLAL
Y2203_SYNP6     ---------FYRFVALGDCDRWRQWLQDLCTALGLRGTILLAPEGINAGLAGNTEAIAQFLSELQQHPPF
Y1892_SYNE7     ---------FYRFVALGDCDRWRQWLQDLCTALGLRGTILLAPEGINAGLAGNTEAIAQFLSELQQHPPF
Y1635_SYNSC     LANDSRLLVFYAFTPLERRETLLSSLPTLARNGSVLGSVLVAHEGVNGTISGPESAVDAVLDHLRTSFDL
Y896_EHRCR      ------VSTFYRFVHLSNYYDIQPVLKEFCVQHSIKGTIILAEQGINATIAADKQSSDEFFSFLNLDDRL
Y976_LEPIC      -------LSFYRYVILENVQELRDQLYAEWEILGVLGRIYIAREGINAQLSIPSHNLDFFRKNLDSRNQF
Y3128_LEPIN     -------LSFYRYVILENVQELRDQLYAEWEILGVLGRIYIAREGINAQLSIPSHNLDFFRKNLDSRNQF
Y2998_NITWN     ----LKVAALYQFTPLPDFRALREPLRELCAAHAIKGSILLAAEGINGTVAGTPRAIDALVSELQTSGRL
Y1101_PROMA     ---DYKIAAFYSFSPI--AEKVITTFLSKLRIIAVRGTVLVALEGINGTICGPVEGVTAMQKQLDSLDLE
Y2579_YERPB     ---------FYKYFTLEDAKTFRDNLYSQFVKLGVFGRVYVAKEGINAQISVPANRYDEFIALFASHPAL
Y2488_YERPS     ---------FYKYFTLEDAKTFRDNLYSQFVKLGVFGRVYVAKEGINAQISVPANRYDEFIALFASHPAL
Y2451_YERPE     ---------FYKYFTLEDAKTFRDNLYSQFVKLGVFGRVYVAKEGINAQISVPANRYDEFIALFASHPAL
Y2048_YERPN     ---------FYKYFTLEDAKTFRDNLYSQFVKLGVFGRVYVAKEGINAQISVPANRYDEFIALFASHPAL
Y1866_YERPP     ---------FYKYFTLEDAKTFRDNLYSQFVKLGVFGRVYVAKEGINAQISVPANRYDEFIALFASHPAL
Y1668_YERPY     ---------FYKYFTLEDAKTFRDNLYSQFVKLGVFGRVYVAKEGINAQISVPANRYDEFIALFASHPAL
Y1560_YERP3     ---------FYKYFTLEDAKTFRDNLYSQFVKLGVFGRVYVAKEGINAQISVPANRYDEFIALFASHPAL
Y1569_ENT38     ----ITISFYKYFSIAEPQETRDALYKAF-ESLNVFGRVYLAHEGINAQISVPESKVSAFRDFLYSFPAL
Y3187_RHOE4     -----KIVLFYQFTPLADPEAIKLWQHSLAESNNLTGRIIVSPHGINATVGGDIEDVKRYVRGTRGYEPF
Y206_EHRCJ      ------VSTFYRFVHLSNYYDIQSVLKEFCVQHDIKGTIILAEQGINATIAGAQSALNQFFSFLDLDNRL
Y1816_PHOLL     ---------FYKYFNILNPLDFRNSLYQQFTDLSVFGRVYIAKEGINAQISLPTHNLEAFKALLYSVPAL
Y1078_NITHX     ----LKVAALYQFAPLPDFREVREPLRALCVGLSVKGTILLAGEGINGTVAGMPDAIDALAAELQTSGRL
YCEA_SALNS      ---------FYKYFTIASPQQTRDALYQVFTALDVFGRVYLAYEGINAQISVPQSKVETFRQQLYTFPAL
Y857_RHOSR      -----KIVLFYVFTPLADPEAIRLWQYTLAEANNLTGRILVSEHGINATVGGDIRDVKRYVKGTRSYAPF
Y2059_ERWT9     ---------FYKYFTIEDPRAFRDALYVALTRLKVFGRVYVAAEGINAQVSVPYEEMKATLYGFH--PAL
Y1185_PROM5     ------VSLYSFFSFQENSIELKQNLLRIEKENDLSGLLIIASEGINGTICAXXXXXXXXXXXXXXXVGN
Y932_SYNPX      ------VAAFYAFTPLDDDQREALSALPTQASHGVLGSVLVAKEGVNGTISGPEQGVEGLLEHLQEQLKL
Y1619_YERE8     ---------FYKYFILEDAKAFRDNLYSQFVKLGVFGRVYVAKEGINAQISNRYDEFKVVLFAAH--PAL
YCEA_ESCF3      ---------FYKYFTIADPQTTRDALYKLFTALNVFGRVYLAHEGINAQISVPESHVDKFRQQLYSFPAL
Y595_RHOOB      -----KIVLFYVFTPLADPEAIRLWQYTLAEAHDLTGRILVSEHGINATVGGDIRDVKRYVKGTRSYAPF
YCEA_SALAR      ---------FYKYFTIVSPQQTRDALYQMFTALGIFGRVYLAHEGINAQISVPQSKVETFRQQLYAFPAL
Y2131_BDEBA     ------VTAYYRFTKLADAIQKALEDKA--EELNVKGLVILGDEGYNSTAASSIESFEAWKTFIREYFNS
Y1094_PROMP     ------VSLYSFFSFQENSIIELKENLSIEKNNDLSGLLIIAREGLNGTVCAEXXXXXXXXXXXXXXVGN
YCEA_SALPB      ---------FYKYFTIASPQQTRDALYQVFTALDVFGRVYLAYEGINAQISVPQSKVETFRQQLYTFPAL
YCEA_SALPK      ---------FYKYFTIASPQQTRDALYQVFTALDVFGRVYLAHEGINAQISVPQSKVETFRQQLYTFPAL
YCEA_SALPA      ---------FYKYFTIASPQQTRDALYQVFTALDVFGRVYLAHEGINAQISVPQSKVETFRQQLYTFPAL
YCEA_SALEP      ---------FYKYFTIASPQQTRDALYQVFTALDVFGRVYLAHEGINAQISVPQSKVETFRQQLYTFPAL
YCEA_SALDC      ---------FYKYFTIASPQQTRDALYQVFTALDVFGRVYLAHEGINAQISVPQSKVETFRQQLYTFPAL
YCEA_SALA4      ---------FYKYFTIASPQQTRDALYQVFTALDVFGRVYLAHEGINAQISVPQSKVETFRQQLYTFPAL
Y201_EHRRG      ------VSTFYRFVHLSNYYDIRPVLKEFCVQNNIKGTIILAEQGINATIAGSQNSLDKFFSFLDLDSRL
Y1886_SERP5     ---------FYKYFTIEDPKAFRDSLYVQFDKLKVFGRIYVAKEGINAQISVPQNKFEAFKAALFSHPAL
YCEA_SALSV      ---------FYKYFTIASPQQTRDALYQVFTALDVFGRVYLAHEGINAQISVPQSKLETFRQQLYTFPAL
YCEA_SALG2      ---------FYKYFTIASPQQTRDALYQVFTALDVFGRVYLAHEGINAQISVPQSKVETFRQQLYTFPAL
YCEA_ECOSM      -------------------------------ALNVFGRVYLAHEGINAQISVPASNVETFRAQLYAFPAL
Y2403_BRAJA     -----KVAAFYQFAALPDYRELREPLRAFCAGLALKGSVLLAQEGINGTIAGAPDAIDAFAELAHGTMRL
Y153_CORK4      -----KIVLFYVFTPLADPEAIRLWQKALAEKWNLKGRVIISKDGINATLGGELNDVKRYCRETRSYAPF
Y1055_PROMM     ----------------------------------LMGTVLLAEEGVNGTICGSVDGVSALLERLESIEGL
YCEA_SALHS      ---------FYKYFTIASPQQTRDALYQVFTALDVFGRVYLAHEGINAQISVPQSKVETFRQQLYTFPAL
YCEA_SHIDS      ---------FYKYFHIADPKVTRAALYQLFTALNVFGRVYLAHEGMNAQISVPASNVETFRAQLYAFPAL
Y359_BUCAT      -------LSFYKYFFIKNTQEYRDRLYKNFYKYNVLGRIYVASEGINAQISVPYSILKKFL-YNFDIE-L
Y358_BUCA5      -------LSFYKYFFIKNTQEYRDRLYKNFYKYNVLGRIYVASEGINAQISVPYSILKKFL-YNFDIE-L
YCEA_SHISS      -------------------------------ALNVFGRVYLAHEGINAQISVPASNVETFRAQLYAFPAL
YCEA_SHIFL      -------------------------------ALNVFGRVYLAHEGINAQISVPASNVETFRAQLYAFPAL
YCEA_SHIF8      -------------------------------ALNVFGRVYLAHEGINAQISVPASNVETFRAQLYAFPAL
YCEA_ECOLI      -------------------------------ALNVFGRVYLAHEGINAQISVPASNVETFRAQLYAFPAL
YCEA_ECODH      -------------------------------ALNVFGRVYLAHEGINAQISVPASNVETFRAQLYAFPAL
YCEA_ECOBW      -------------------------------ALNVFGRVYLAHEGINAQISVPASNVETFRAQLYAFPAL
YCEA_ECO8A      -------------------------------ALNVFGRVYLAHEGINAQISVPASNVETFRAQLYAFPAL
YCEA_ECO7I      -------------------------------ALNVFGRVYLAHEGINAQISVPASNVETFRAQLYAFPAL
YCEA_ECO55      -------------------------------ALNVFGRVYLAHEGINAQISVPASNVETFRAQLYAFPAL
YCEA_ECO27      ------------------------------------GRVYLAHEGINAQISVPASNVETFRAQLYAFPAL
YCEA_ECO24      -------------------------------ALNVFGRVYLAHEGINAQISVPASNVETFRAQLYAFPAL
Y997_PROM3      ----------------------------------LMGTVLLAEEGVNGTICGSVDGVSALLERLERIEGL
Y2095_XANC8     ----------YQFAPIHDPQQLADSVLERAQQRALKGSVLVAEEGINLFLAGDAEQIASFYAWLHADARF
Y2086_XANCP     ----------YQFAPIHDPQQLADSVLERAQQRALKGSVLVAEEGINLFLAGDAEQIASFYAWLHADARF
YCEA_ECOSE      -------------------------------ALNVFGRVYLAHEGINAQISVPASNVETFRAQLYDFPAL
YCEA_ECOLU      ------------------------------------GRVYLAHEGINAQISVPASNVETFRAQLYAFPAL
YCEA_ECOL6      -------------------------------ALNVFGRVYLAHEGINAQISVPASNVETFRAQLYAFPAL
YCEA_ECOL5      -------------------------------ALNVFGRVYLAHEGINAQISVPASNVETFRAQLYAFPAL
YCEA_ECOK1      -------------------------------ALNVFGRVYLAHEGINAQISVPASNVETFRAQLYAFPAL
YCEA_ECO45      -------------------------------ALNVFGRVYLAHEGINAQISVPASNVETFRAQLYAFPAL
Y3487_KLEP3     ------------------------------------GRIYLAREGINAQISVPESNVEALREFLYGFPAL
Y330_BUCBP      ---------FYKYIFIHEPIKFRNSLYRMFFKFNIFGRVYIANEGINAQISIPKKIYHKAINIITSFAVL
Y204_EHRRW      ------VSTFYRFVHLSNYYDIRPVLKEFCVQNNIKGTIILAEQGINATIAGSQNSLDKFFSFLDLDSRL
YCEA_ECO81      -------------------------------ALNVFGRVYLAHEGINAQISVPASNVETFRAQLYAFPAL
Y2387_XANCB     ----------YQFAPIHDPQQLADSVLERAQQRALKGSVLVAEEGINLFLAGDAEQIAGFYAWLHADARF
YCEA_SALCH      ---------FYKYFTIASPQQTRDALYQVFTALDVFGRVYLAHEGINAQISVPQSKLETFRQQLYTFPAL
Y365_BUCAI      -------LSFYKYFFIKNTQEYRDRLYKTFYKYNVLGRIYVASEGINAQISVPYSILKKFL-YNFDIE-L
Y1781_ERWCT     ---------FYKYFTIDDPKAFRDRLYIQLEQYKVFGRIYIAAEGINAQISVPNNQFDAFKTGLFSAPAL
YCEA_SALTY      ---------FYKYFTIASPQQTRDALYQVFTALDVFGRVYLAHEGINAQISVPQSKLETFRQQLYTFPAL
YCEA_SALTI      ---------FYKYFTIASPQQTRDALYQVFTALDVFGRVYLAHEGINAQISVPQSKVETFRQQLYTFPAL
Y1048_SODGM     ---------FYRYFTLSDPQGFRDDLYRTLTALQVFGRVYIAAEGINAQISSRFDAMREALYAAH--PQL
Y2519_PECCP     ---------FYKYFTIDDPKAFRDRLYIQLEQCKVLGRIYIATEGINAQISVPNNQFDAFKAVLFSAPAL
Y081_HAMD5      -----QTLSFYKYFALDNPSMFRDKLYTQWNQLSVFGRVYIAKEGINAQISVPID---HYNDFKASLPAL
Y2011_CITK8     ---------FYKYFTIVDPQSTRDALYQMFTSLNVFGRVYLAREGINAQISVPQSQVAAFREQLYAFPAL
YCEA_ECOLC      -------------------------------ALNVFGRVYLAHEGINAQISVPASNVETFRAQLYALDGL
YCEA_ECOHS      -------------------------------ALNVFGRVYLAHEGINAQISVPASNVETFRAQLYALDGL
YCEA_ECO5E      -------------------------------ALNVFGRVYLAHEGINAQISVPASNVKTFRAQLYALDGL
YCEA_ECO57      -------------------------------ALNVFGRVYLAHEGINAQISVPASNVKTFRAQLYALDGL
Y1201_PROM0     ----------------------------------LSGLFIFANEGINGTICAEKNVIDIVINLINTYTDN
Y1105_PROM9     --KNYKIVSLYSFFPFQ--ENLIIDLKSKLLEIGLSGLLIFASEGINGTICAEKNVIDIVINLLNKYADN
Y2930_XANOM     ----------YQFVTIQHPQTLAASVLAQAEQQALKGSVLIAEEGINLFLAGDAEQIGAFYAWLQADARF
Y2292_ENTS8     -------------------------------ALNVFGRIYLAHEGINAQISVPESNVEAFRAALYGFPAL
Y1514_XANOP     ----------YQFVTIQHPQTLAASVLAQAEQQALKGSVLIAEEGINLFLAGDAEQIGAFYAWLQADARF
Y1230_PROM2     ----------------------------------LSGLLIFAREGINGTICAEKNVIDIVINLINKYADY
Y4043_DELAS     ---DILNISCYKFTPLPDAAALRDTLAERAQALALKGTILLAEEGINFFLAGPAQAVHSFVDQLRADDRF
Y353_BUCAP      ------VVSFYKYFLIKNTKEYRDRIYQNFYKYNVLGRVYVSDEGINAQIS----IPVKFYFFVKNFLYN
Y1200_PROMS     ----------------------------------LSGLLIFASEGINGTICAEKNVIDIVINLIKEYTDS
Y2109_XANAC     ----------YQFVTIRDPQTLAASVLAQAEQHALKGSVLVAEEGINLFLAGAAEQIGAFYTWLQADTRF
Y899_RALEH      ----------YKFVSLDDIETLRPAMRERCEAAGLKGTILLAPEGINMFLAGPRAAIDGFMDWLHADARF
Y1074_PELUB     ----------------------------------IRGTIIIANEGVNATISGKANDLKSXXXXXXXXLNF
Y065_WIGBR      --KKTKTISFYKYCKIENIDCIQEKLFEICKKLEILGRIYISYEGINAHISIKKHKIEELKIFIKTFDYL
Y839_BORBR      ----------YKFVSIANPADLREPMLEQAGQRQLKGTVLLAPEGINLFLAGAADAIEGFLRWLRADARF
Y179_BORPE      ----------YKFVSIANPADLREPMLEQAGQRQLKGTVLLAPEGINLFLAGAADAIEGFLRWLRADARF
Y754_BORPA      ----------YKFVSIANPADLREPMLEQAGQRQLKGTVLLAPEGINLFLAGAADAIEGFLRWLRADARF
Y753_RALME      ----------YKFVTLEDIETLRPVMRERCDAAGLKGTILLAPEGINMFLAGTREQIDEFMAWLHADARF
Y2353_BURCM     -------LAAYHFVSIDATEQWRPLVTARCNELGLRGTILLAPEGINLFIAGPREATDAFIDYIRHDPLF
Y2233_BURA4     -------LAAYHFVSIDATEQWRPLVTARCNELGLRGTILLAPEGINLFIAGPREATDAFIDYIRHDPLF
Y810_CUPTR      ----------YKFVSLDDIETLRPAMRERCEAAGLKGTILLAPEGINLFLAGPREAIDGFMAWLHADARF
Y454_BAUCH      ---------FYKYFDIQNPNLFRDRFYLQMNELKIFGRIYIAKEGINAQISVLNSRINAFRTMLYSHPQL
Y3126_BURM9     -------LAAYRFVSLDSIEQWRPLVAARCNTLGLRGTILLAPEGINLFIAGPREATDAFVDYIRHDPLF
Y2842_BURMS     -------LAAYRFVSLDSIEQWRPLVAARCNTLGLRGTILLAPEGINLFIAGPREATDAFVDYIRHDPLF
Y2825_BURM7     -------LAAYRFVSLDSIEQWRPLVAARCNTLGLRGTILLAPEGINLFIAGPREATDAFVDYIRHDPLF
Y2535_RALEJ     ----------YKFVSLNDIETLRPEMRSRCEDLELKGTILLAPEGINMFLAGPRESIDGFMAWLHADTRF
Y1914_BURMA     -------LAAYRFVSLDSIEQWRPLVAARCNTLGLRGTILLAPEGINLFIAGPREATDAFVDYIRHDPLF
Y1354_BURP1     -------LAAYRFVSLDSIEQWRPLVAARCNTLGLRGTILLAPEGINLFIAGPREATDAFVDYIRHDPLF
Y1204_BURP0     -------LAAYRFVSLDSIEQWRPLVAARCNTLGLRGTILLAPEGINLFIAGPREATDAFVDYIRHDPLF
Y1196_BURP6     -------LAAYRFVSLDSIEQWRPLVAARCNTLGLRGTILLAPEGINLFIAGPREATDAFVDYIRHDPLF
Y1116_BURPS     -------LAAYRFVSLDSIEQWRPLVAARCNTLGLRGTILLAPEGINLFIAGPREATDAFVDYIRHDPLF
Y2206_RALSO     ----------YKFVTLNDRETLRPALLAECQARDLKGTVLLAPEGINIFLAGSREAIDGIVGWLRADARF
Y2370_BURCJ     -------LAAYHFVSLDANEQWRPLVTARCNELGLRGTILLAPEGINLFIAGTREATDAFIAYIRHDPLF
Y2337_BURCC     -------LAAYHFVSLDANEQWRPLVTARCNELGLRGTILLAPEGINLFIAGTREATDAFIAYIRHDPLF
Y2314_BURCH     -------LAAYHFVSLDANEQWRPLVTARCNELGLRGTILLAPEGINLFIAGTREATDAFIAYIRHDPLF
Y4097_BORPD     ----------YKFVVLDNLPTLRADVLAQAGAVNLKGTVLLAEEGINLFLAGSRDKIDTFLQWLRADSRL
Y983_BURTA      -------LAAYRFVSLDSIEQWRPLITARCNALGLRGTILLAPEGINLFIAGSRGATDAFVDYLRHDPLF
Y2403_BURVG     -------LAAYHFVSLDAIEQWRPLVTARCNELGLRGTILLAPEGINLFIAGPREATDAFVDYLRHDPLF
Y5656_BURS3     -------LAAYHFVSLDTNEQWRPLVTARCNELGLRGTILLAPEGINLFIAGTREAADAFIAYLRHDPLF
Y1252_BURPP     ----------YHFATIEDTAAWRPFVTERCNALGLKGTILLAPEGINLFVAGTRENTDAFIHYIRHDALF
Y471_BORA1      -------------------------------ALGLKGTILLAPEGINLFLAGSGEAIEAFLAGLRADARF
Y1152_BURXL     ----------YQFATIEDTAAWRPFVTERCNALGLKGTVLLAPEGINLFVAGTRENTDAFIHYIRHDALF
Y683_THIDA      ----------YKFVTLNDREALKADLGARCLQLGLRGTILLAPEGINVFLAGTRAAIDAIVAGLRADPRF
Y2421_XANC5     ----------YQFVTIQDPQTLADGVRAQAEQHALKGSVLVAEEGINLFLAGAAEQIGAFYAWLQADARF
Y2090_XYLF2     ----------YHFVSITQPQTLADQIRAHGEIAGLKGTVLIANEGINLFLAGEKEAINAFYAWLCADVRF
Y1985_XYLFT     ----------YHFVSITQPQTLADQIRAHGEIAGLKGTVLIANEGINLFLAGEKEAINAFYAWLCADVRF
Y2609_XYLFA     ----------YHFVSITQPQTLADQIRAHGEIAGLKGTVLIANEGINLFLAGEKEAINAFYAWLCADVRF
Y3119_VARPS     --QEILNIAAYKFVAIDDSPVLREDLRERAQALGLMGTILLAPEGINLFLAGLPDAVRSFVAGLRADVRF
GLPE_PSEA6      ----------------------------------------------------------------------
GLPE_COXBU      ----------------------------------------------------------------------
GLPE_COXBR      ----------------------------------------------------------------------
GLPE_COXB2      ----------------------------------------------------------------------
GLPE_COXB1      ----------------------------------------------------------------------
GLPE_PSEFS      ----------------------------------------------------------------------
GLPE_PSEHT      ----------------------------------------------------------------------
GLPE_PSEF5      ----------------------------------------------------------------------
GLPE_PSEU2      ----------------------------------------------------------------------
GLPE_PSE14      ----------------------------------------------------------------------
CALU_XENLA      ----------------------------------------------------------------------
YIBN_ECOLI      ----------------------------------------------------------------------
YIBN_ECOL6      ----------------------------------------------------------------------
YIBN_ECO57      ----------------------------------------------------------------------
GLPE_PASMU      ----------------------------------------------------------------------
GLPE_SHEON      ----------------------------------------------------------------------
Y1743_ERWT9     ------------------------------------------------------ETGRLRADYKELQPEV
GLPE_PSEU5      ----------------------------------------------------------------------
GLPE_PSEPW      ----------------------------------------------------------------------
GLPE_HAEIN      ----------------------------------------------------------------------
GLPE_HAEIG      ----------------------------------------------------------------------
GLPE_HAEI8      ----------------------------------------------------------------------
YAY7_SCHPO      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           EELWFKIDEESEQAFKKMFVRYKKEIVHLGLEDNDFDNDINPLETTGAYLSPKEFKEALLDKDTVVLDTR
Y154_STRZP      EELWFKIDEESEQAFKKMFVRYKKEIVHLGLEDNDFDNDINPLETTGAYLSPKEFKEALLDKDTVVLDTR
Y092_STRP4      EELWFKIDEESEQAFKKMFVRYKKEIVHLGLEDNDFDNDINPLETTGAYLSPKEFKEALLDKDTVVLDTR
Y125_STRZT      EDLWFKIDEESEQAFKKMFVRYKKEIVHLGLEDNDFDNDINPLETTGAYLSPKEFKEALLDKDTVVLDTR
Y118_STRZJ      EELWFKIDEENEQAFKKMFVRYKKEIVHLGLEDNDFDNDINPLETTGAYLSPKEFKEALLDKDTVVLDTR
Y105_STRPJ      EELWFKIDEENEQAFKKMFVRYKKEIVHLGLEDNDFDNDINPLETTGAYLSPKEFKEALLDKDTVVLDTR
Y095_STRPN      EELWFKIDEENEQAFKKMFVRYKKEIVHLGLEDNDFDNDINPLETTGAYLSPKEFKEALLDKDTVVLDTR
Y091_STRP2      EELWFKIDEENEQAFKKMFVRYKKEIVHLGLEDNDFDNDINPLETTGAYLSPKEFKEALLDKDTVVLDTR
Y090_STRPS      EELWFKIDEENEQAFKKMFVRYKKEIVHLGLEDNDFDNDINPLETTGAYLSPKEFKEALLDKDTVVLDTR
Y084_STRR6      EELWFKIDEENEQAFKKMFVRYKKEIVHLGLEDNDFDNDINPLETTGAYLSPKEFKEALLDKDTVVLDTR
Y194_STRPI      EDLWFKIDEENEQAFKKMFVRYKKEIVHLGLEDNDFDNDINPLETTGAYLSPKEFKEALLDKDTVVLDTR
Y154_STRP7      EDLWFKIDEENEQAFKKMFVRYKKEIVHLGLEDNDFDNDINPLETTGAYLSPKEFKEALLDKDTVVLDTR
Y593_STRSV      EDLWFKIDEENEQAFKKMFVRYKKEIVHLGLEDNDFDNDINPLETTGAYLSPKEFKEALLDEDTVVLDTR
Y476_STRGC      EDLWFKIDEENEQAFKKMFVRYKKEIVHLGLEDNDFDNDINPLETTGAYLSPKEFKEALLDEDTVVLDTR
Y548_STRT1      EDLWFKIDEEEEQAFKKMFVRYKKEIVHLGLEDNNFDSDINPLETTGAYLSPKEFKDALLDEDTVVLDTR
Y548_STRT2      EDLWFKIDEEEEQAFKKMFVRYKKEIVHLGLEDNNFDSDINPLETTGAYLSPKEFKDALLDEDTVVLDTR
Y588_STRTD      EDLWFKIDEEEEQAFKKMFVRYKKEIVHLGLEDNNFDSDINPLETTGAYLSPKEFKDALLDEDTVVLDTR
Y406_STRSY      SDLWFKIDEENEQAFKKMFVRYKKEIVHLGLEDNDFDNDIDPLVTTGAYLSPKEFKEALLDEDTVVLDTR
Y392_STRS2      SDLWFKIDEENEQAFKKMFVRYKKEIVHLGLEDNDFDNDIDPLVTTGAYLSPKEFKEALLDEDTVVLDTR
Y1504_STRA3     ADLWFKIDEENQQAFRKMFVRYKKEIVHLGLEDNNFDSDINPLETTGEYLNPKQFKEALLDEDTVVLDTR
Y1469_STRA1     ADLWFKIDEENQQAFRKMFVRYKKEIVHLGLEDNNFDSDINPLETTGEYLNPKQFKEALLDEDTVVLDTR
Y1434_STRA5     ADLWFKIDEENQQAFRKMFVRYKKEIVHLGLEDNNFDSDINPLETTGEYLNPKQFKEALLDEDTVVLDTR
Y630_STRP3      ADLWFKIDEENQQAFRKMFVRYKKEIVHLGLEDNNFDSDINPLETTGEYLNPKQFKEALLDEDTVVLDTR
Y973_STRP8      ADLWFKIDEENQQAFRKMFVRYKKEIVHLGLEDNNFDSDINPLETTGEYLNPKQFKEALLDEDTVVLDTR
Y915_STRP1      ADLWFKIDEENQQAFRKMFVRYKKEIVHLGLEDNNFDSDINPLETTGEYLNPKQFKEALLDEDTVVLDTR
Y811_STRPF      ADLWFKIDEENQQAFRKMFVRYKKEIVHLGLEDNNFDSDINPLETTGEYLNPKQFKEALLDEDTVVLDTR
Y743_STRP6      ADLWFKIDEENQQAFRKMFVRYKKEIVHLGLEDNNFDSDINPLETTGKYLNPKQFKEALLDEDTVVLDTR
Y726_STRPZ      ADLWFKIDEENQQAFRKMFVRYKKEIVHLGLEDNNFDSDINPLETTGEYLNPKQFKEALLDEDTVVLDTR
Y1090_STRPG     ADLWFKIDEENQQAFRKMFVRYKKEIVHLGLEDNNFDSDINPLETTGEYLNPKQFKEALLDEDTVVLDTR
Y776_STRPD      ADLWFKIDEENQQAFRKMFVRYKKEIVHLGLEDNNFDSDINPLETTGEYLNPKQFKEALLDEDTVVLDTR
Y789_STRPB      ADLWFKIDEENQQAFRKMFVRYKKEIVHLGLEDNNFDSDINPLETTGEYLNPKQFKEALLDEDTVVLDTR
Y773_STRPC      ADLWFKIDEENQQAFRKMFVRYKKEIVHLGLEDNNFDSDINPLETTGEYLNPKQFKEALLDEDTVVLDTR
Y697_STRPM      ADLWFKIDEENQQAFRKMFVRYKKEIVHLGLEDNNFDSDINPLETTGEYLNPKQFKEALLDEDTVVLDTR
Y1138_STRU0     SDLWFKMDEEEEQAFKKMFVRYKKEIVHLGLEDNQFDEDINPLEVTGQYLNPKEFKEALLDEDTIVLDTR
YMDE_LACLA      SSTIFKIDEAEQNAFKKMHVRYRPELVNLSLED-----DVNPLELTGAYLDPKEFREAMLDENTVVIDAR
Y1287_LACLM     TSTIFKIDEAKQNAFKKMHVRYRPELVNLSLED-----DVNPLELTGAYLDPKEFREAMLDENTVVIDAR
Y1324_LACLS     TSTIFKIDEAKQNAFKKMHVRYRPELVNLSLED-----DVNPLELTGAYLDPKEFREAMLDENTVVIDAR
Y748_ENTFA      KDTFFKIDPAEEMAFRKMFVRPRSELVALNLEE-----DVDPLETTGKYLEPAEFKEALLDEDTVVIDAR
Y2654_BACSK     EGIVFKVDEEEQHVFKKMHVRPRPELVTLRLNEDD----VNPNELTGKHLSPKEWREAMLAEDTVVIDAR
Y3574_BACLD     EDMVFKIDESEGHAFKKMHVRHRDELVTLRLED-----DIDPNELTGKYLEPKEFYEAMQQEDTIVVDAR
Y1400_LISW6     ADMVFKIDAADSHAFKKMHVRPRAEIVSLSLEE-----DVNPLEVTGTYLEPTEFREALLDEDTVILDAR
Y1185_LISMH     ADMVFKIDAADAHAFKKMHVRPRAEIVSLSLEE-----DVNPLEVTGTYLEPSEFREALLDEDTVILDAR
Y1403_LISMF     ADMVFKIDAADAHAFKKMHVRPRAEIVSLSLEE-----DVNPLEVTGTYLEPSEFREALLDEDTVILDAR
Y1393_LISMC     ADMVFKIDAADAHAFKKMHVRPRAEIVSLSLEE-----DVNPLEVTGTYLEPSEFREALLDEDTVILDAR
Y1384_LISMO     ADMVFKIDAADAHAFKKMHVRPRAEIVSLSLEE-----DVNPLEVTGTYLEPSEFREALLDEDTVILDAR
Y1421_LISIN     ADMVFKIDAADSHAFKKMHVRPRAEIVSLSLEE-----DVNPLEITGDYLEPAEFRDALLDEDTVILDAR
Y127_STAS1      QGITFKVDEAEGHAFKKMHVRPRQEIVALDLED-----DVNPRELTGNYLSPKEFREALLSDDTVVIDAR
Y1961_BACC1     DGIVFKIDEADGHAFKKMHVRPRPELVTLRLED-----DINPHEITGKYLEPKDFYEAMKQEDTVIIDAR
Y1989_BACC7     DGIVFKIDEADGHAFKKMHVRPRPELVTLRLED-----DINPHEITGKYLEPKDFYEAMKQEDTVIIDAR
Y1948_BACC3     DGIVFKIDEADGHAFKKMHVRPRPELVTLRLED-----DINPHEITGKYLEPKDFYEAMKQEDTVIIDAR
Y1658_BACAH     DGIVFKIDEADGHAFKKMHVRPRPELVTLRLED-----DINPHEITGKYLEPKDFYEAMKQEDTVIIDAR
Y1875_BACCQ     DGIVFKIDEADGHAFKKMHVRPRPELVTLRLED-----DINPHEITGKYLEPKDFYEAMKQEDTVIIDAR
Y3469_BACC2     DGIVFKIDEEEGHAFKKMHVRPRPELVTLRLED-----DINPHEITGKYLEPKDFYEAMKQEDTVIIDAR
Y299_STAHJ      ADMTFKIDEAEGHAFKKMHVRPRNEIVALGLED-----DVDPRVTTGKYYSPSEFKEALEDEDTVILDAR
Y2712_BACAC     DGIVFKIDEADGHAFKKMHVRPRPELVTLRLED-----DINPHEITGKYLEPKDFYEAMKQEDTVIIDAR
Y1948_BACAA     DGIVFKIDEADGHAFKKMHVRPRPELVTLRLED-----DINPHEITGKYLEPKDFYEAMKQEDTVIIDAR
Y1916_BACC0     DGIVFKIDEADGHAFKKMHVRPRPELVTLRLED-----DINPHEITGKYLEPKDFYEAMKQEDTVIIDAR
Y1881_BACAN     DGIVFKIDEADGHAFKKMHVRPRPELVTLRLED-----DINPHEITGKYLEPKDFYEAMKQEDTVIIDAR
Y1875_BACC4     DGIVFKIDEADGHAFKKMHVRPRPELVTLRLED-----DINPHEITGKYLEPKDFYEAMKQEDTVIIDAR
Y1804_BACCR     DGIVFKIDEADGHAFKKMHVRPRPELVTLRLED-----DINPHEITGKYLEPKDFYEAMKQEDTVIIDAR
Y1719_BACHK     DGIVFKIDEADGHAFKKMHVRPRPELVTLRLED-----DINPHEITGKYLEPKDFYEAMKQEDTVIIDAR
Y1694_BACCZ     DGIVFKIDEADGHAFKKMHVRPRPELVTLRLED-----DINPHEITGKYLEPKDFYEAMKQEDTVIIDAR
Y1736_BACWK     AGIVFKIDEADEHAFKKMHVRPRSELVTLRLED-----DINPKEITGKYLEPKDFYEAMKQEDTVIIDAR
Y572_OCEIH      HDMTFKIDPHEGHTFKKMHVRPRPELVTLRLED-----DVNPLETTGEYLEPKDFYQALQDENTVVLDAR
Y1464_BACCN     AGIVFKVDEADGHAFKKMHVRPRSELVTLRLED-----DINPKELTGKYLEPKEFYEAMQQEETIVIDAR
Y2770_STAA2     KDMVFKIDEAEGHAFKKMHVRPRKEIVALDLED-----DVDPRHTTGQYLSPVEFRKALEDDDTVIIDAR
Y2713_STAA9     KDMVFKIDEAEGHAFKKMHVRPRKEIVALDLED-----DVDPRHTTGQYLSPVEFRKALEDDDTVIIDAR
Y2689_STAAM     KDMVFKIDEAEGHAFKKMHVRPRKEIVALDLED-----DVDPRHTTGQYLSPVEFRKALEDDDTVIIDAR
Y2673_STAA1     KDMVFKIDEAEGHAFKKMHVRPRKEIVALDLED-----DVDPRHTTGQYLSPVEFRKALEDDDTVIIDAR
Y2481_STAAN     KDMVFKIDEAEGHAFKKMHVRPRKEIVALDLED-----DVDPRHTTGQYLSPVEFRKALEDDDTVIIDAR
Y2609_STAAW     KDMVFKIDEAEGHAFKKMHVRPRKEIVALDLED-----DVDPRHTTGQYLSPVEFRKALEDDDTVIIDAR
Y2575_STAAS     KDMVFKIDEAEGHAFKKMHVRPRKEIVALDLED-----DVDPRHTTGQYLSPVEFRKALEDDDTVIIDAR
Y3024_STAA8     KDMVFKIDEAEGHAFKKMHVRPRKEIVALDLED-----DVDPRHTTGQYLSPVEFRKALEDDDTVIIDAR
Y2691_STAAT     KDMVFKIDEAEGHAFKKMHVRPRKEIVALDLED-----DVDPRHTTGQYLSPVEFRKALEDDDTVIIDAR
Y2622_STAA3     KDMVFKIDEAEGHAFKKMHVRPRKEIVALDLED-----DVDPRHTTGQYLSPVEFRKALEDDDTVIIDAR
Y2587_STAAE     KDMVFKIDEAEGHAFKKMHVRPRKEIVALDLED-----DVDPRHTTGQYLSPVEFRKALEDDDTVIIDAR
Y262_STAES      ADLTFKIDEAESHAFKKMHVRPRREIVALDLEE-----DINPREITGKYYSPKEFKAALEDENTVILDAR
Y1123_ACHLI     EDIFFKIDEVDAHAFSKMHVRVKKELVNLSLED-----DVNPLEITGKYLEPIEFYQKLQDPNTVVIDAR
Y2316_STAEQ     ADLTFKIDEAESHAFKKMHVRPRREIVALDLEE-----DINPREITGKYYSPKEFKAALEDENTVILDAR
Y2713_STAAC     KDMVFKIDEAEGHAFKKMHVRPRKEIVALDLED-----DVDPRHTTGQYLSPVEFRKALEDDDTVIIDAR
Y2771_STAAR     KDMVFKIDEAEGHAFKKMHVRPRKEIVALDLEE-----DVDPRHTTGQYLSPVEFRKALEDDDTVIIDAR
YBFQ_BACSU      ADMVFKIDEAEGHAFKKIFVRHKKELVTLRLED-----DVDPNETTGQHLKPAEFYEKMQDPNTIVIDAR
Y2565_STAAB     KDMVFKIDEAEGHAFKKMHVRPRKEIVALDLEE-----DVDPRHTTGQYLSPVEFRKALEDDDTVIIDAR
Y2303_STACT     KDITFKIDEAEGHAFKKMHVRPRHEIVALDLE-----NDIDPRETTGKYLSPSEFREALEDDDTIVIDAR
Y205_BACP2      ASMPIKIDEADGHAFKKMHVRHRNELVNLSLED-----DVNPLELTGKHLSPVEFYEQMQSPDTVVIDAR
Y274_BACA2      ADMPIKIDEADGHAFRKMFVRHKKELVTLRLED-----DVDPNVTTGKHLKPKDFYEQMQDPDTIVIDAR
Y085_ONYPE      CNTVFKMETVEAHVFPRLSIKVKPELVNLSLQEN-----VDLTKDKGAYLAPQEFLQALQEKDTLILDAR
Y630_AYWBP      CNTVFKIENVDAQVFPRLSIKVKPELVNLSLEEK-----VDLTKDKGAYLAPQEFLQALQEKDVLILDAR
Y2691_CYTH3     EALEFKIEAHEGHAFQKLYVRVKPEIVHSSLK------HVDPTKRTGKHLEPAEFKAMKXXXXXXXXXXX
Y2281_BRUO2     GEPELKYSHASEMPFHRMKVRLKREIVTMGVEG------IDPLKSVGTYIAPKDWNALIADENTVVVDTR
Y3086_BRUSU     GEPELKYSHASEMPFHRMKVRLKREIVTMGVEG------IDPLKSVGTYIAPKDWNALIADENTVVVDTR
Y2589_BRUC2     GEPELKYSHASEMPFHRMKVRLKREIVTMGVEG------IDPLKSVGTYIAPKDWNALIADENTVVVDTR
Y800_BRUA1      GEPELKYSHASEMPFHRMKVRLKREIVTMGVEG------IDPLKSVGTYIAPKDWNALIADENTVVVDKR
Y2897_LEGPA     ADLHFKETYDNKNPFDKAKVKLRKEIVTMGVQK------VDPSYNTGTYLSPEEWHQFIQDPNVILLDTR
Y2585_BRUA2     GEPELKYSHASEMPFHRMKVRLKREIVTMGVEG------IDPLKSVGTYIAPKDWNALIADENTVVVDKR
Y2390_BRUMB     GEPELKYSHASEMPFHRMKVRLKREIVTMGVEG------IDPLKSVGTYIAPKDWNALIADENTVVVDKR
Y2386_BRUAB     GEPELKYSHASEMPFHRMKVRLKREIVTMGVEG------IDPLKSVGTYIAPKDWNALIADENTVVVDKR
Y996_CHLFF      SNVKFKIHHIEENIFPRATVKYRKELVALGC-DVDLSNQ-------GKHISPKEWHEKLEENRCLVLDVR
Y007_BRUME      GEPELKYSHASEMPFHRMKVRLKREIVTMGVEG------IDPLKSVGTYIAPKDWNALIADENTVVVDKR
Y4255_OCHA4     ADPELKYSHATEMPFHRMKVRLKREIVTMGVDG------IDPLKSVGTYIAPQDWNALIADENTVVVDTR
Y2591_BRUSI     GEPELKYSHASEMPFHRMKVRLKREIVTMGVEG------IDPLKSVGTYIVPKDWNALIADENTVVVDTR
Y3122_LEGPC     ADLHFKETYDSKNPFDKAKVKLRKEIVTMGVQK------VDPSYNAGTYLSPEEWHQFIQDPNVILLDTR
Y010_CHLCV      SNVKFKIHHIEENIFPRVTVKYRKELVALGCDVD--------LTTQGKHISPKEWHEKLKENRCLVLDVR
Y2838_LEGPH     ADLHFKETYDNKNPFDKAKVKLRKEIVTMGVQK------VDPSYNAGTYLSPEEWHQFIQDPNVILLDTR
Y010_CHLAB      SNVKFKIHHIEENIFPRVTVKYRKELVALGC-DVDLSNQ-------GKHISPQEWHEKLEENRCLVLDVR
Y680_CHLTA      ASIKFKIHHIEENIFPRVTVKYRKELVALGCS----------VDTTGKHISPEEWHEKLQENRCLVLDVR
Y627_CHLTR      ASIKFKIHHIEENIFPRVTVKYRKELVALGCS----------VDTTGKHISPEEWHEKLQENRCLVLDVR
Y2780_TERTT     DALEHKESVATEQPFYRLKIKLKKEIVTMGVEG------IDPNLVVGTYVAPAEWNALISDPDVTVIDTR
Y2750_LEGPL     ADLHFKETYDNKNPFDKAKVKLRKEIVTMGVQK------VDPSYNAGTYLSPEEWHQFIQDPNVILLDTR
Y916_CHLMU      ATVKFKIHHIKENVFPRVTVKYRKELVALGCSVD--------TSKQGKHISPEEWHEKLQENRCLVLDVR
Y891_CHLT2      ASIKFKIHHIEENIFPRVTVKYRKELVALGCS----------VDTTGKHISPEEWHEKLQENRCLVLDVR
Y885_CHLTB      ASIKFKIHHIEENIFPRVTVKYRKELVALGCS----------VDTTGKHISPEEWHEKLQENRCLVLDVR
Y1091_BARBK     QTPELKYSWASKMPFHRIKVRLKKEIVTMGVEG------INPLKAVGTYVAPEDWNALIQDEETLVVDTR
Y2992_RHILO     AGLEVKFSSATDMPFHRMKVRLKREIVTMGVED------IDPATSAGTYVAPADWNALISEPGTIVIDTR
Y3407_PSYIN     NKLTTKESFTEENPFYRTKVKLKKEIVTMGVEG------IDPKRTAGSYVKPKDWNALISDPDVLLVDTR
Y3401_RHILW     SGLEHKESRASKMPFLRMKVKLKKEIVTMGVED------IDPNKVVGTYVAPQEWNALISDPDTIVIDTR
Y2130_SHEPC     DNIVYKLSFDDEMPFYRTKVKLKNEIVTMGVEG------IDPLKVVGTYVKPKDWNALISDPDVILVDTR
Y1881_SHESW     DNIVYKLSFDDEMPFYRTKVKLKNEIVTMGVEG------IDPLKVVGTYVKPKDWNALISDPDVILVDTR
Y1007_BARQU     QTPEIKYSWASKMPFHRMKVRLKKEIVTMGVEG------INPLKIVGTYVDPEDWNALIQDEETLLIDTR
Y6152_NOSP7     ADLEYKESYTETPPFERMKVRLKSEIVTLGLPE------IDPTEKVGTYVSPQEWNDLICDPEVTVIDTR
Y2319_METFK     VDIDHKESFADEMPFYRMKVRLKKEIVTLGVPG------ISPNKKVGTYVKPEDWNTLISDPDVVVIDTR
Y384_ANASP      QDLEHKESTADTPPFERMKVRLKKEIVTLGLPE------VDPNEQVGAYVTPEEWNELISDPEVIVIDTR
Y2481_SHEB9     DNIVHKLSFDDEMPFYRTKVKLKNEIVTMGVEG------IDPLKVVGTYVKPQDWNALISDPDVILVDTR
Y2366_SHEB8     DNIVHKLSFDDEMPFYRTKVKLKNEIVTMGVEG------IDPLKVVGTYVKPQDWNALISDPDVILVDTR
Y771_ACIBY      NAMEYKESHSSDKPFRKMKIKLKKEIVTLGVE-------VKPRDLVGHYLDPKEWNELIARDDVILIDTR
Y768_ACIBS      NAMEYKESHSSDKPFRKMKIKLKKEIVTLGVE-------VKPRDLVGHYLDPKEWNELIARDDVILIDTR
Y4166_RHIL3     SGLEHKESRASKMPFLRMKVKLKKEIVTMGVED------IDPNKVVGTYVAAKDWNTLISDPDTIVIDTR
Y2378_SHEB5     DNIVHKLSFDDEMPFYRTKVKLKNEIVTMGVEG------IDPLKVVGTYVKPQDWNALISDPDVILVDTR
Y2825_ANAVT     QDLEHKESTADTPPFERMKVRLKKEIVTLGLPE------VDPNEQVGTYVTPEEWNELISDPEVIVIDTR
Y2782_SINMW     ADLVHKESRASAMPFLRMKVRLKKEIVTMGVEN------IDPKKVVGTYVEPKDWNALISDPETLVIDTR
Y2261_SHESA     ENIVYKLSFDDEMPFYRTKVKLKKEIVTMGVEG------IDPLKVVGTYVKPQDWNALISDPEVILVDTR
Y1981_SHEB2     DNIVHKLSFDDEMPFYRTKVKLKNEIVTMGVEG------IDPLKVVGTYVKPQDWNALISDPDVILVDTR
Y2524_SHEPA     DNIVYKLSFDDVMPFYRTKVKLKKEIVTMGVEG------IDPKKVVGTYVKPKDWNQLISDPEVLLVDTR
Y1276_BARHE     QMPEIKYSWASKMPFHRMKVRLKKEIVTMGVDG------VNPLKAVGTYVDPKDWNALIQDEETLLIDTR
Y734_CHLPN      SXXXXXXXXXXXXXXPRITVKYRKELAALGCEVD--------LSKQAKHISPQEWHEKLQENRCLILDVR
Y3638_RHIEC     ARLEHKESRASKMPFLRMKVKLKKEIVTMGVED------IDPNKVVGTYVAPRDWNALISDPDTIVIDTR
Y2917_ACIAD     HAMEYKESHSAEKPFRKMKIKLKQEIVTLGVE-------VKPRDLVGHYLDPKEWNELISRDDVILVDTR
Y2887_RHIME     AGLIHKESRASAMPFLRMKVRLKKEIVTMGVEN------IDPKKVVGTYVEPKDWNALISDPETLVIDTR
Y1760_SHESM     ENIVYKLSFDDEMPFYRTKVKLKKEIVTMGVEG------IDPLKVVGTYVKPQDWNALISDPEVILVDTR
Y2290_SHEON     ENITYKLSFDDEMPFYRTKVKLKKEIVTMGVEG------IDPLKVVGTYVKPKDWNALISDPEVVLVDTR
Y378_PARUW      ETMPFKIHSHHENVFPRQTVKYRKQLVAL---DEDVD-----MNQTGQHISPXXXXXXXXXXXXXXXDVR
Y2937_RHISN     TGLEHKESRAAAMPFLRMKVRLKKEIVTMGVET------IDPNQVVGTYVEPKDWNALIADPETLVIDTR
Y1838_SHESR     ENIVYKLSFDDEMPFYRTKVKLKKEIVTMGVEG------IDPLKVVGTYVKPQDWNALISDPEVILVDTR
Y2660_SHESH     DNIVHKRSFDEQMPFYRTKVKLKKEIVTMGVEG------IDPLKVVGTYVKPRDWNKLISDPDVLLVDTR
Y1312_SACD2     ADIDHKESYEEEQPFYRMKVKLKKEIVTMGVEG------IDPNNIVGTYVEPKDWNSLIDDPEVIVVDTR
Y1496_SYNP2     ADLTYKVSTAPKQPFKRLKVKLKQEIVTLG------QPNVDPNNTVGTYIDPKDWNDLIQNPDVTLVDTR
Y1075_ACAM1     ADLAPKESWSEKRPFYRMKVRLKKEIIKMGVPD------IDPTQTVGEYVKPEDWNQLLADPDVVVIDVR
Y584_ROSDO      DGLEWKEAQSERANFGKMKVRIKREIVTMK------QPDVDPRAKTGHYVTPADWNALIAQPDVAVIDTR
Y091_SILPO      SDLEWKEATSDHPPFGKMKVRLKQEIVTMG------QPDVDPRARVGHYVEPEDWNDLIRSDDVVLIDTR
Y6657_VIBHB     NGIVYKESYSDTQPFNRTKVKLKKEIVTLGVEG------IDPRHVVGTYVKPQDWNDLIADPEVFVVDTR
Y5597_VIBPA     TGTVYKESYSETQPFNRTKVKLKKEIVTLGVEG------IDPRHVVGTYVKPQDWNDLIADPEVFVVDTR
Y1781_SHELP     DNIVYKLSFDDEMPFYRTKVKLKKEIVTMGVEG------IDPRKVVGTYVKPKDWNKLISDPEVLLIDTR
Y789_FRATN      VDIDYKESYHQEMPFYRSKVKLKKEIVTLGVDE------IDPNKICGKYVEPKDWNDLISDPETVLIDTR
Y370_PSYA2      GSFTFKESYTDAQPFYRTKVKLKKEIVTMGVEN------IDPLQSVGRYVKPSDWNALISDPDVILIDTR
Y1885_SHEPW     DNIVHKLSFDDDMPFYRTKVKLKKEIVTMGVEG------IDPNEVVGTYVKPKDWNALISDPEVLLVDTR
Y960_RICRS      KDVNVKINYSDVHPFQKLKVRLKKEIIAMNVDDLNVDL------FKGEYIEPKDWDEFITKQDVIVIDTR
Y674_LEPBL      KDMLLKIAEDDHRSFLKLDLKVRNKIVADGLNDDAFD-----VTNVGKHLSAEEFNRCMEDKNSIVVDVR
Y522_HAHCH      ADLSYKESYDENIPFYRTKVKLKKEIVTMGVEG------IDPKRVVGTYVKPQDWNALITDPEVLLIDTR
Y411_PSYCK      GSFTFKESYTDAQPFYRTKVKLKKEIVTMGVEN------IDPLQSVGRYVKPSDWNALISDPDVILIDTR
Y4030_RICPU     KDVNVKINYSDVHPFQKLKVRLKKEIVAMNVDDLNVDL------FKGEYIEPKDWDEFITKQDVIVIDTR
Y2438_LEPBJ     KDMLLKIAEDDHRSFLKLDLKVRNKIVADGLNDDAFD-----VTNVGKHLSAEEFNRCMEDKNSIVVDVR
Y208_RICRO      KDVNVKINYSDVHPFQKLKVRLKKEIIAMNVDDLNVDL------FKGEYIEPKDWDEFITKQDVIVIDTR
Y716_WOLPP      RDLTWKESAAEYQPFSKMKVRLKREIVNLGVSNLD-------TSVRGQYIDPDYWDDFISQPDVLVIDTR
Y3658_PSEU2     IDIDHKESYCDEQPFYRTKVKLKKEIVTLGVEG------VDPNKSVGTYVEPKDWNDLISDPEVLLIDTR
Y1973_SHEWM     DSIVHKLSFDETMPFYRTKVKLKKEIVTMGVEG------IDPLKVVGTYVKPKDWNQLISDPEVLLVDTR
Y175_RICM5      KDVNVKINYSDVHPFQKLKVRLKKEIVAMNVDDLNVDL------FKGEYIEPKDWDEFITKQDVIVIDTR
Y1734_PSESM     IDIDHKESYCDEQPFYRTKVKLKKEIVTLGVEG------VDPNKSVGTYVEPKDWNDLITDPEVLLIDTR
Y1391_FRATW     VDIDYKESYHQEMPFYRSKVKLKKEIVTLGIDE------IDPNKICGKYVEPKDWNDLISDPETVLIDTR
Y1229_FRATM     VDIDYKESYHQEMPFYRSKVKLKKEIVTLGIDE------IDPNKICGKYVEPKDWNDLISDPETVLIDTR
Y1178_FRATF     VDIDYKESYHQEMPFYRSKVKLKKEIVTLGIDE------IDPNKICGKYVEPKDWNDLISDPETVLIDTR
Y1118_FRATH     VDIDYKESYHQEMPFYRSKVKLKKEIVTLGIDE------IDPNKICGKYVEPKDWNDLISDPETVLIDTR
Y1091_FRATO     VDIDYKESYHQEMPFYRSKVKLKKEIVTLGIDE------IDPNKICGKYVEPKDWNDLISDPETVLIDTR
Y1085_FRATT     VDIDYKESYHQEMPFYRSKVKLKKEIVTLGIDE------IDPNKICGKYVEPKDWNDLISDPETVLIDTR
Y1085_FRAT1     VDIDYKESYHQEMPFYRSKVKLKKEIVTLGIDE------IDPNKICGKYVEPKDWNDLISDPETVLIDTR
Y3678_PSE14     IDIDHKESYCDEQPFYRTKVKLKKEIVTLGVEG------VDPNKSVGTYVEPKDWNALITDPEVLLIDTR
Y2744_RENSM     NDIDVKWSEGSAADFPRLSVKVRDEIVSFG-APGELEVDQNGVVGGGTHLQPEELHELVAQKDVVFFDGR
Y1677_MARMM     DTLEHKESHADTQPFLRMKVRLKREIVTMGV------TDIDPVDDVGTYVEPEDWNDLISAPDVVTIDTR
Y2535_MARMS     DKIVSKESYDEDMPFYRTKVKLKKEIVTMGVEG------IDPKRVVGTYVKPSEWNALISDPDVVLVDTR
Y4604_VIBSL     ADVVYKESFNEEQPFNRTKVKLKKEIVTMGVEG------IDPRHVVGTYVKPNEWNALISDPDVILVDTR
Y315_ANAMM      RGMKYHESHSDREPFAKMKVRLKREVVRLGIDGFD-------CSLRGEYIDPRDWDEFVSSPDVHVIDTR
Y234_ANAMF      RGMKYHESHSDREPFAKMKVRLKREVVRLGIDGFD-------CSLRGEYIDPRDWDEFVSSPDVHVIDTR
Y2100_SHEDO     DNIVSKVSFDAQMPFYRTKVKLKKEIVTMGVEG------IDPRKVVGTYVKPKDWNALISDPDVILVDTR
Y1135_WOLPM     RDLTWKESAAEYQPFSKMKVKLKREIVNLGVSNLD-------ISLRGKYVDPEHWDDFTSQPDVLVIDTR
Y4798_COLP3     DNISHKESYSEENPFHRTKVKLKKEIVTMGIEG------IDPNQVVGTYVKPKDWNALISDPEVVLVDTR
Y240_CORJK      KKMEFKWSAGSADDFPRLSVKVREEIVAFGAPD-ELKVDENGVIGGGVHLKPEEVNKLVEEREVVFFDGR
Y167_RICCN      KDVNVKINYSDVHPFQKLKVRLKKEIVAMNVDGLNVDL------FKGEYIEPKDWDEFITQQDVIVIDTR
CI097_MOUSE     KDYLFKSSKGGSHCFPELRVGVFEEIVPMGISPSQVS-----YKKPGIHLSPGEFHEKLLSQDTIILDCR
Y4090_PSEPF     VDIDHKESYCDEQPFYRTKVKLKKEIVTLGVEG------VDPNKKVGTYVEPKDWNALISDPEVLLIDTR
Y1846_FRAP2     ADIDYKESYHQEMPFYRSKVKLKKEIVTLGIEE------IDPNKVCGKYVEPKDWNALISDPETILVDTR
Y156_RICAE      KDVNVKINYSDVHPFQKLKVRLKKEIVAMNVDGLNVDL------FKGEYIEPKDWDEFITKQDVIVIDTR
Y1433_PSEHT     NNIVTKESYDDECPFYRTKVKLKKEIVTMGVEG------IDPLKVVGSYVKPNEWNALISDPEVILIDTR
Y1758_PSEPK     VDIDHKESYCDEQPFYRTKVKLKKEIVTLGVPG------VDPNKAVGTYVEPKDWNALISDPEVLLIDTR
Y1365_PSEPW     VDVDHKESYCDEQPFYRTKVKLKKEIVTLGVPG------VDPNNAVGTYVEPKDWNALISDPEVLLIDTR
Y962_ANAPZ      ADMKYHESYSSRLPFSKMKVRLKKEVVRLGIDDFDCSS------MRGEYVDPKAWNDLITKPGMHVIDTR
Y8368_RHOBA     DVKWSYCEEIP---FRKTKVRLKREIVTMGV------SSIDPLRSVGTYIEPQDWNALVDDPDVTLIDTR
Y1259_VIBCH     KGTVYKESSASEPPFNRTKVKLKKEIVTMGVEG------IDPRHVVGTYVKPQDWNALISDPEVLVVDTR
Y925_RICAH      KDVNVKINYSDVHPFQKLKVRLKKEIVAMNVEGLNVDL------FKGEYIEPKDWDEFITKQNVIVIDTR
Y4491_AGRT5     AALEHKESRASHMPFVRLKVKLKKEIVTMGVPD------IDPNRIVGTYVDPRDWNALISDPDTIVIDTR
Y3956_PSEP1     VDVDHKESYCDEQPFYRTKVKLKKEIVTLGVPG------VDPNQAVGTYVEPKDWNALISDPEVLLIDTR
Y1477_PSEE4     VDVDHKESYCDEQPFYRTKVKLKKEIVTLGVPG------VDPNKAVGTYVDPKDWNALISDPEVLLIDTR
Y765_SYNY3      TSVPQRHSWAKTIPFQRMKVKIKPEIVSLG------QPQVNPEKQVGTYVSPQQWNQLLQDPDVVVIDTR
Y4311_PSEFS     VDIDHKESYCDDQPFYRTKVKLKKEIVTLGVEG------VDPNKKVGTYVEPQDWNALISDPEVLLIDTR
Y4325_PSEF5     VDIDHKESYCDEQPFYRTKVKLKKEIVTLGVPG------VDPNKKVGTYVEPQDWNALISDPEVLLIDTR
Y2830_COREF     AKMEFKWSEGGAEDFPKLSVKVRDEIVAFG-APNEIKVDENGIIGGGVHLKPEEVNQLVEEREVVFFDGR
Y1760_CORU7     KGMEFKWSQGGAEDFPRLSVKVRDEIVSFG-APGELKVDENGVIGGGTHLKPEEVNKLVEERDVVFFDGR
Y038_WOLTR      KDLTWKESAAKYQPFSKMKVRLKREIVNLGVSNLD-------TSLRGKYIDPDHWDDFISQPDVLVIDTR
Y2448_CORA7     KKMEFKWSEGGAEDFPRLSVKVRDEIVAFG-APGELKVDENGVIGGGVHLKPEEVNKLVEEREVVFFDGR
Y1113_CAUCN     ADLTPKTAWAERMPFYRMKVRLKKEIVTLG------EPDLDPTD-AGTYVEPADWNALISDPDVLVIDTR
Y1060_CAUCR     ADLTPKTAWAERMPFYRMKVRLKKEIVTLG------EPDLDPTD-AGTYVEPADWNALISDPDVLVIDTR
Y255_NEOSM      RGLEWKESYTNFQPFQEMKVRLKKEIVALGCAELE---NMEICET-GEYVEPEDWSSLIAREDVKTIDTR
Y114_RICTY      KDVNVKINYSSVHPFQKLKVRLKKEIIAMNVKD------LNIEVFKGDYIEPKDWDEFITKQNVIVIDTR
Y895_GLUOX      ADLESKDSRAPELPFRRMKVRLKKEIVTMG------EPDIDPRQGVGRYVAPEDWNALISDPDTILIDTR
Y635_RICCK      KDVNVKINYSDLHPFQKLKVRLKKEIVAMNVDDLNVDL------FKGEYIESKDWDSFITKQDVIVIDTR
Y3365_ARTS2     HGIDVKWSDGGAEDFPRLSVKVRDEIVSFG-APGELKVDANGVVGGGTHLKPEEL-HRLVDEEVVFFDGR
Y1435_RICB8     KDVNVKINYSEIHPFQKLKVRLKKEIVAMNVDN------LNVNLFKGEYIETKDWDEFITKQDVIVVDTR
Y1241_PHOPR     TDVVYKESFDENQPFNRTKVKLKKEIVTMGVEG------IDPRHVVGTYVKPKDWNALIADPDVFVVDTR
Y3316_ALISL     ADVVYKESINDVQPFNRTKVKLKKEIVTMGVEG------IDPLHVVGTYVKPADWNALISDPDVLLVDTR
Y2992_CORGL     NRMQFKWSEGGAEDFPKLSVKVRDEIVAFGAPD-ELKVDENGVVGGGVHLKPQQVNELVEAREVVFFDGR
Y1349_PSEPG     VDVDHKESYCDEQPFYRTKVKLKKEIVTLGVPG------VDPNQAVGTYVEPKDWNALISDPEVLLIDTR
CI097_PONAB     XXXXXXXXXXTSKGFPELRVGVFEEIVPMGISPKKIS-----YKKPGIHLSPGEFHKEVEQSDTILLDCR
Y2881_CORGB     NRMQFKWSEGGADDFPKLSVKVRDEIVAFGAPD-ELKVDENGVVGGGVHLKPQQVNELVEAREVVFFDGR
Y1100_DEIRA     DRLEYKESQASEKPFKRYKVRLKKEIVTLGVP-------VAPREQVGTYLDPQAWNDLLADPEVIVVDTR
CI097_HUMAN     XXXXXXXXXXTSKGFPELRVGVFEEIVPMGISPKKIS-----YKKPGIHLSPGEFHKEVEQSDTILLDCR
Y2301_CORDI     RGTEFKWSDGGAEDFPKLSVKVRDEIVAFG-APGELKVDEKGVIGGGVHLKPEEVNKLVEERDVVFFDGR
Y4661_PSEA7     ADIEHKESYCDEQPFYRTKVKLKKEIVTLGVPG------VDPNKRVGQYVEAKDWNALISDPEVLLIDTR
Y858_PSEAE      ADIEHKESYCDEQPFYRTKVKLKKEIVTLGVPG------VDPNKQVGQYVEAKDWNALISDPEVLLIDTR
Y4460_PSEA8     ADIEHKESYCDEQPFYRTKVKLKKEIVTLGVPG------VDPNKQVGQYVEAKDWNALISDPEVLLIDTR
Y125_RICPR      KDVNVKINYSPVHPFQKLKVRLKREIIAMNVKDLNVD------VFKGHYIEPKDWDEFITKQNVILIDTR
Y1169_RICBR     KDVNVKINCSEIHPFQKLKVRLKKEIVAMNVDN------LNVNLFKGEYIETKDWDEFITKQD-VIVDTR
Y5318_PSEAB     ADIEHKESYCDEQPFYRTKVKLKKEIVTLGVLG------VDPNKQVGQYVEAKDWNALISDPEVLLIDTR
Y2351_IDILO     ADIEHKESPSDEQAFYRTKVKLKKEIVTLGVDW------VDPKSSVGTYVDPEKWNDLIADPEVLVIDTR
Y654_PROMT      SDINVKYSWSEKQXXXXXXXXXXXEIVTIGLKE------INPTKSVGKYIKAGEWNQFLEDPNSVVIDTR
Y011_JANSC      AGLEWKESTATAAPFGKLKVRLKTEIVSMGAPGLD------PADV-GTHVAPAEWNALISAPDVAVIDTR
Y1693_PSEMY     ADIDHKESYCDEQPFYRTKVKLKKEIVTLGVPG------VDPNQRVGTYVEPQDWNALISDPEVLLIDTR
Y1486_PROM1     SDINVKYSWCEXXXXXXXXXXXXXEIVTIGLKE------INPTKSVGKYIKAGEWNQFLEDPDSVVIDTR
Y3153_ARTCA     HGIDVKWSDGGAEDFPRLSVKVRDEIVSFG-APGELTVDAXXXXXXXTHLKPEELHELVEAREVVFFDGR
Y1961_RHOFD     ADLQHKEAWSAKAPFYRMKVRLKREIVTMGVPG------IDPNLVVGTYVKPQDWNALIGDPDVVVIDTR
Y794_KOCRD      QHADIKWSDGAGDDFPRLSVKVRPELVTFDAPDLIRVTE-HGVEGGGTHLTPHEVHELVRGEDVVFFDGR
Y1395_SYNS9     ERLEVKRSWADQAVFRRFKARAKKEIVTMGV------TSVNPRQNVGTYVDPKDWNDLVDDPDTLVIDTR
Y2203_SYNP6     ANLSFKSATVTDWPFARLKVKVKPEIVSLGCPE------LNPAERTGTLVAPQDWNQLLQDPEVVLIDVR
Y1892_SYNE7     ANLSFKSATVTDWPFARLKVKVKPEIVSLGCPE------LNPAERTGTLVAPQDWNQLLQDPEVVLIDVR
Y1635_SYNSC     DEHYARLEVKRSWAEKPVFRRFKKEIVTIGVAS------VDPSTSVGTYVEAEHWNALVDDPDTLVIDTR
Y896_EHRCR      KDIRYHKSFAMHNPFSKMKVKLRKELVCLGIED--FDNSV-----CGEYVSPQDWDDLISRSDVYTIDTR
Y976_LEPIC      KDMQFKIAEXXXXXXXXXXXXXXXXXVADGLNDDAFD-----VTNVGKHLSAEEFNLHMEDENSIVVDVR
Y3128_LEPIN     KDMQFKIAEXXXXXXXXXXXXXXXXXVADGLNDDAFD-----VTNVGKHLSAEEFNLHMEDENSIVVDVR
Y2998_NITWN     NDLELKFSQASAMPFARLKVRLKKEIVTLG------DPATDPTRAVGIYVDPQDWNELIATPDTILLDVR
Y1101_PROMA     TPLEIKYSYTSRQXXXXXXXXXXNEIVTMGVEN------VDPCKTTGKYVEPEDWNAFLDDPLTLVIDTR
Y2579_YERPB     DQVRLNVAHEDDKSFWVLRLKVRERIVADGIDDDSFDP-----ANIGHYLKADQVNQMIDDPDTLFVDMR
Y2488_YERPS     DQVRLNVAHEDDKSFWVLRLKVRERIVADGIDDDSFDP-----ANIGHYLKADQVNQMIDDPDTLFVDMR
Y2451_YERPE     DQVRLNVAHEDDKSFWVLRLKVRERIVADGIDDDSFDP-----ANIGHYLKADQVNQMIDDPDTLFVDMR
Y2048_YERPN     DQVRLNVAHEDDKSFWVLRLKVRERIVADGIDDDSFDP-----ANIGHYLKADQVNQMIDDPDTLFVDMR
Y1866_YERPP     DQVRLNVAHEDDKSFWVLRLKVRERIVADGIDDDSFDP-----ANIGHYLKADQVNQMIDDPDTLFVDMR
Y1668_YERPY     DQVRLNVAHEDDKSFWVLRLKVRERIVADGIDDDSFDP-----ANIGHYLKADQVNQMIDDPDTLFVDMR
Y1560_YERP3     DQVRLNVAHEDDKSFWVLRLKVRERIVADGIDDDSFDP-----ANIGHYLKADQVNQMIDDPDTLFVDMR
Y1569_ENT38     NNVRLNIADDDGKSFWVLRMKVRERIVADGIDDPTFN-----ASDVGEYLKAAEVNAMLDDPDAVFIDMR
Y3187_RHOE4     RTADIKWSDGLGNDFPRLSVKARSEIVTFGAPD-ELKVDENGVVGGGVHLAPKELHELVDSRDVVFFDGR
Y206_EHRCJ      KDIQHHESFSTHNPFSKMKVKLRNELVRLGIEN--FDNSV-----CGEYVSPQNWDDLISRSDVYTIDTR
Y1816_PHOLL     DNLRLNIADDDGKSFWVLRMKVRDRVVADGIDDETFDPS-----KTGEYLKAEQVNQMLDNPDTLFVDMR
Y1078_NITHX     DNLELKFSQASVMPFARLKVRLKKEIVTLG------DPATDPTRAVGIYVEPKDWNGLIAAPDTLLIDTR
YCEA_SALNS      DGLRLNIAEDDGKSFWVLRMKVRDRIVADGIDDPSFD-----ASNVGDYLKAADVNEMLDDPDAVFIDMR
Y857_RHOSR      KDADIKWSDGLGDDFPRLSVKVRPEIVTFG-APGELKVDADGVVGGGTHLAPDEVHRLVEGRDVVFFDGR
Y2059_ERWT9     DKLRMNIADDDGKSFWVLRLKVRERIVADGITDESFD-----ASDVGAYLKAAEVNAMLDDPEAVFVDMR
Y1185_PROM5     NQLNIKVSYSXXXXXXXXXXXXXNEIVTMGVPE------INPLEDAGTYIDSFNWNKLIKDKDTIVIDTR
Y932_SYNPX      GEQHFERLEAERSVFRRFKARRKKEIVTMGV------TGVDPRANVGTYVDPEDWNGLVDDPDTLVIDTR
Y1619_YERE8     DQVRLNVAHEDDKSFWVLRMKVRERIVADGIDDDSFDPS-----NVGHYLKADQVNQMIDDPDTLFVDMR
YCEA_ESCF3      NNLRLNIADDDGKSFWVLRMKVRERIVADGITDPDFD-----ASNVGNYLQAAQVNAMLDDPDALFIDMR
Y595_RHOOB      KDADIKWSDGLGNDFPRLSVKVRPEIVTFG-APGELKVDADGVVGGGTHLAPEEVHRLVEGRDVVFFDGR
YCEA_SALAR      DGLRLNIAEDDGKSFWVLRMKVRDRIVADGIDDPSFD-----ASNVGAYLKAAEVNAMLDDPDAIFIDMR
Y2131_BDEBA     PDQFFKDSESTKSPFRRFKVKVRNEIVTTGIPG------VMPPEGVNHHLSPTEWNKVMKEEDYVMIDTR
Y1094_PROMP     NKLNIKVSYSXXXXXXXXXXXXXDEIVTMGVPE------INPSEDSGTYIDSFSWNKLIKDKNTIVVDTR
YCEA_SALPB      DGLRLNIAEDDGKSFWVLRMKVRDRIVADGIDDPSFD-----ASNVGDYLKAADVNAMLDDPDAVFIDMR
YCEA_SALPK      DGLRLNIAEDDGKSFWVLRMKVRDRIVADGIDDPTFD-----ASNVGDYLKAADVNAMLDDPDAVFIDMR
YCEA_SALPA      DGLRLNIAEDDGKSFWVLRMKVRDRIVADGIDDPTFD-----ASNVGDYLKAADVNAMLDDPDAVFIDMR
YCEA_SALEP      DGLRLNIAEDDGKSFWVLRMKVRDRIVADGIDDPTFD-----ASNVGDYLKAADVNAMLDDPDAVFIDMR
YCEA_SALDC      DGLRLNIAEDDGKSFWVLRMKVRDRIVADGIDDPTFD-----ASNVGDYLKAADVNAMLDDPDAVFIDMR
YCEA_SALA4      DGLRLNIAEDDGKSFWVLRMKVRDRIVADGIDDPSFD-----ASNVGDYLKAADVNVMLDDPDAVFIDMR
Y201_EHRRG      CNLQYHKSFSRCNPFSKMKVKLRKELVCLGIED--FDNSVS-----GEYIDPENWDNFISRSDVYTIDTR
Y1886_SERP5     DQVRLNIAEDDGKSFWVLRLKVRERIVADGLDDESF----NPANV-GEYLQADRVNQMIDDPDTLFVDMR
YCEA_SALSV      DGLRLNIAEDDGKSFWVLRMKVRDRIVADGIDDPTFD-----ASNVGDYLKAADVNAMLDDPDAVFIDMR
YCEA_SALG2      DGLRLNIAEDDGKSFWVLRMKVRDRIVADGIDDPTFD-----ASNVGDYLKAADVNAMLDDPDAVFIDMR
YCEA_ECOSM      EGLRLNIAEDDGKSFWVLRMKVRDRIVADGIDDPHFD-----ASNVGEYLQAAEVNAMLDDPDALFIDMR
Y2403_BRAJA     DNLELKFSTAEAMPFGRLKVRLKKEIVTLG------DAAADPTRQVGTYVDAAAWNALIAAPDTLVLDTR
Y153_CORK4      KNADIKWSEGEGDDFPRLSVKVRPELVTFGAGDELKVNEEGVI-GGGTHLKPEDLHHLMDERDVVFFDGR
Y1055_PROMM     FEL--KISWTPEQAFRRFKVRRKAEIVTMGLAG------LNPSKTVGTYVDAHEWNXXXXXXXXXXXXXR
YCEA_SALHS      DGVRLNIAEDDGKSFWVLRMKVRDRIVADGIDDPTFD-----ASNVGDYLKAADVNAMLDDPDAVFIDMR
YCEA_SHIDS      EGLRLNIADDDGKSFWVLRMKVRDRIVADGIDDPHFD-----ASNVGEYLQAAEVNAMLDDPDALFIDMR
Y359_BUCAT      NNLRINKSLDNEKSFWVLCVKIKKKIVQDGIKEHFF----NP-NNVGIYIQSEQVNSMLNDKKTIFIDMR
Y358_BUCA5      NNLRINKSLDNEKSFWVLCVKIKKKIVQDGIKEHFF----NP-NNVGIYIQSEQVNSMLNDKKTIFIDMR
YCEA_SHISS      EGLRLNIADDDGKSFWVLRMKVRDRIVADGIDDPHFD-----ASNVGEYLQAAEVNAMLDDPDALFIDMR
YCEA_SHIFL      EGLRLNIADDDGKSFWVLRMKVRDRIVADGIDDPHFD-----ASNVGEYLQAAEVNAMLDDPDALFIDMR
YCEA_SHIF8      EGLRLNIADDDGKSFWVLRMKVRDRIVADGIDDPHFD-----ASNVGEYLQAAEVNAMLDDPDALFIDMR
YCEA_ECOLI      EGLRLNIADDDGKSFWVLRMKVRDRIVADGIDDPHFD-----ASNVGEYLQAAEVNAMLDDPDALFIDMR
YCEA_ECODH      EGLRLNIADDDGKSFWVLRMKVRDRIVADGIDDPHFD-----ASNVGEYLQAAEVNAMLDDPDALFIDMR
YCEA_ECOBW      EGLRLNIADDDGKSFWVLRMKVRDRIVADGIDDPHFD-----ASNVGEYLQAAEVNAMLDDPDALFIDMR
YCEA_ECO8A      EGLRLNIADDDGKSFWVLRMKVRDRIVADGIDDPHFD-----ASNVGEYLQAAEVNAMLDDPDALFIDMR
YCEA_ECO7I      EGLRLNIADDDGKSFWVLRMKVRDRIVADGIDDPHFD-----ASNVGEYLQAAEVNAMLDDPDALFIDMR
YCEA_ECO55      EGLRLNIADDDGKSFWVLRMKVRDRIVADGIDDPHFD-----ASNVGEYLQAAEVNAMLDDPDALFIDMR
YCEA_ECO27      EGLRLNIADDDGKSFWVLRMKVRDRIVSDGIDDPHFD-----ASNVGEYLQAAEVNAMLDDPDALFIDMR
YCEA_ECO24      EGLRLNIADDDGKSFWVLRMKVRDRIVADGIDDPHFD-----ASNVGEYLQAAEVNAMLDDPDALFIDMR
Y997_PROM3      FEL--KISWTPEQAFRRFKVRRKAEIVTMGLAG------LNPSKTVGTYVDAHEWNXXXXXXXXXXXXXR
Y2095_XANC8     AQMRVKYSHSAEQPFARLKVKVKPEIISFRRDD------ASPLQGRAPSVAPAVLRKWMQQRPLVLLDTR
Y2086_XANCP     AQMRVKYSHSAEQPFARLKVKVKPEIISFRRDD------ASPLQGRAPSVAPAVLRKWMQQRPLVLLDTR
YCEA_ECOSE      EGLRLNIADDDGKSFWVLRMKVRDRIVADGIDDPHFD-----ASNVGEYLQAAEVNAMLDDPDALFIDMR
YCEA_ECOLU      EGLRLNIADDDGKSFWVLRMKVRDRIVADGIDDPHFD-----ASNVGEYLQAAEVNAMLDDPDALFIDMR
YCEA_ECOL6      EGLRLNIADDDGKSFWVLRMKVRDRIVADGIDDPHFD-----ASNVGEYLQAAEVNAMLDDPDALFIDMR
YCEA_ECOL5      EGLRLNIADDDGKSFWVLRMKVRDRIVADGIDDPHFD-----ASNVGEYLQAAEVNAMLDDPDALFIDMR
YCEA_ECOK1      EGLRLNIADDDGKSFWVLRMKVRDRIVADGIDDPHFD-----ASNVGEYLQAAEVNAMLDDPDALFIDMR
YCEA_ECO45      EGLRLNIADDDGKSFWVLRMKVRDRIVADGIDDPHFD-----ASNVGEYLQAAEVNAMLDDPDALFIDMR
Y3487_KLEP3     AGLRFNIAEDDGKSFWVLRLKVRDRIVADGIDDPSFD-----ASNVGDYLKAADVNAMLDDPDAVFIDMR
Y330_BUCBP      KDINVNLALDNRESFWVLRMKVRKKILFDNLPIDFFDPN-----NVGTYLSAKDVNNMLENKNSVLVDMR
Y204_EHRRW      CNLQYHKSFSRCNPFSKMKVKLRKELVCLGIED--FDDSVG-----GEYIDPENWDNFISRSDVYTIDTR
YCEA_ECO81      EGLRLNIADDDGKSFWVLRMKVRDRIVADGIDDPLFD-----ASNVGEYLQAAEVNAMLDDPDALFIDMR
Y2387_XANCB     AQMRVKYSHSAEQPFARLKVKVKPEIISFRRDD------ASPLQGRAPSVAPAMLRKWMQQRPLVLLDTR
YCEA_SALCH      DGLRLNIAEDDGKSFWVLRMKVRDRIVADGIDDPSFD-----ASNVGDYLKAADVNVMLDDPDAVFIDMR
Y365_BUCAI      NNLRINKSLDNEKSFWVLCVKIKKKIVQDGIKEHFF----NP-NNVGIYIQSEQVNSMLNDKKTIFIDMR
Y1781_ERWCT     DQIRLNIAEDDGKSFWVLRMKVRERIVADGIDDPTF----NPANV-GQYLKADRVNAMADDPDTVFVDMR
YCEA_SALTY      DGVRLNIAEDDGKSFWVLRMKVRDRIVADGIDDPTFD-----ASNVGDYLKAADVNAMLDDPDAVFIDMR
YCEA_SALTI      DGVRLNIAEDDGKSFWVLRMKVRDRIVADGIDDPSFD-----ASNVGDYLKAADVNAMLDDPDAVFIDMR
Y1048_SODGM     DGLRLNVADDDGKSFWVLRMKVRPRIVADGIDDPTF----NPANV-GHYLKAEEVNALADDPQALFVDMR
Y2519_PECCP     DQIRLNIAEDDGKSFWVLRMKVRERIVADGIDDPTF----NPANV-GQYLKADQVNAMADDPDTVFVDMR
Y081_HAMD5      DQIRLNTAEDNGRSFWVLRMKVRQRIVADGIEDETF----NPAHT-GQYLKAHEVNEMIKDPDALFVDMR
Y2011_CITK8     NGLRLNIADDDGKSFWVLRMKVRERIVADGIDDPNFD-----ASDVGEYLKAAEVNAMLDDPDAVFIDMR
YCEA_ECOLC      R-LNIALDDDGK-SFWVLRMKVRDRIVADGIDDPHFD-----ASNVGEYLQAAEVNAMLDDPDALFIDMR
YCEA_ECOHS      R-LNIALDDDGK-SFWVLRMKVRDRIVADGIDDPHFD-----ASNVGEYLQAAEVNAMLDDPDALFIDMR
YCEA_ECO5E      R-LNIALDDDGK-SFWVLRMKVRDRIVADGIDDPHFD-----ASNVGEYLQAAEVNAMLDDPDALFIDMR
YCEA_ECO57      R-LNIALDDDGK-SFWVLRMKVRDRIVADGIDDPHFD-----ASNVGEYLQAAEVNAMLDDPDALFIDMR
Y1201_PROM0     KNLXXXXXXXXXXXXXXXXXXXXXEIVTMGIPE------INPSENNGTYIDSADWNKLIKNKNTIVIDTR
Y1105_PROM9     RNLXXXXXXXXXXXXXXXXXXXXXEIVTMGVPE------INPSENNGTYIDSANWNKLIKNQNTIVIDTR
Y2930_XANOM     ARMRIKYSESAYQPFARLKVKIKPEIISFRRDD------ASPLQGRAPSVTPAVLREWLRNRPLVLLDTR
Y2292_ENTS8     DGVRLNIADDDGKSFWVLRMKVRDRIVADGIDDPTFD-----ASDVGEYLKAAEVNAMLDDPDAVFIDMR
Y1514_XANOP     ARMRIKYSESAYQPFARLKVKIKPEIISFRRDD------ASPLQGRAPSVTPAVLREWLRNRPLVLLDTR
Y1230_PROM2     RNLXXXXXXXXXXXXXXXXXXXXXEIVTMGVPE------INPSENNGTYIDSTDWNKLIKNQNTIVIDTR
Y4043_DELAS     ADLAPKESWSDTVPFRKMLVKVKREIIRMD------HPTIRPAEGRAPSVSPATLRRWLEQREVVTLDTR
Y353_BUCAP      SDLELKSLSNHKKAFWVLSVKIKKKIVNDGITNPLFN-----FKKVGIYIKSRQVNMMLSDRNVIFIDMR
Y1200_PROMS     RNLXXXXXXXXXXXXXXXXXXXXXEIVTMGVPE------INPSENNGTYIDSAGWNKLIKNQNTIVIDTR
Y2109_XANAC     AQMRIKYSESKHQPFARLKVKIKREIISFRRDD------ASPLQGRAPSVTPAVLRKWLRNRPLVLLDTR
Y899_RALEH      ADIAPKESLSENQPFKRMLVRAKKEIITMKMPL------IRPEEGRAPSVRPAELKRWLDQRPVVMLDTR
Y1074_PELUB     KKF------DSENISKSKFQXXXXXXXXXXXXXXXMGLSLSSKNKKNNHIDPKKWNKLINDKDTLVLDSR
Y065_WIGBR      TDIRFNLSDXXXXXXXXXXXXXXXXXXXXXXXDCSFD-----IKNTGHKLTANDFNAILMKNDFILVDMR
Y839_BORBR      ADLQAKYSESARMPFRKLLVKVKREIIHPAIRPEAGRAPAVDAATLRRWLAQGRDDQG---RELVMLDTR
Y179_BORPE      ADLQAKYSESARMPFRKLLVKVKREIIHPAIRPEAGRAPAVDAATLRRWLAQGRDDQG---RELVMLDTR
Y754_BORPA      ADLQAKYSESARMPFRKLLVKVKREIIRMD------HPAIRPEAGRAPAVDAATLRRWLAQRELVMLDTR
Y753_RALME      ADIAPKESLSENQPFKRMLVRAKKEIITMKMPL------IRPEAGRAPSVRPVDLKRWLDQRPVVMLDTR
Y2353_BURCM     ETLQFKESLSDSQPFRRMLVRLKREIITMKKPA------IKPELGRAPSVDARTLK-AWLDRGVVMLDTR
Y2233_BURA4     ETLQFKESLSDSQPFRRMLVRLKREIITMKKPA------IKPELGRAPSVDARTLK-AWLDRGVVMLDTR
Y810_CUPTR      ADIAPKESLSENQPFKRMLVRAKKEIITMKMPL------IRPEAGRAPSVRPADLKRWLDQRPVVMLDTR
Y454_BAUCH      DQLRLNFADNNRQSFWMLRMKVKKLLVADGIQEPNF-NCFN----ANNYLKAEEVNILLENPNILFIDMR
Y3126_BURM9     EDLPFKESLSDSQPFRRMLVRLKREIITMKKPA------IKPELGRAPSVDARTLK-AWLDRPVVMLDTR
Y2842_BURMS     EDLPFKESLSDSQPFRRMLVRLKREIITMKKPA------IKPELGRAPSVDARTLK-AWLDRPVVMLDTR
Y2825_BURM7     EDLPFKESLSDSQPFRRMLVRLKREIITMKKPA------IKPELGRAPSVDARTLK-AWLDRPVVMLDTR
Y2535_RALEJ     ADIAPKESLSDNQPFKRMLVRAKKEIITMKRPL------IRPEEGRAPSVRPVDLKRWLDQRPVVMLDTR
Y1914_BURMA     EDLPFKESLSDSQPFRRMLVRLKREIITMKKPA------IKPELGRAPSVDARTLK-AWLDRPVVMLDTR
Y1354_BURP1     EDLPFKESLSDSQPFRRMLVRLKREIITMKKPA------IKPELGRAPSVDARTLK-AWLDRPVVMLDTR
Y1204_BURP0     EDLPFKESLSDSQPFRRMLVRLKREIITMKKPA------IKPELGRAPAVDARTLK-AWLDRPVVMLDTR
Y1196_BURP6     EDLPFKESLSDSQPFRRMLVRLKREIITMKKPA------IKPELGRAPSVDARTLK-AWLDRPVVMLDTR
Y1116_BURPS     EDLPFKESLSDSQPFRRMLVRLKREIITMKKPA------IKPELGRAPSVDARTLKAWLASRPVVMLDTR
Y2206_RALSO     ADLAPKESLSDHQPFRRLLVRLKKEIITMRYPL------IRPEDGRAPSLPPATLKRWLDQREVVMLDTR
Y2370_BURCJ     ETLQFKESLSDSQPFRRMLVRLKREIITMKKPA------IKPELGRAPFVDARTLKSWLTGRPVVMLDTR
Y2337_BURCC     ETLQFKESLSDSQPFRRMLVRLKREIITMKKPA------IKPELGRAPFVDARTLK-AWLDRGVVMLDTR
Y2314_BURCH     ETLQFKESLSDSQPFRRMLVRLKREIITMKKPA------IKPELGRAPFVDARTLK-AWLDRGVVMLDTR
Y4097_BORPD     ADLEAKFSLSETVPFRRLRVKIKREIIRMD------HPAIQPQSGRAPAVSPATLARWLEQRPVVMLDTR
Y983_BURTA      EDLPFKESLSDSQPFRRMLVRLKREIITMKKPA------IKP-ELGRAPSVDARMLKAWLDRGVVMLDTR
Y2403_BURVG     ETLQFKESLSDSQPFRRMLVRLKREIITMKKPA------IKPELGRAPSVDARTLK-AWLDRGVVMLDTR
Y5656_BURS3     ETLQFKESLSDSQPFRRMLVRLKREIITMKKPA------IKPELGRAPFVDAQTLKTWLTGRPVVMLDTR
Y1252_BURPP     EDLQFKESLSDKQPFTRMLVKLKREIITMKKPA------IRPELGRAPFVDAPTLKHWLQGRPVVMLDTR
Y471_BORA1      ADIEVKYSTSADVPFGKMRVRLKREIIRMN--HPAIRPEAGRAPSVNAHTLARWLEQGRDDREVVMLDTR
Y1152_BURXL     EDLQFKESLSDKQPFTRMLVKLKREIITMKKPA------IRPELGRAPFVDAPTLKSWLEGRPVVMLDTR
Y683_THIDA      ADLEPKLSLSAEAPFTRMRVRLKKEIITMKMPV------VRPEEGRAPAVAAATLKRWLDQRPVVMLDTR
Y2421_XANC5     AQMRIKYSESAHQPFARLKVKIKPEIISFRRDD------ASPLQGRAPSVTPAVLREWLRNRPLVLLDTR
Y2090_XYLF2     AALHVKYSVSAYKPFARFKVKVRPEIISFRR------GDISPLQVRAPGVSAHTLRDWLRGRRLVMLDAR
Y1985_XYLFT     AALHVKYSVSAYKPFARFKVKVRPEIISFRR------GDISPLQVRAPGVSAHTLRDWLRGRRLVMLDAR
Y2609_XYLFA     AALHVKYSVSAYKPFARFKVKVRPEIISFRR------GDISPLQGRAPGVSAHTLRDWLRGRRLVMLDAR
Y3119_VARPS     ADLETKESWSAAQPFRRMLVKLKREIIRMD------HPAIQPAAGRAPGVDAPTLKRWLDQREIALLDTR
GLPE_PSEA6      -----------------------------------------------AHISVQETQQKLAAKEARLVDIR
GLPE_COXBU      -------------------------------------------------ISHLEAWELVKKRDIVIADVR
GLPE_COXBR      -------------------------------------------------ISHLEAWELVKKRDIVIADVR
GLPE_COXB2      -------------------------------------------------ISHLEAWELVKKRDIVIADVR
GLPE_COXB1      -------------------------------------------------ISHLEAWELVKKRDIVIADVR
GLPE_PSEFS      ---------------------------------------------------PPEHAQALREQGAVVVDIR
GLPE_PSEHT      ----------------------------------------------------------LLDKDVVIADIR
GLPE_PSEF5      ---------------------------------------------------PPEQAQALREQGAVVVDIR
GLPE_PSEU2      ---------------------------------------------------PPEQAQALREQGAVLVDVR
GLPE_PSE14      ---------------------------------------------------PPEQAQALREQGAVLVDVR
CALU_XENLA      -------DPDNSFNYKQMMIRDERRFK---MADKDGDLVATKEEFT-AFLHPEEFDYM---KDIVVLETM
YIBN_ECOLI      -------------------------------------------------------------EDAVVVDLR
YIBN_ECOL6      -------------------------------------------------------------EDAVVVDLR
YIBN_ECO57      -------------------------------------------------------------EDAVVVDLR
GLPE_PASMU      -------------------------------------------------ISPQQAWQLVQQHAAALLDIR
GLPE_SHEON      ------------------------------------------------HLSVNQLVQMTEAKSVQIVDIR
Y1743_ERWT9     QDLWPTVTNENLNQLTD-FVGYKKEFMHLGLEGVDYDADVNP----------------------------
GLPE_PSEU5      ---------------------------------------------------PPEQAHAMRNAGAVIVDIR
GLPE_PSEPW      ---------------------------------------------------PPEQALALRAQGAVVVDIR
GLPE_HAEIN      -------------------------------------------------ITPQQAWE-MMQQGAILVDIR
GLPE_HAEIG      -------------------------------------------------ITPQQAWE-MMQQGAILVDIR
GLPE_HAEI8      -------------------------------------------------ITPQQAWE-MMQQGAILVDIR
YAY7_SCHPO      ------------------------------------------------------------DKSTVLIDVR


                         +         .         .         .         .         *         .:210
query           NDYEYDLGHFRGAIRPDIRNFREXPQWVRDNKEKFMDKRVVVYCTGGVRCEKFSGWMVREGYKDVGQLHG
Y154_STRZP      NDYEYDLGHFRGAIRPDIRNFRELPQWVRDNKEKFMDKRVVVYCTGGVRCEKFSGWMVREGYKDVGQLHG
Y092_STRP4      NDYEYDLGHFRGAIRPDIRNFREXPQWVRDNKEKFMDKRVVVYCTGGVRCEKFSGWMVREGYKDVGQLHG
Y125_STRZT      NDYEYDLGHFRGAIRPDIRNFRELPQWVRDNKEKFMDKRVVVYCTGGVRCEKFSGWMVREGYKDVGQLHG
Y118_STRZJ      NDYEYDLGHFRGAIRPDIRNFRELPQWVRDNKEKFMDKRVVVYCTGGVRCEKFSGWMVREGYKDVGQLHG
Y105_STRPJ      NDYEYDLGHFRGAIRPDIRNFRELPQWVRDNKEKFMDKRVVVYCTGGVRCEKFSGWMVREGYKDVGQLHG
Y095_STRPN      NDYEYDLGHFRGAIRPDIRNFRELPQWVRDNKEKFMDKRVVVYCTGGVRCEKFSGWMVREGYKDVGQLHG
Y091_STRP2      NDYEYDLGHFRGAIRPDIRNFRELPQWVRDNKEKFMDKRVVVYCTGGVRCEKFSGWMVREGYKDVGQLHG
Y090_STRPS      NDYEYDLGHFRGAIRPDIRNFRELPQWVRDNKEKFMDKRVVVYCTGGVRCEKFSGWMVREGYKDVGQLHG
Y084_STRR6      NDYEYDLGHFRGAIRPDIRNFRELPQWVRDNKEKFMDKRVVVYCTGGVRCEKFSGWMVREGYKDVGQLHG
Y194_STRPI      NDYEYDLGHFRGAIRPDIRNFRELPQWVRDNKEKFMDKRVVVYCTGGVRCEKFSGWMVREGYKDVGQLHG
Y154_STRP7      NDYEYDLGHFRGAIRPDIRNFRELPQWVRDNKEKFMDKRVVVYCTGGVRCEKFSGWMVREGYKDVGQLHG
Y593_STRSV      NDYEYDLGHFRGAIRPDIRNFRELPQWVRDNKEKFMDKRVIVYCTGGVRCEKFSGWMVREGYKDVGQLHG
Y476_STRGC      NDYEYDLGHFRGAIRPDIRNFRELPQWVRDNKEKFMDKRVVVYCTGGVRCEKFSGWMVREGYKDVGQLHG
Y548_STRT1      NDYEYDLGHFRGAIRPDIRNFRELPQWVRDHKEEFMDKRVVVYCTGGVRCEKFSGWLVREGYKDVGQLHG
Y548_STRT2      NDYEYDLGHFRGAIRPDIRNFRELPQWVRDHKEEFMDKRVVVYCTGGVRCEKFSGWLVREGYKDVGQLHG
Y588_STRTD      NDYEYDLGHFRGAIRPDIRNFRELPQWVRDHKEEFMDKRVVVYCTGGVRCEKFSGWLVREGYKDVGQLHG
Y406_STRSY      NDYEYDLGHFRGAIRPDIRNFRELPQWVRDNKEKFMDKRVVVYCTGGVRCEKFSGWMVREGYKDVGQLHG
Y392_STRS2      NDYEYDLGHFRGAIRPDIRNFRELPQWVRDNKEKFMDKRVVVYCTGGVRCEKFSGWMVREGYKDVGQLHG
Y1504_STRA3     NDYEYDLGHFRGAIRPDIRNFRELPQWVRDNKDKFMEKRVVVYCTGGVRCEKFSGWMVREGFKDVGQLHG
Y1469_STRA1     NDYEYDLGHFRGAIRPDIRNFRELPQWVRDNKDKFMEKRVVVYCTGGVRCEKFSGWMVREGFKDVGQLHG
Y1434_STRA5     NDYEYDLGHFRGAIRPDIRNFRELPQWVRDNKDKFMEKRVVVYCTGGVRCEKFSGWMVREGFKDVGQLHG
Y630_STRP3      NDYEYDLGHFRGAIRPDIRNFRELPQWVRDNKDKFMEKRVVVYCTGGVRCEKFSGWMVREGFKDVGQLHG
Y973_STRP8      NDYEYDLGHFRGAIRPDIRNFRELPQWVRDNKDKFMEKRVVVYCTGGVRCEKFSGWMVREGFKDVGQLHG
Y915_STRP1      NDYEYDLGHFRGAIRPDIRNFRELPQWVRDNKDKFMEKRVVVYCTGGVRCEKFSGWMVREGFKDVGQLHG
Y811_STRPF      NDYEYDLGHFRGAIRPDIRNFRELPQWVRDNKDKFMEKRVVVYCTGGVRCEKFSGWMVREGFKDVGQLHG
Y743_STRP6      NDYEYDLGHFRGAIRPDIRNFRELPQWVRDNKDKFMEKRVVVYCTGGVRCEKFSGWMVREGFKDVGQLHG
Y726_STRPZ      NDYEYDLGHFRGAIRPDIRNFRELPQWVRDNKDKFMEKRVVVYCTGGVRCEKFSGWMVREGFKDVGQLHG
Y1090_STRPG     NDYEYDLGHFRGAIRPDIRNFRELPQWVRDNKDKFMEKRVVVYCTGGVRCEKFSGWMVREGFKDVGQLHG
Y776_STRPD      NDYEYDLGHFRGAIRPDIRNFRELPQWVRDNKDKFMEKRVVVYCTGGVRCEKFSGWMVREGFKDVGQLHG
Y789_STRPB      NDYEYDLGHFRGAIRPDIRNFRELPQWVRDNKDKFMEKRVVVYCTGGVRCEKFSGWLVREGFKDVGQLHG
Y773_STRPC      NDYEYDLGHFRGAIRPDIRNFRELPQWVRDNKDKFMEKRVVVYCTGGVRCEKFSGWLVREGFKDVGQLHG
Y697_STRPM      NDYEYDLGHFRGAIRPDIRNFRELPQWVRDNKDKFMEKRVVVYCTGGVRCEKFSGWMVREGFKDVGQLHG
Y1138_STRU0     NDYEYDLGHFRGAVRPDIRNFRELPQWVRDNKDKFMEKRVVVYCTGGVRCEKFSGWMVREGFKDVGQLHG
YMDE_LACLA      NDYEFDLGHFRGAIRPEIRSFRELPQWIRDNKEQFMEKRVLTYCTGGIRCEKFSGWLVREGFKDVGQLHG
Y1287_LACLM     NDYEFDLGHFRGAIRPEIRSFRELPQWIRDNKEQFMEKRVLTYCTGGIRCEKFSGWLVREGFKDVGQLHG
Y1324_LACLS     NDYEFDLGHFRGAIRPEIRSFRELPQWIRDNKEQFMEKRVLTYCTGGIRCEKFSGWLVREGFKDVGQLHG
Y748_ENTFA      NDYEYDLGHFRGAVRPDIRSFRELPQWIRENKEKFMDKKIVTYCTGGIRCEKFSGWLLKEGFEDVAQLHG
Y2654_BACSK     NDYEYDVGHFRGAIRPDIKAFRELPDWIRQNKEQFENKRILTYCTGGIRCEKFSGWLKKEGFEDVAQLDG
Y3574_BACLD     NDYEYDLGHFRGAIRPDIKAFRELPEWIRDNKEKLEGKKILTYCTGGIRCEKFSGWLKKEGFEDVSQLHG
Y1400_LISW6     NDYEFDIGHFRGAVRPDIQNFRELPGWIEENRDQLADKKIVTYCTGGIRCEKFSGWLKTAGFEDVSQLHG
Y1185_LISMH     NDYEFDIGHFRGAVRPDIQNFRELPGWIEDNREQLADKKIVTYCTGGIRCEKFSGWLKTAGFDDVSQLHG
Y1403_LISMF     NDYEFDIGHFRGAVRPDIQNFRELPGWIEDNREQLADKKIVTYCTGGIRCEKFSGWLKTAGFDDVSQLHG
Y1393_LISMC     NDYEFDIGHFRGAVRPDIQNFRELPGWIEDNREQLADKKIVTYCTGGIRCEKFSGWLKTAGFDDVSQLHG
Y1384_LISMO     NDYEFDIGHFRGAVRPDIQNFRELPGWIEDNREQLADKKIVTYCTGGIRCEKFSGWLKTAGFDDVSQLHG
Y1421_LISIN     NDYEFDIGHFRGAVRPDIQNFRELPGWIEDNRDQLEDKKIVTYCTGGIRCEKFSGWLKTAGFEDVSQLHG
Y127_STAS1      NDYEYDLGHFRGAVRPDITRFRDLPDWIKENKEQFMDKKIVTYCTGGIRCEKFSGYLLKEGFEDVSQLEG
Y1961_BACC1     NDYEFDLGHFKGAIKPDIESFRELPDWIRENKEVLEGKKILTYCTGGIRCEKFSGWLVREGYEDVSQLHG
Y1989_BACC7     NDYEFDLGHFKGAIKPDIESFRELPDWIRENKEVLEGKKILTYCTGGIRCEKFSGWLVREGYEDVSQLHG
Y1948_BACC3     NDYEFDLGHFKGAIKPDIESFRELPDWIRENKEVLEGKKILTYCTGGIRCEKFSGWLVREGYEDVSQLHG
Y1658_BACAH     NDYEFDLGHFKGAIKPDIESFRELPDWIRENKEVLEGKKILTYCTGGIRCEKFSGWLVREGYEDVSQLHG
Y1875_BACCQ     NDYEFDLGHFKGAIKPDIESFRELPDWIRENKEILEGKKILTYCTGGIRCEKFSGWLVREGYEDVSQLHG
Y3469_BACC2     NDYEFDLGHFKGAIKPDIESFRELPDWIRENKETLEGKKILTYCTGGIRCEKFSGWLVREGYEDVSQLHG
Y299_STAHJ      NDYEFDLGHFRGAIRPDITRFRDLPDWIRENKDQLDGKNIVTYCTGGIRCEKFSGWLVKEGFENVGQLHG
Y2712_BACAC     NDYEFDLGHFKGAIKPDIESFRELPDWIRENKEVLEGKKILTYCTGGIRCEKFSGWLVREGYEDVSQLHG
Y1948_BACAA     NDYEFDLGHFKGAIKPDIESFRELPDWIRENKEVLEGKKILTYCTGGIRCEKFSGWLVREGYEDVSQLHG
Y1916_BACC0     NDYEFDLGHFKGAIKPDIESFRELPDWIRENKEVLEGKKILTYCTGGIRCEKFSGWLVREGYEDVSQLHG
Y1881_BACAN     NDYEFDLGHFKGAIKPDIESFRELPDWIRENKEVLEGKKILTYCTGGIRCEKFSGWLVREGYEDVSQLHG
Y1875_BACC4     NDYEFDLGHFKGAIKPDIESFRELPDWIRENKEVLEGKKILTYCTGGIRCEKFSGWLVREGYEDVSQLHG
Y1804_BACCR     NDYEFDLGHFKGAIKPDIESFRELPDWIRENKEVLEGKKILTYCTGGIRCEKFSGWLVREGYEDVSQLHG
Y1719_BACHK     NDYEFDLGHFKGAIKPDIESFRELPDWIRENKEVLEGKKILTYCTGGIRCEKFSGWLVREGYEDVSQLHG
Y1694_BACCZ     NDYEFDLGHFKGAIKPDIESFRELPDWIRENKEVLEGKKILTYCTGGIRCEKFSGWLVREGYEDVSQLHG
Y1736_BACWK     NDYEFDLGHFKGAIKPDIESFRELPDWIRENKETLEGKKILTYCTGGIRCEKFSGWLVREGYEDVSQLHG
Y572_OCEIH      NDYEYDLGHFRGAIRPDIKTFRDLPDWVQENKDMLEGKKVVTYCTGGIRCEKFSGWLVKEGFEDVAQLHG
Y1464_BACCN     NDYEYDLGHFRGAIKPEIKSFRELPNWIKENKEVLEGKKILTYCTGGIRCEKFSGWLVREGFEDVSQLHG
Y2770_STAA2     NDYEFDLGHFRGAIRPDITRFRDLPDWIKENKALFTDKKVVTYCTGGIRCEKFSGWLLKEGFEDVAQLHG
Y2713_STAA9     NDYEFDLGHFRGAIRPDITRFRDLPDWIKENKALFTDKKVVTYCTGGIRCEKFSGWLLKEGFEDVAQLHG
Y2689_STAAM     NDYEFDLGHFRGAIRPDITRFRDLPDWIKENKALFTDKKVVTYCTGGIRCEKFSGWLLKEGFEDVAQLHG
Y2673_STAA1     NDYEFDLGHFRGAIRPDITRFRDLPDWIKENKALFTDKKVVTYCTGGIRCEKFSGWLLKEGFEDVAQLHG
Y2481_STAAN     NDYEFDLGHFRGAIRPDITRFRDLPDWIKENKALFTDKKVVTYCTGGIRCEKFSGWLLKEGFEDVAQLHG
Y2609_STAAW     NDYEFDLGHFRGAIRPNITRFRDLPDWIKENKALFADKKVVTYCTGGIRCEKFSGWLLKEGFEDVAQLHG
Y2575_STAAS     NDYEFDLGHFRGAIRPNITRFRDLPDWIKENKALFADKKVVTYCTGGIRCEKFSGWLLKEGFEDVAQLHG
Y3024_STAA8     NDYEFDLGHFRGAIRPNITRFRDLPDWIKENKALFADKKVVTYCTGGIRCEKFSGWLLKEGFEDVAQLHG
Y2691_STAAT     NDYEFDLGHFRGAIRPNITRFRDLPDWIKENKALFADKKVVTYCTGGIRCEKFSGWLLKEGFEDVAQLHG
Y2622_STAA3     NDYEFDLGHFRGAIRPNITRFRDLPDWIKENKALFADKKVVTYCTGGIRCEKFSGWLLKEGFEDVAQLHG
Y2587_STAAE     NDYEFDLGHFRGAIRPNITRFRDLPDWIKENKALFADKKVVTYCTGGIRCEKFSGWLLKEGFEDVAQLHG
Y262_STAES      NDYEYDLGHFRGAIRPDITRFRDLPEWVRNNKEQLDGKNIVTYCTGGIRCEKFSGWLVKEGFENVGQLHG
Y1123_ACHLI     NDYEFDLGHFRGAIKPEIKNFRDLPDWIRENKDQFKDKEILTYCTGGVRCEKFSGWLIKEGFNVAGQLHG
Y2316_STAEQ     NDYEYDLGHFRGAIRPDITRFRDLPEWVRNNKEQLDGKNIVTYCTGGIRCEKFSGWLVKEGFENVGQLHG
Y2713_STAAC     NDYEFDLGHFRGAIRPNITRFRDLPDWIKENKALFADKKVVTYCTGGIRCEKFSGWLLKEGFEDVAQLHG
Y2771_STAAR     NDYEFDLGHFRGAIRPNITRFRDLPDWIKENKALFADKKVVTYCTGGIRCEKFSGWLLKEGFEDVAQLHG
YBFQ_BACSU      NDYEYDLGHFRGAVRPDIEAFRELPEWIEEHKDMLEGKKILTYCTGGVRCEKFSGWLVKQGFEDVAQLDG
Y2565_STAAB     NDYEFDLGHFRGAIRPNITRFRDLPDWIKENKALFADKKVVTYCTGGIRCEKFSGWLLKEGFEDIAQLHG
Y2303_STACT     NDYEFDLGHFRGAVRPNITRFRDLPDWIKENKEVFMDKKIVTYCTGGIRCEKFSGFLLKEGFEDVAQLEG
Y205_BACP2      NDYEFDVGHFRGAVRPDIETFRELPEWIRDNKEILEGKKILTYCTGGVRCEKFSGWLKREGFEDVSQLDG
Y274_BACA2      NDYEYDLGHFRGAVRPDIEAFRELPDWIEEHKDMLEGKKILTYCTGGVRCEKFSGWLLKKGFEDVSQLDG
Y085_ONYPE      NDYEYDLGHFRNAVNPNIRHFRDLPNWVKQNTHLLKDKKIVTYCTGGVRCEKFSTFLKKEGFDDVYQLEG
Y630_AYWBP      NDYEYDLGHFRNAVNPNIRHFRDLPNWVKQNTHLLKNKKIVTYCTGGVRCEKFSTFLKKEGFVDVYQLEG
Y2691_CYTH3     SNYEHQVGRFKNAVTIDMENFRDFPEKIKE-LDHLKGKKVLTYCTGGIKCEKASAFLLEQGFEDVYQLHG
Y2281_BRUO2     NDYEYAIGTFEGAIDPQTRTFREFPEWVKQNRDRLEGKKIAMFCTGGIRCEKATAFVKGLGFDDVYHLKG
Y3086_BRUSU     NDYEYAIGTFEGAIDPQTRTFREFPEWVKQNRDRLEGKKIAMFCTGGIRCEKATAFVKGLGFDDVYHLKG
Y2589_BRUC2     NDYEYAIGTFEGAIDPQTRTFREFPEWVKQNRDRLEGKKIAMFCTGGIRCEKATAFVKGLGFDDVYHLKG
Y800_BRUA1      NDYEYAIGTFEGAIDPQTRTFREFPEWVKQNRDRLEGKKIAMFCTGGIRCEKATAFVKGLGFDDVYHLKG
Y2897_LEGPA     NDYEYELGTFKNAINPDIENFREFPDYVQRNLIDKKDKKIAMFCTGGIRCEKTTAYMKEQGFQHVYQLHD
Y2585_BRUA2     NDYEYAIGTFEGAIDPQTRTFREFPEWVKQNRDRLEGKKIAMFCTGGIRCEKATAFVKGLGFDDVYHLKG
Y2390_BRUMB     NDYEYAIGTFEGAIDPQTRTFREFPEWVKQNRDRLEGKKIAMFCTGGIRCEKATAFVKGLGFDDVYHLKG
Y2386_BRUAB     NDYEYAIGTFEGAIDPQTRTFREFPEWVKQNRDRLEGKKIAMFCTGGIRCEKATAFVKGLGFDDVYHLKG
Y996_CHLFF      NNYEWKIGHFENAVLPDIQTFREFPEYAEQLSKEHDPETVMMYCTGGIRCELYSSLLLEKGFKEVYQLDG
Y007_BRUME      NDYEYAIGTFEGAIDPQTRTFREFPEWVKQNRDRLEGKKIAMFCTGGIRCEKATAFVKGLGFDDVYHLKG
Y4255_OCHA4     NDYEYAIGTFEGALDPQTKTFREFPEWVEQNRDKLEGKKIAMFCTGGIRCEKATAFVKGLGFDDVFHLKG
Y2591_BRUSI     NDYEYAIGTFEGAIDPQTRTFRAFPEWVKQNRDRLEGKKIAMFCTGGIRCEKATAFVKGLGFDDVYHLKG
Y3122_LEGPC     NDYEYELGTFKNAINPDIENFREFPDYVQRNLIDKKDKKIAMFCTGGIRCEKTTAYMKELGFQHVYQLHD
Y010_CHLCV      NNYEWKIGHFENAVLPDIQTFREFPEYARLSKEHDATTPVMMYCTGGIRCELYSSLLLEKGFKEVYQLDG
Y2838_LEGPH     NDYEYELGTFKNAINPDIENFREFPDYVQRNLIDKKDKKIAMFCTGGIRCEKTTAYMKELGFEHVYQLHD
Y010_CHLAB      NNYEWKIGHFENAVLPDIRTFREFPDYAEQLSKEHATTPVMMYCTGGIRCELYSSLLLEKGFKEVYQLDG
Y680_CHLTA      NNYEWKIGHFENAVLPDIETFREFPDYA-DRLAKEHDPAVMMYCTGGIRCELYSALLLEKGFKEVYQLDG
Y627_CHLTR      NNYEWKIGHFENAVLPDIETFREFPDYA-DRLAKEHDPAVMMYCTGGIRCELYSALLLEKGFKEVYQLDG
Y2780_TERTT     NDYEYEIGTFRGAVNPNTQSFRQLPQYVAENLDPNKHKKVAMFCTGGIRCEKSTALMKQMGFEEVYHLQG
Y2750_LEGPL     NDYEYELGTFKNAINPDIENFREFPDYVQRNLIDKKDKKIAMFCTGGIRCEKTTAYMKELGFQHVYQLHD
Y916_CHLMU      NNYEWKIGHFENAVLPDIETFREFPAYADRLAQEHAPETVMMYCTGGIRCELYSALLLEKGFKEVYQLDG
Y891_CHLT2      NNYEWKIGHFENAVLPDIETFREFPDYA-DRLAKEHDPAVMMYCTGGIRCELYSALLLEKGFKEVYQLDG
Y885_CHLTB      NNYEWKIGHFENAVLPDIETFREFPDYA-DRLAKEHDPAVMMYCTGGIRCELYSALLLEKGFKEVYQLDG
Y1091_BARBK     NDYEYMLGSFQGAVDPNIKTFREFPQWVANHQDELKKKRIAMFCTGGIRCEKSTSYMRELGYEEVYHLKG
Y2992_RHILO     NTYEVSIGTFKGAVDPATASFREFPAWVEAHRAELEGRKVAMFCTGGIRCEKATAYVKSLGFEDVFHLKG
Y3407_PSYIN     NDYEISIGTFKNAVDPKTTNFREFPQYVKDNLDPAVNKKVAMFCTGGIRCEKSTAYLKEQGFDEVYHLEG
Y3401_RHILW     NDYETAIGTFRGALDPKTKTFREFPDWVRSNSGLHNKPKIAMYCTGGIRCEKATAFMKAEGFDEVYHLKG
Y2130_SHEPC     NDYEVQIGTFKNAINPVTETFREFPEYVKQNLDPVKHKKVAMFCTGGIRCEKSTAYLKEQGFEEVYHLEG
Y1881_SHESW     NDYEVQIGTFKNAINPVTETFREFPEYVKQNLDPVKHKKVAMFCTGGIRCEKSTAYLKEQGFEEVYHLEG
Y1007_BARQU     NDYEYAIGSFQGAIDPGIKTFREFPEWVRKHEADLKKKKMAMFCTGGIRCEKSTAYVRELGYEQVYHLKG
Y6152_NOSP7     NDYEVNIGTFQGAENPQTGSFREFPDYVVHNLDPTKHKKVALFCTGGIRCEKASSFMLAQGFAEVYHLKG
Y2319_METFK     NNYEYEIGTFKGAIDPATTTFRQFPEFVRKNLDPAKNKKVAMFCTGGIRCEKASSYMLEQGFKEVYHLQG
Y384_ANASP      NDYEVHIGTFQGAQNPQTNSFRDFPEYVRQNLDPNQHKKVAMFCTGGIRCEKASSFMLSQGFAEVYHLKG
Y2481_SHEB9     NDYEVQIGTFKNAVNPVTETFREFPEYVKQNLDPAKHKKVAMFCTGGIRCEKSTAYLKEQGFDEVYHLEG
Y2366_SHEB8     NDYEVQIGTFKNAVNPVTETFREFPEYVKQNLDPAKHKKVAMFCTGGIRCEKSTAYLKEQGFDEVYHLEG
Y771_ACIBY      NDYEYKAGTFKGAIDPKTETFREFPEYVKKELEQHKDKKIAMFCTGGIRCEKSTSLLLQEGFKEVYHLKG
Y768_ACIBS      NDYEYKAGTFKGAIDPKTETFREFPEYVKKELEQHKDKKIAMFCTGGIRCEKSTSLLLQEGFKEVYHLKG
Y4166_RHIL3     NDYETAIGTFRGALDPKTKSFREFPEWVRQNPGLHNKPKVAMYCTGGIRCEKATAFMKAEGFDEVYHLKG
Y2378_SHEB5     NDYEVQIGTFKNAVNPVTETFREFPEYVKQNLDPAKHKKVAMFCTGGIRCEKSTAYLKEQGFDEVYHLEG
Y2825_ANAVT     NDYEVHIGTFQGAQNPQTNSFRDFPEYVRQNLDPNQHKKVAMFCTGGIRCEKASSFMLSQGFAEVYHLKG
Y2782_SINMW     NDYETAIGVFQGAVDPKTKTFREFPEWVRNNSGLHNKPKIAMYCTGGIRCEKATAFMKEQGFEEVYHLKG
Y2261_SHESA     NDYEVQIGTFKNAINPVTETFREFPEYVKQNLDPAKHKKVAMFCTGGIRCEKSTAYLKEQGFEEVYHLEG
Y1981_SHEB2     NDYEVQIGTFKNAVNPVTETFREFPEYVKQNLDPAKHKKVAMFCTGGIRCEKSTAYLKEQGFDEVYHLEG
Y2524_SHEPA     NDYEVQIGTFKDALDPKTKTFREFPDYVKQNLDPAKHKKVAMFCTGGIRCEKSTAYLKEQGFDEVFHLEG
Y1276_BARHE     NDYEYAIGSFQGAVDPRIKTFREFPAWVKHEADLXXXXXIAMFCTGGIRCEKSTAYVRELGYEQVYHLKG
Y734_CHLPN      NNYEWKIGHFDNATLPDIQTFREFPEYAEKLAQECDPETVMMYCTGGIRCELYSPVLLEKGFKEVYQLDG
Y3638_RHIEC     NDYETAIGTFRGALDPKTKTFREFPDWVRRNTGLHNKPKVAMYCTGGIRCEKATAFMKAEGFDEVYHLKG
Y2917_ACIAD     NDYEYKAGTFKGAIDPKTETFREFPDYVKQNLEQHKDKKIAMFCTGGIRCEKSTSLLLQEGFNEVYHLKG
Y2887_RHIME     NDYETAIGLFQGAVDPKTKTFREFPEWVRNNSGLHNKPKIAMYCTGGIRCEKATAFMKEQGFEEVYHLKG
Y1760_SHESM     NDYEVQIGTFKNAINPVTETFREFPDYVKQNLDPAKHKKVAMFCTGGIRCEKSTAYLKEQGFEEVYHLEG
Y2290_SHEON     NDYEVQIGTFKNAINPVTETFREFPEYVKQNLDPAKHKKVAMFCTGGIRCEKSTAYLKEQGFEEVYHLEG
Y378_PARUW      NEYEWQVGRFDGAECPPCDTFREFKEYAENLKTQVNPEQIMMYCTGGIRCELYSSLLKKEGFKEVYQLEG
Y2937_RHISN     NDYETAIGLFRGAVDPQTKTFREFPDWVRNHTGLHNKPKIAMYCTGGIRCEKATAFMKEQGFEEVYHLKG
Y1838_SHESR     NDYEVQIGTFKNAINPVTETFREFPDYVKQNLDPAKHKKVAMFCTGGIRCEKSTAYLKEQGFEEVYHLEG
Y2660_SHESH     NEYEIQIGTFKNAVDPKTDTFREFPAYVKDNLDPAKHKKVAMFCTGGIRCEKSTAYLKEQGFDEVYHLEG
Y1312_SACD2     NNYEYDIGTFEGALNPNTESFRELPEYVAKNLDPAKHKKVAMFCTGGIRCEKSTAFMKQRGFEEVYHLKG
Y1496_SYNP2     NDYEVGIGTFKGAINPNTKSFREFPDYVAENLDPQKNAKVAMFCTGGIRCEKATSYLLNQGFQEVYHLKG
Y1075_ACAM1     NDYEVAIGTFKGAINPNTKSFSELPEWLQEQAELQKKPKVAMFCTGGIRCEKSTALLRHEGFEDVFHLQG
Y584_ROSDO      NDYEVEIGTFEGAIDPKTRSFGEFPAWWEANKHRFHNKKIAMFCTGGIRCEKSTNYLLGQGVEDVFHLKG
Y091_SILPO      NDYEVAIGTFEGAIDPMTESFRDFPAWWEANKERFHNKRVAMFCTGGIRCEKSTNYLLGQGVEDVYHLKG
Y6657_VIBHB     NDYEIEIGTFKGAVNPNTDTFREFPDYVKQNMDPEKHKKVAMFCTGGIRCEKSTAYMKEQGFDEVYHLEG
Y5597_VIBPA     NDYEIEIGTFKGAVNPNTETFREFPDYVKENMDPAKHKKVAMFCTGGIRCEKSTAYMKEQGFEEVYHLEG
Y1781_SHELP     NDYEVNIGTFKNAVDPKTQTFREFPDYVKQNLDPKQHKKVAMFCTGGIRCEKSTAYLKEQGFDEVYHLEG
Y789_FRATN      NEYEIEIGTFKNAINPHTENFREFPQYVDENLDPKKHKKVAMFCTGGIRCEKSTALLKAKGFDEVYHLKG
Y370_PSYA2      NDYEVKIGTFQNAVNPNTETFREFPEYVAKELDPAKHKKVAMFCTGGIRCEKSTAFMREQGFEEVYHLEG
Y1885_SHEPW     NDYEVKIGTFENALDPQTATFREFPEYVKQNLDPTKHKKVAMFCTGGIRCEKSTAYLKEQGFEDVYHLEG
Y960_RICRS      NDYEVEVGTFKSAINPNTKTFKQFPAWVQQNQELLKGKKIAMVCTGGIRCEKSTSLLKSIGYNEVYHLKG
Y674_LEPBL      NHYESEIGHFENAILPQSDTFREELQILLELLNGKEDHKILMYCTGGIRCEKASAWLKHHGFKDVNQLHG
Y522_HAHCH      NDYEVQIGKFKNAINPNTETFREFPDYVKSNLDPAKHKKVAMYCTGGIRCEKSTAYLKELGFEDVYHLEG
Y411_PSYCK      NDYEVKIGTFQNAVNPNTETFREFPEYVAKELDPSKHKKVAMFCTGGIRCEKSTAFMREQGFEEVYHLEG
Y4030_RICPU     NDYEVEVGTFKSAINPNTKTFKQFPAWVQQNQELLKGKKIAMVCTGGIRCEKSTSLLKSIGYDEVYHLKG
Y2438_LEPBJ     NHYESEIGHFENAILPQSDTFREELQILLELLNGKEDHKILMYCTGGIRCEKASAWLKHHGFKDVNQLHG
Y208_RICRO      NDYEVEVGTFKSAINPNTKTFKQFPAWVQQNQELLKGKKIAMVCTGGIRCEKSTSLLKSIGYNEVYHLKG
Y716_WOLPP      NDYEVKLGKFKNAINPHTQRFRDFPQWAESFSES-KDLKVAMYCTGGIRCEKSTAYMKSLGFNDVYHLKG
Y3658_PSEU2     NDYEVSIGTFEGAIDPKTTSFREFPEYIKAHFDPAVHKKVAMFCTGGIRCEKASSYMLGEGFEEVYHLKG
Y1973_SHEWM     NEYEVQIGTFKNAVDPKTDTFREFPAYVKEHLDPAKHKKVAMFCTGGIRCEKSTAYLKEQGFDEVYHLEG
Y175_RICM5      NDYEVEVGTFKSAINPNTKTFKQFPAWVQQNQELLKGKKIAMVCTGGIRCEKSTSLLKSIGYDEVYHLKG
Y1734_PSESM     NDYEVSIGTFEGAIDPKTTSFREFPEYIKAHFDPAVHKKVAMFCTGGIRCEKASSYMLGEGFEEVYHLKG
Y1391_FRATW     NEYEIEIGTFKNAINPHTENFREFPQYVDENLDPKKHKKVAMFCTGGIRCEKSTALLKAKGFDEVYHLKG
Y1229_FRATM     NEYEIEIGTFKNAINPHTENFREFPQYVDENLDPKKHKKVAMFCTGGIRCEKSTALLKAKGFDEVYHLKG
Y1178_FRATF     NEYEIEIGTFKNAINPHTENFREFPQYVDENLDPKKHKKVAMFCTGGIRCEKSTALLKAKGFDEVYHLKG
Y1118_FRATH     NEYEIEIGTFKNAINPHTENFREFPQYVDENLDPKKHKKVAMFCTGGIRCEKSTALLKAKGFDEVYHLKG
Y1091_FRATO     NEYEIEIGTFKNAINPHTENFREFPQYVDENLDPKKHKKVAMFCTGGIRCEKSTALLKAKGFDEVYHLKG
Y1085_FRATT     NEYEIEIGTFKNAINPHTENFREFPQYVDENLDPKKHKKVAMFCTGGIRCEKSTALLKAKGFDEVYHLKG
Y1085_FRAT1     NEYEIEIGTFKNAINPHTENFREFPQYVDENLDPKKHKKVAMFCTGGIRCEKSTALLKAKGFDEVYHLKG
Y3678_PSE14     NDYEVSIGTFEGAIDPKTTSFREFPEYIKAHFDPAVHKKVAMFCTGGIRCEKASSYMLGEGFEEVYHLKG
Y2744_RENSM     NAFEAQIGKFKNAVVPDVETTRDFIAELDSGKDELKDQPIVTYCTGGIRCEVLSSLMVKRGFKEVYQLDG
Y1677_MARMM     NDYEVRIGQFEGAINPHTVSFREFPDWFRQFRETRPDARIAMYCTGGIRCEKATAFARMEGVDDVFHLKG
Y2535_MARMS     NDYEVQIGTFKNAVNPKTDTFREFPAYVKENMDPAKHKKVAMFCTGGIRCEKSTAYMLEQGFEEVYHLEG
Y4604_VIBSL     NDYEVDIGTFKNAVNPNTETFREFPQYVEDNLDPKKHKKVAMFCTGGIRCEKSTAYMKEQGFDEVYHLEG
Y315_ANAMM      NDYEVRLGRFKGAIDPGTSSFREFPEWARNALDKERDTCVAMYCTGGIRCEKSTAFMRSLGFRNVYHLRG
Y234_ANAMF      NDYEVRLGRFKGAIDPGTSSFREFPEWARNALDKERDTCVAMYCTGGIRCEKSTAFMRSLGFRNVYHLRG
Y2100_SHEDO     NDYEVQIGTFKHAVNPVTETFREFPEYVKQNLDPAKHKKVAMFCTGGIRCEKSTAYLKEQGFDEVYHLEG
Y1135_WOLPM     NEYEVKLGKFKNAINPHTQCFREFPQWTESFSES-KDLKVAMYCTGGIRCEKSTAYMKSLGFSDVYHLKG
Y4798_COLP3     NDYEIEIGTFKNAINPNTETFREFPDYVAKNLDKNKHKKVAMYCTGGIRCEKSTAYLKEQGFEEVYHLEG
Y240_CORJK      NAMEAEIGKFKNAIVPDVRTTHDFISEIESGKDDLKDKPVVTYCTGGIRCEILSSLMKNRGFEEVYQIDG
Y167_RICCN      NDYEVEVGTFKSAINPNTKTFKQFPAWVQQNQELLKGKKIAMVCTGGIRCEKSTSLLKSIGYDEVYHLKG
CI097_MOUSE     NFYESKIGRFQGCLAPDIRKFSYFPSYVDKNLDIFRQKRVLMYCTGGIRCERGSAYLRAKGVKEVFQLKG
Y4090_PSEPF     NDYEVSIGTFEGAIDPKTTSFREFPDYIKEHFDPAVHKKVAMFCTGGIRCEKASSYMLGEGFEEVYHLKG
Y1846_FRAP2     NDYEIEIGTFKNAINPSTETFREFPEYVDKNLDPKKHKKVAMFCTGGIRCEKSTALMKAKGFDEVYHLKG
Y156_RICAE      NDYEVEVGTFKSAVNPNTKTFKQFPAWVQQNQELLKGKKIAMVCTGGIRCEKSTSLLKSIGYDEVYHLKG
Y1433_PSEHT     NDYEIEIGTFQNAVDPNTKTFREFPQWAKENLDPSKHKKVAMFCTGGIRCEKSTAYMKEQGFDEVYHLEG
Y1758_PSEPK     NDYEVAIGTFKGAIDPKTETFREFPEYIKANFDPSKHKKVAMFCTGGIRCEKASSYMLGEGFESVYHLKG
Y1365_PSEPW     NDYEVAIGTFKGAIDPKTETFREFPEYIKANFDPSKHKKVAMFCTGGIRCEKASSYMLGEGFEAVYHLKG
Y962_ANAPZ      NDYEIKFGRFKHSINPGTTSFREFPDWARKWAEKDKDVGVAMYCTGGIRCEKSTAFLKSLGFENVYHLKG
Y8368_RHOBA     NDYEIEIGTFEGAINPHTESFREFPKFVEENLDPQKHPKVAMFCTGGIRCEKSTAYLKERGFEEVYHLRG
Y1259_VIBCH     NDYEVQLGTFKNALNPKTETFREFPHYVQENLDPQKHKKVAMFCTGGIRCEKSTAYLKEQGFEEVYHLEG
Y925_RICAH      NDYEVEVGTFKSAISPNTKTFKQFPAWVQKNQGLLKGKRIAMVCTGGIRCEKSTSLLKSIGYDEVYHLKG
Y4491_AGRT5     NDYETAIGVFKGAVDPQTKTFREFPDWVKNNPGLHNKPKIAMYCTGGIRCEKATAFMKEQGFDEVYHLKG
Y3956_PSEP1     NDYEVAIGTFKGAIDPKTETFREFPEYIKANFDPSKHKKVAMFCTGGIRCEKASSYMLGEGFESVYHLKG
Y1477_PSEE4     NDYEVAIGTFKGAIDPKTETFREFPDYIKANFDPSKHKKVAMFCTGGIRCEKASSYMLGEGFEAVYHLKG
Y765_SYNY3      NDYEVAIGTFQGAVNPCTKKFRQFPDYVKNNLDQQKNKKVAMFCTGGIRCEKASAYLLEEGFAEVYHLRG
Y4311_PSEFS     NDYEVSIGTFEGAIDPKTTSFREFPDYIKANFDPAKHKKVAMFCTGGIRCEKASSYMLSEGFDEVYHLKG
Y4325_PSEF5     NDYEVSIGTFEGAIDPKTTSFREFPDYIKAHFDPSKHKKVAMFCTGGIRCEKASSYMLSEGFDEVFHLKG
Y2830_COREF     NAMEAQIGKFRDAVVPDVNTTHDFIKEIESGKDDLKDKPVVTYCTGGIRCEILSSLMINRGFQEVYQIDG
Y1760_CORU7     NAMEAEIGRFKNAVVPDVETTHDFIKELESGKYDWMDKPVVSYCTGGIRCEVLSALMKNRGFEEVYQIDG
Y038_WOLTR      NEYEVKLGKFKNAINPYIQYFREFPQWAK-SFSKNKNLKVAMYCTGGIRCEKSTAYMKSLGFNDVYHLKG
Y2448_CORA7     NAMEAEIGKFKNAVVPDVRTTHDFIAELESGKYDWMDKPVVSYCTGGIRCEILSALMKNRGFNEVYQIDG
Y1113_CAUCN     NAYEVAVGRFEGAIDPQTASFADFPAWFRDWRKSVEAQRVAMYCTGGIRCEKSTAFLKAEGVEQVFHLKG
Y1060_CAUCR     NAYEVAVGRFEGAIDPQTASFADFPAWFRDWRKSVEAQRVAMYCTGGIRCEKSTAFLKAEGVEQVFHLKG
Y255_NEOSM      NLYETKLGRFKYSIDPETINFRDFQEWVRKWIEKSMEQKIAMYCTGGVRCEKSTAYMKRIGFKNVYQLKG
Y114_RICTY      NEYEIDIGTFKSAINPRTETFKQFPAWVQQNQALLQGKKIAMFCTGGIRCEKSTSLLKSIGYNEVYHLKG
Y895_GLUOX      NDYEVAIGTFKGAEDPKTKSXXXXXXXXXXXXXXLEAKKIAMFCTGGIRCEKSTSFARAEGVDEVYHLKG
Y635_RICCK      NDYEVEIGTFKSAINPYTKTFKQFPAWVHQNEKLLKGKKIAMFCTGGIRCEKSTSLLKSIGYDDVYHLKG
Y3365_ARTS2     NAFEAQIGKFKDAIVPDVATTHDFIKELESGKDALKDKPVVTYCTGGIRCEVLSSLMVNRGFKEVYQLDG
Y1435_RICB8     NDYEVEVGTFKAAINPYTETFKQFPAWAEQNAELLKGKKIAMFCTGGIRCEKSTSLLKSMGHEEVYHLKG
Y1241_PHOPR     NDYEIEIGTFKHAVNPETESFREFPEYVEKNLDPEKHKKVAMFCTGGIRCEKSTAYLKEQGFDEVYHLEG
Y3316_ALISL     NDYEVDIGTFKYAVNPKTETFRDFPQYVAENLDPAKHKKVAMFCTGGIRCEKSTAYMKEQGFDEVYHLEG
Y2992_CORGL     NAMEAQIGKFKDAVVPDVETTHDFIAEIESGKDDLKDKPVVTYCTGGIRCEILSSLMINRGFKEVYQIDG
Y1349_PSEPG     NDYEVAIGTFKGAIDPKTETFREFPEYIKANFDPSKHKKVAMFCTGGIRCEKASSYMLGEGFDAVYHLKG
CI097_PONAB     NFYESKIGRFQGCLAPDIRKFSYFPSYVDKNLELFREKRVLMYCTGGIRCERGSAYLKAKGVKEVFQLKG
Y2881_CORGB     NAMEAQIGKFKDAVVPDVETTHDFIAEIESGKDDLKDKPVVTYCTGGIRCEILSSLMINRGFKEVYQIDG
Y1100_DEIRA     NRYEVKAGTFQGAVDPEIDSFREFPAWVDEHLAGAEGKKIAMFCTGGIRCEKSTSLLLQKGFQDVYHLKG
CI097_HUMAN     NFYESKIGRFQGCLAPDIRKFSYFPSYVDKNLELFREKRVLMYCTGGIRCERGSAYLKAKGVKEVFQLKG
Y2301_CORDI     NAMEAQIGKFKNAVVPDVRTTHDFIRELESGKYDWMDKPVVSYCTGGIRCEILSSLMKNRGFKEIYQIDG
Y4661_PSEA7     NDYEVAIGTFEGAVDPKTRSFREFPEYIKAHYDPARHKKVAMFCTGGIRCEKASSYMLGAGFEEVFHLRG
Y858_PSEAE      NDYEVAIGTFEGAVDPKTRSFREFPEYIKAHYDPARHKKVAMFCTGGIRCEKASSYMLGAGFEEVFHLKG
Y4460_PSEA8     NDYEVAIGTFEGAVDPKTRSFREFPEYIKAHYDPARHKKVAMFCTGGIRCEKASSYMLGAGFEEVFHLKG
Y125_RICPR      NEYEIDIGTFKSAINPRTETFKQFPAWVQQNHALLQGKKIAMFCTGGIRCEKSTSLLKSIGYNEVYHLKG
Y1169_RICBR     NDYEVEVGTFKAAINPYTETFKQFPAWVEQNAELLKGKKIAMFCTGGIRCEKSTSLLKSMGHEEVYHLKG
Y5318_PSEAB     NDYEVAIGTFEGAVDPKTRSFREFPEYIKAHYDPARHKKVAMFCTGGIRCEKASSYMLGAGFEEVFHLRG
Y2351_IDILO     NEYEYAVGTFEGAINPKTDTFREFPEYVKQHLDPEKHKKVAMFCTGGIRCEKSTAYLKEQGFDEVYHLKG
Y654_PROMT      NEYEIKIGNFAGALNPQTSSFREFPAWVQKHLKPLIEEKIGMYCTGGIRCEKATSYLIEEGFSDVHHLEG
Y011_JANSC      NAYEVEIGTFEGAVDPATESFRDFPAWWQANKHRFANQRIAMFCTGGIRCEKSTAYLKEQGVEEVFHLKG
Y1693_PSEMY     NDYEVAIGTFEGAIDPKTKSFREFPEYVKAHFDPSKHKKVAMFCTGGIRCEKASSYMLGEGFEEVYHLKG
Y1486_PROM1     NDYEIKIGNFAGALNPQTSSFREFPAWVQKHLKPLIEEKIGMYCTGGIRCEKATSYLIEEGFSDVHHLEG
Y3153_ARTCA     NAFEAQIGRFKDAVVPDVATTHDFIKELDSGKDALKDKPVATYCTGGIRCEVLSSLMVNRGFKEVYQLDG
Y1961_RHOFD     NDYEVGIGTFAGAVNPDIQSFAMLPQWLAQHPATGKKPKVAMFCTGGIRCEKSTALLRAQGFDEVFHLEG
Y794_KOCRD      NQLEAEIGRFRGAVVPRTETTRDFLRELDSGADHLKDKALVTYCTGGIRCEVLSGLLRNRGFRDVYQLDG
Y1395_SYNS9     NSYETAIGSFEGSLDPSTESFRDFPAWAEASLRPLMNKRIAMFCTGGIRCEKASSYLQSNGFGEVLHLRG
Y2203_SYNP6     NRFEIALGSFPRAIDPQTDRFRDFPRFVQEQLLPQPPAKVAMFCTGGIRCEKASAYLLEQGIETVYQLEG
Y1892_SYNE7     NRFEIALGSFPRAIDPQTDRFRDFPRFVQEQLLPQPPAKVAMFCTGGIRCEKASAYLLEQGIETVYQLEG
Y1635_SYNSC     NSYETAIGTFEGAIDPSTESFRDFPQWLRPLIEQKSSKRIAMFCTGGIRCEKASSYLQQQGFGEVHHLRG
Y896_EHRCR      NTYEINFGKFKNAINPQTKCFRDFPEWAISSNKVDQDPIIAMYCTGGIRCEKSTAFMKDLGFSKVYHLKG
Y976_LEPIC      NHYESEIGHFENAILPQSDTFXXXXXXXXXXXNGKENHKILMYCTGGIRCEKASAWLKHHGYKDVNQLHG
Y3128_LEPIN     NHYESEIGHFENAILPQSDTFXXXXXXXXXXXNGKENHKILMYCTGGIRCEKASAWLKHHGYKDVNQLHG
Y2998_NITWN     NDFEVVMGSFEGAIDPQLARFGQFKDFAAQELDHRKHRRIAMYCTGGIRCEKASSYLLSRGFKEVYHLKG
Y1101_PROMA     NEYEISVGSFDGAVNPRTDSFREFPEWVXXXXXXXXXXXIALFCTGGIRCEKASALLLREGFPEVHHLHG
Y2579_YERPB     NHYEYEVGHFENAIEVPSDTFREQLPMAVDMLQHDKEKNIVMYCTGGIRCEKASAYMLHNGFKNVYHVEG
Y2488_YERPS     NHYEYEVGHFENAIEVPSDTFREQLPMAVDMLQHDKEKNIVMYCTGGIRCEKASAYMLHNGFKNVYHVEG
Y2451_YERPE     NHYEYEVGHFENAIEVPSDTFREQLPMAVDMLQHDKEKNIVMYCTGGIRCEKASAYMLHNGFKNVYHVEG
Y2048_YERPN     NHYEYEVGHFENAIEVPSDTFREQLPMAVDMLQHDKEKNIVMYCTGGIRCEKASAYMLHNGFKNVYHVEG
Y1866_YERPP     NHYEYEVGHFENAIEVPSDTFREQLPMAVDMLQHDKEKNIVMYCTGGIRCEKASAYMLHNGFKNVYHVEG
Y1668_YERPY     NHYEYEVGHFENAIEVPSDTFREQLPMAVDMLQHDKEKNIVMYCTGGIRCEKASAYMLHNGFKNVYHVEG
Y1560_YERP3     NHYEYEVGHFENAIEVPSDTFREQLPMAVDMLQHDKEKNIVMYCTGGIRCEKASAYMLHNGFKNVYHVEG
Y1569_ENT38     NHYEYEVGHFENALEIPADTFREQLPKAVEMMQEHKDKKIIMYCTGGIRCEKASAWMKHSGFNKVWHIEG
Y3187_RHOE4     NAFEAEIGRFRDAVVPDVATTRDFVDELDSGKDHLKGKAVVTYCTGGVRCEVLSSLMRSRGFDEVYQLDG
Y206_EHRCJ      NTYEINFGKFKNAINPQTKCFRDFPEWAVSSDKVNQDPIIAMYCTGGIRCEKSTAFMKNLGFNKVYHLKG
Y1816_PHOLL     NHYEYEVGHFENAIEVPSDTFREQLPMVAEMLQDNKDKNIVMYCTGGIRCEKASAYMLHNGFKNVYHVEG
Y1078_NITHX     NAFEVAMGTFEGAVDPQLARFGEFKDFVAQKLDPDRHRRIAMFCTGGIRCEKASSYLLSRGFKEVYHLKG
YCEA_SALNS      NHYEYEVGHFENALEIPADTFREQLPKAVEMLREHADKKIVMYCTGGIRCEKASAWMKHNGFNKVWHIEG
Y857_RHOSR      NGFEAEIGRFRDAVVPDVSTTREFVHELDSGKDHLKDKAVVTYCTGGVRCEVLSSLMRSRGFGEVYQLDG
Y2059_ERWT9     NHYEYEVGHFDNALEIPADTFRDQLPMAVDMLEQDKDKKIVMYCTGGIRCEKASAWMRHNGYENVYHIEG
Y1185_PROM5     NHYEVSIGSFKKSINPNTKNFSEFPQWVDNNLDNHLSKNIAMFCTGGIRCEKATTLLKNKGYKNIFHLKG
Y932_SYNPX      NHYETAIGSFDGAIDPGTDSFRDFPHWAETKLRPLIDKRIAMFCTGGIRCEKASSYLQHQGFGEVHHLRG
Y1619_YERE8     NHYEYEVGHFENAIEVPSDTFREQLPMAVDMLQHDKEKNIVMYCTGGIRCEKASAYMLHNGFKNVFHVEG
YCEA_ESCF3      NHYEYEVGHFENAMEIPADTFREQLPKAVEMMQEHKDKKIVMYCTGGIRCEKASAWMKHNGFEKVWHIEG
Y595_RHOOB      NGFEAEIGRFRDAVVPDVSTTRDFVHELDSGKDHLKDKAVVTYCTGGVRCEVLSSLMRSRGFGEVYQLDG
YCEA_SALAR      NHYEYEVGHFENALEIPADTFREQLPKAVEMLREHADKKIVMYCTGGIRCEKASAWMKHNGFNKVWHIEG
Y2131_BDEBA     NWYEYKIGTFKGALNPNIEKFTEFPQYI-EAQGIPKDKKMLIFCTGGIRCEKGILELQDKGYNNVFQLDG
Y1094_PROMP     NHYEVSIGSFKKSINPNTENFSEFPEWVDDNLGKYISKNIAMFCTGGIRCEKATSLLKKKGYKNIFHLQG
YCEA_SALPB      NHYEYEVGHFENALEIPADTFREQLPKAVEMLREHADKKIVMYCTGGIRCEKASAWMKHNGFNKVWHIEG
YCEA_SALPK      NHYEYEVGHFENALEIPADTFREQLPKAVEMLREHADKKIVMYCTGGIRCEKASAWMKHNGFNKVWHIEG
YCEA_SALPA      NHYEYEVGHFENALEIPADTFREQLPKAVEMLREHADKKIVMYCTGGIRCEKASAWMKHNGFNKVWHIEG
YCEA_SALEP      NHYEYEVGHFENALEIPADTFREQLPKAVEMLREHADKKIVMYCTGGIRCEKASAWMKHNGFNKVWHIEG
YCEA_SALDC      NHYEYEVGHFENALEIPADTFREQLPKAVEMLREHADKKIVMYCTGGIRCEKASAWMKHNGFNKVWHIEG
YCEA_SALA4      NHYEYEVGHFENALEIPADTFREQLPKAVEMLREHADKKIVMYCTGGIRCEKASAWMKHNGFNKVWHIEG
Y201_EHRRG      NSYEINFGKFKNSINPETNCFRDFPDWISWAKNKIDDDPIIMYCTGGIRCEKSTAFMKDLGFSKVYHLKG
Y1886_SERP5     NHYEYEVGHFENAIEVPSDTFRDQVEMLQDNK----DKNIVMYCTGGIRCEKASAYMLHNGFKNVYHVEG
YCEA_SALSV      NHYEYEVGHFENALEIPADTFREQLPKAVEMLREHADKKIVMYCTGGIRCEKASAWMKHNGFNKVWHIEG
YCEA_SALG2      NHYEYEVGHFENALEIPADTFREQLPKAVEMLREHADKKIVMYCTGGIRCEKASAWMKHNGFNKVWHIEG
YCEA_ECOSM      NHYEYEVGHFENALEIPADTFREQLPKAVEMMQAHKDKKIVMYCTGGIRCEKASAWMKHNGFNKVWHIEG
Y2403_BRAJA     NAFEVAMGTFEGAVDPGIKSFGQFKDFAAERLDPAKHRRIAMFCTGGIRCEKASAHLLARGFAEVYHLKG
Y153_CORK4      NAMEAEIGKFRNAVVPNTTTTRDFLNEIESGKYDDLKKRVVTYCTGGIRCEVLSVLMKNRGFEEVYQLDG
Y1055_PROMM     NDYEVAIGEFKGAINPQTKCFRDFPAWVEQQLRSMVKARIAMYCTGGIRCEKATSYLIEKGFTNVHHLRG
YCEA_SALHS      NHYEYEVGHFENALEIPADTFREQLPKAVEMLREHADKKIVMYCTGGIRCEKASAWMKHNGFNKVWHIEG
YCEA_SHIDS      NHYEYEVGHFENALEIPADTFREQLPKAVEMMQAHKDKKIVMYCTGGIRCEKASAWMKHNGFNKVWHIEG
Y359_BUCAT      NSYEYAIGHFENAIEIKSITFREQLKKVIQLMAYAKNKKIVMYCTGGIRCEKATSWMLFNGFKHVYHLEG
Y358_BUCA5      NSYEYAIGHFENAIEIKSITFREQLKKVIQLMAYAKNKKIVMYCTGGIRCEKATSWMLFNGFKHVYHLEG
YCEA_SHISS      NHYEYEVGHFENALEIPADTFREQLPKAVEMMQAHKDKKIVMYCTGGIRCEKASAWMKHNGFNKVWHIEG
YCEA_SHIFL      NHYEYEVGHFENALEIPADTFREQLPKAVEMMQAHKDKKIVMYCTGGIRCEKASAWMKHNGFNKVWHIEG
YCEA_SHIF8      NHYEYEVGHFENALEIPADTFREQLPKAVEMMQAHKDKKIVMYCTGGIRCEKASAWMKHNGFNKVWHIEG
YCEA_ECOLI      NHYEYEVGHFENALEIPADTFREQLPKAVEMMQAHKDKKIVMYCTGGIRCEKASAWMKHNGFNKVWHIEG
YCEA_ECODH      NHYEYEVGHFENALEIPADTFREQLPKAVEMMQAHKDKKIVMYCTGGIRCEKASAWMKHNGFNKVWHIEG
YCEA_ECOBW      NHYEYEVGHFENALEIPADTFREQLPKAVEMMQAHKDKKIVMYCTGGIRCEKASAWMKHNGFNKVWHIEG
YCEA_ECO8A      NHYEYEVGHFENALEIPADTFREQLPKAVEMMQAHKDKKIVMYCTGGIRCEKASAWMKHNGFNKVWHIEG
YCEA_ECO7I      NHYEYEVGHFENALEIPADTFREQLPKAVEMMQAHKDKKIVMYCTGGIRCEKASAWMKHNGFNKVWHIEG
YCEA_ECO55      NHYEYEVGHFENALEIPADTFREQLPKAVEMMQAHKDKKIVMYCTGGIRCEKASAWMKHNGFNKVWHIEG
YCEA_ECO27      NHYEYEVGHFENALEIPADTFREQLPKAVEMMQAHKDKKIVMYCTGGIRCEKASAWMKHNGFNKVWHIEG
YCEA_ECO24      NHYEYEVGHFENALEIPADTFREQLPKAVEMMQAHKDKKIVMYCTGGIRCEKASAWMKHNGFNKVWHIEG
Y997_PROM3      NDYEIAIGEFKGAINPQTKCFRDFPAWVEQQLRSMVSARIAMYCTGGIRCEKATSYLIEKGFTNVHHLRG
Y2095_XANC8     NAQEVAYGTFQGALTLPIDKFTELPEALQPHRAALADATVVSFCTGGIRCEKAALWMHAEGMDNVLQLEG
Y2086_XANCP     NAQEVAYGTFQGALTLPIDKFTELPEALQPHRAALADATVVSFCTGGIRCEKAALWMHAEGMDNVLQLEG
YCEA_ECOSE      NHYEYEVGHFENALEIPADTFREQLPKAVEMMQAHKDKKIVMYCTGGIRCEKASAWMKHNGFNKVWHIEG
YCEA_ECOLU      NHYEYEVGHFENALEIPADTFREQLPKAVEMMQAHKDKKIVMYCTGGIRCEKASAWMKHNGFNKVWHIEG
YCEA_ECOL6      NHYEYEVGHFENALEIPADTFREQLPKAVEMMQAHKDKKIVMYCTGGIRCEKASAWMKHNGFNKVWHIEG
YCEA_ECOL5      NHYEYEVGHFENALEIPADTFREQLPKAVEMMQAHKDKKIVMYCTGGIRCEKASAWMKHNGFNKVWHIEG
YCEA_ECOK1      NHYEYEVGHFENALEIPADTFREQLPKAVEMMQAHKDKKIVMYCTGGIRCEKASAWMKHNGFNKVWHIEG
YCEA_ECO45      NHYEYEVGHFENALEIPADTFREQLPKAVEMMQAHKDKKIVMYCTGGIRCEKASAWMKHNGFNKVWHIEG
Y3487_KLEP3     NHYEYEVGHFENALEIPADTFRDQLPKAVEMMQDHKDKKIVMYCTGGIRCEKASAWMKHNGFNKVWHIEG
Y330_BUCBP      NHYEYKIGHFDSAINVPVNTFREQLFHIVDFLKHYKNRDIIMYCTGGIRCEKATAWIKYNGFKNVYQIKG
Y204_EHRRW      NSYEINFGKFKNSINPETNCFRDFPDWISWAKNKIDDDPIIMYCTGGIRCEKSTAFMKDLGFSKVYHLKG
YCEA_ECO81      NHYEYEVGHFENALEIPADTFREQLPKAVEMMQAHKDKKIVMYCTGGIRCEKASAWMKHNGFNKVWHIEG
Y2387_XANCB     NAQEVAYGTFQGALTLPIDKFTELPEALQPHRAALADATVVSFCTGGIRCEKAALWMHAEGMDNVLQLEG
YCEA_SALCH      NHYEYEVGHFENALEIPADTFREQLPKAVEMLREHADKKIVMYCTGGIRCEKASAWMKHNGFNKVWHIEG
Y365_BUCAI      NSYEYAIGHFENAIEIKSITFREQLKKVIQLMAYAKNKKIVMYCTGGIRCEKATSWMLFNGFKHVYHLEG
Y1781_ERWCT     NHYEYEVGHFQNALEVPSDTFREQLPMAVDMLDDIRDKNIVMYCTGGIRCEKASAYMLHHGFKNVYHVEG
YCEA_SALTY      NHYEYEVGHFENALEIPADTFREQLPKAVEMLREHADKKIVMYCTGGIRCEKASAWMKHNGFNKVWHIEG
YCEA_SALTI      NHYEYEVGHFENALEIPADTFREQLPKAVEMLREHADKKIVMYCTGGIRCEKASAWMKHNGFNKVWHIEG
Y1048_SODGM     NHYEYEVGHFDQAIEIPSDTFREQLPMVVEMLQHDKDKKIVMYCTGGIRCEKASAWMRHNGFKNVYHVEG
Y2519_PECCP     NHYEYEVGHFENALEVPSDTFREQLPMAVEMLDEARDKNIVMYCTGGIRCEKASAYMLHHGFKNVYHVEG
Y081_HAMD5      NHYEYEVGHFKNAIKVPSDTFREQLPMAVDMLKEDKEKKMVLYCTGGIRCEKASAYLLHHGFKNVYHVEG
Y2011_CITK8     NHYEYEVGHFENALEIPADTFREQLPKAVEMMQEHRDKKIVMYCTGGIRCEKASAWMKHNGFNKVWHIEG
YCEA_ECOLC      NHYEYEVGHFENALEIPADTFREQLPKAVEMMQAHKDKKIVMYCTGGIRCEKASAWMKHNGFNKVWHIEG
YCEA_ECOHS      NHYEYEVGHFENALEIPADTFREQLPKAVEMMQAHKDKKIVMYCTGGIRCEKASAWMKHNGFNKVWHIEG
YCEA_ECO5E      NHYEYEVGHFENALEIPADTFREQLPKAVEMMQAHKDKKIVMYCTGGIRCEKASAWMKHNGFNKVWHIEG
YCEA_ECO57      NHYEYEVGHFENALEIPADTFREQLPKAVEMMQAHKDKKIVMYCTGGIRCEKASAWMKHNGFNKVWHIEG
Y1201_PROM0     NHYEVSIGTFQNSINPNTKNFSEFPKWVDDHLDTHLENKIAMFCTGGIRCEKATTLLKKKGYKNVYHLQG
Y1105_PROM9     NHYEVSVGTFQNSINPNTRNFSEFPKWVDDQLDTHLENKIAMFCTGGIRCEKATSLLKKKGYKNIYHLQG
Y2930_XANOM     NAQEVVYGTFQGALTLPIDTFTELPGALESHRAALADATVVSFCTGGIRCEKAALWMQADGMDNVLQLEG
Y2292_ENTS8     NHYEYEVGHFENALEIPADTFRAQLPKAVEMMQEYKDKKIVMYCTGGIRCEKASAFMRHNGFQKVWHIEG
Y1514_XANOP     NAQEVVYGTFQGALTLPIDTFTELPGALESHRAALADATVVSFCTGGIRCEKAALWMQADGMDNVLQLEG
Y1230_PROM2     NHYEVSIGTFQNSINPNTRNFSEFPKWVDDHLDNHLEDKIAMFCTGGIRCEKATSLLKKKGYKNIYHLQG
Y4043_DELAS     NDFEVDAGAFKDTIDWRITKFTEFPPALRAHKAELADKTVVSYCTGGIRCEKAAILMRDEGLEHVYQLEG
Y353_BUCAP      NSYEYEIGHFPNAIEIKSQTFREQLKKVIQIMHYAKNKKIVMYCTGGIRCEKASAWMHFNGFKYVYHLKN
Y1200_PROMS     NHYEISVGTFQNSINPNTRNFSEFPKWVDDHLNTHLENKIAMFCTGGIRCEKATSLLKKKGYKNIYHLKG
Y2109_XANAC     NAQEVRYGTFQGALTLPIDKFTDLPGALEPHRAALADATVVSFCTGGIRCEKAALWMQADGMDNVLQLEG
Y899_RALEH      NDFEVAVGTFEDAVEYDIAKFSEFPEAVAAHKAELEGKTVVSFCTGGIRCEKAAIHMQEVGVERVYQLEG
Y1074_PELUB     KPFEYNVGTFKRSVNPDVANFREFPKYLNKLKKT---KPIAMFCTGGIRCEKASVFLEKKGFKNVYQLKG
Y065_WIGBR      NSYEYEIGHFENALKISSKTFRQQLKLLINNLKFYKSKNIIMYCTGGIRCEAASAWMMHNGFKYVSFLDG
Y839_BORBR      NAFEVEVGTFRGALDWRIERFTQFPQAVRDNQAALAGKTVVSFCTGGIRCEKAAIYMAEAGIEHVYQLEG
Y179_BORPE      NAFEVEVGTFRGALDWRIERFTQFPQAVRDNQAALAGKTVVSFCTGGIRCEKAAIYMAEAGIEHVYQLEG
Y754_BORPA      NAFEVEVGTFRGALDWRIERFTQFPQAVRDNQAALAGKTVVSFCMGGIRCEKAAIYMAEAGIEHVYQLEG
Y753_RALME      NAFEVAVGTFDKAVEYGIDKFSEFPPAVAENKAEFEGKTIVSFCTGGIRCEKAAIHMQEVGIDHVYQLEG
Y2353_BURCM     NAFEVDVGTFDGALDYRIDKFSEFPEVIDANRADLEGRTVVSFCTGGIRCEKAAIHMKEIGIDNVYQLEG
Y2233_BURA4     NAFEVDVGTFDGALDYRIDKFSEFPEVIDANRADLEGRTVVSFCTGGIRCEKAAIHMKEIGIDNVYQLEG
Y810_CUPTR      NDFEVAVGTFENAVEYDIAKFSEFPDAVAAHKAELDGKTVVSFCTGGIRCEKAAIHMQEVGIERVYQLEG
Y454_BAUCH      NNYEYEVGHFQHAMEIPSRTFREKLPIAIKMLQHNKERKIVMYCTGGIRCEKASAWMLHNGFQHIFQVEG
Y3126_BURM9     NAFEVDVGTFDRALDYRIDKFSEFPAVIEANRADLEGKTIVSFCTGGIRCEKAAIHMKDVGIENVYQLEG
Y2842_BURMS     NAFEVDVGTFDRALDYRIDKFSEFPAVIEANRADLEGKTIVSFCTGGIRCEKAAIHMKDVGIENVYQLEG
Y2825_BURM7     NAFEVDVGTFDRALDYRIDKFSEFPAVIEANRADLEGKTIVSFCTGGIRCEKAAIHMKDVGIENVYQLEG
Y2535_RALEJ     NDFEVAVGTFDNVVEYNLTKFSEFPDVIEARKAEFEGKTVVSFCTGGIRCEKAAIHMQEVGIGHVYQLEG
Y1914_BURMA     NAFEVDVGTFDRALDYRIDKFSEFPAVIEANRADLEGKTIVSFCTGGIRCEKAAIHMKDVGIENVYQLEG
Y1354_BURP1     NAFEVDVGTFDRALDYRIDKFSEFPAVIEANRADLEGKTIVSFCTGGIRCEKAAIHMKDVGIENVYQLEG
Y1204_BURP0     NAFEVDVGTFDRALDYRIDKFSEFPAVIEANRADLEGKTIVSFCTGGIRCEKAAIHMKDVGIENVYQLEG
Y1196_BURP6     NAFEVDVGTFDRALDYRIDKFSEFPAVIEANRADLEGKTIVSFCTGGIRCEKAAIHMKDVGIENVYQLEG
Y1116_BURPS     NAFEVDVGTFDRALDYRIDKFSEFPAVIEANRADLEGKTIVSFCTGGIRCEKAAIHMKDVGIENVYQLEG
Y2206_RALSO     NGFEVAVGTFRDAVEYGIRKFTEFPPAIAAHKDDFAGKTVVSFCTGGIRCEKAAIHMQEIGLQHVYQLEG
Y2370_BURCJ     NAFEVDVGTFDNALDYRIDKFSEFPEVIDANRADLEGKTVVSFCTGGIRCEKAAIHMKEIGIDNVYQLEG
Y2337_BURCC     NAFEVDVGTFDNALDYRIDKFSEFPEVIDANRADLEGKTVVSFCTGGIRCEKAAIHMKEIGIDNVYQLEG
Y2314_BURCH     NAFEVDVGTFDNALDYRIDKFSEFPEVIDANRADLEGKTVVSFCTGGIRCEKAAIHMKEIGIDNVYQLEG
Y4097_BORPD     NAFEVDAGTFEGAVDWRIERFTQFPAAVQAHRDSLRGKTVVSFCTGGIRCEKAALYMAESGVEHVYQLDG
Y983_BURTA      NAFEVDVGTFDNALDYRIDKFSQFPGVIEANRADLEGKTVVSFCTGGIRCEKAAIHMKDVGIENVYQLEG
Y2403_BURVG     NAFEVDVGTFDDALDYRIDKFSQFPEVIDANRADLEGKTVVSFCTGGIRCEKAAIHMKEIGIDHVYQLEG
Y5656_BURS3     NAFEVDVGTFDDALDYRIDKFSEFPEVIDANRADLEGKTVVSFCTGGIRCEKAAIHMKEIGIENVYQLEG
Y1252_BURPP     NAFEVDVGTFDNALDYRITKFSEFPEVIEQNRADLEGKTVVSFCTGGIRCEKAAIHMKEVGIENVYQLEG
Y471_BORA1      NAFEVDVGTFRNAIDWRIDRFTQFPDAVREHRAELEGKTVVSFCTGGIRCEKAAIFMEDIGIAHVYQLEG
Y1152_BURXL     NAFEVDVGTFDNALDYRITKFSEFPEVIEQNRADLEGKTIVSFCTGGIRCEKAAIHMKDVGIENVYQLEG
Y683_THIDA      NDYEVAAGSFENAVDYGIGVFSEFPPQLQRRRDDYAGKTVVSFCTGGIRCEKAAIHMQEIGVERVYQLEG
Y2421_XANC5     NAQEVAYGTFQGALTLPIDKFTDLPGALEPHRGALADATVVSFCTGGIRCEKAALWMQADGMDNVLQLEG
Y2090_XYLF2     NQQEIAYGTFSGAMTLPITKFTGFPGALAHYRDLLSDATVVSFCTGGIRCEKAVLWMRADGMDNVLQLEG
Y1985_XYLFT     NQQEIAYGTFSGAMTLPITKFTGFPGALAHYRDLLSDATVVSFCTGGIRCEKAVLWMRADGMDNVLQLEG
Y2609_XYLFA     NQQEIAYGTFSGAMTLPITKFTGFPGALAHYRDLLSDATVVSFCTGGIRCEKAVLWMRVDGMDNVLQLEG
Y3119_VARPS     NDFEVDEGSFDGAIDWRITKFTEFPPALKAHRADFAGKTVVSFCTGGIRCEKAAILMREEGIENVLQLEG
GLPE_PSEA6      DEQSFVAGHIEGAVH------LTNGTLVNFTQETDFDTPVIVCCYHGVSSQQAAQFLLHQGFEEVYSMDG
GLPE_COXBU      DQDSYEEEHIANALHLSMAKLQEYSE--KADKEK----PVLVYCYHGISSQSVAQHLVEQGFKEVYSLIG
GLPE_COXBR      DQDSYEEEHIANALHLSMAKLQEYSE--KADKEK----PVLVYCYHGISSQSVAQHLVEQGFKEVYSLIG
GLPE_COXB2      DQDSYEEEHIANALHLSMAKLQEYSE--KADKEK----PVLVYCYHGISSQSVAQHLVEQGFKEVYSLIG
GLPE_COXB1      DQDSYEEEHIANALHLSMAKLQEYSE--KADKEK----PVLVYCYHGISSQSVAQHLVEQGFKEVYSLIG
GLPE_PSEFS      DQPTYAAGHITGAQHVDNVNIADF------IRAADLDAPVIVACYHGNSSQSAAAYLVSQGFSDVYSLDG
GLPE_PSEHT      DPNSYQAGHIPGSEALSNANIAHFMM------EKEFDQPIIIVCYHGMSSQGAASYLVEQGFEDVYSMDG
GLPE_PSEF5      DPQTYALNHISGSQHLDNHSISDFI------RAADLDAPLVVVCYHGNSSQSAAAYLVSQGFSDVYSLDG
GLPE_PSEU2      DPQAFESNHIPDSVHLDNHSIADFI------READLDKPLVVVCYHGNSSQSAAAYLVGQGFSDVYSVDG
GLPE_PSE14      DAQTFQSNHIPDSVHLDNHSIADFIA------KADLDKPLVVVCYHGNSSQSAAAYLVGQGFSDVYSVDG
CALU_XENLA      EDIDIDLEEYIGDMYNHDGDANE-PEWVKTEREQFMEFRDKNH-DGKMDKEETKDWILPSDY-DHSEAES
YIBN_ECOLI      QRDDFRKGHIAGSINL-------LPSEIKANNEKHKDKPVIVVDGSGMQCQEPANALTKAGFAQVFVLKE
YIBN_ECOL6      QRDDFRKGHIAGSINL-------LPSEIKANNEKHKDKPVIVVDGSGMQCQEPANALTKAGFAQVFVLKE
YIBN_ECO57      QRDDFRKGHIAGSINL-------LPSEIKANNEKHKDKPVIVVDGSGMQCQEPANALTKAGFAQVFVLKE
GLPE_PASMU      NETHFALAHPAQAFHLSHQSYGEFEMQYED------DHPVIVICYHGVSSRGAAMYLIEQGYTQVYSVTG
GLPE_SHEON      DGNSFNNGHIDGAFNLNNENLAHFIG------QADMDRPLVVVCYHGISSQNAAQYLCEQGFDDVYSLDG
Y1743_ERWT9     ----------------------------------------------------------------------
GLPE_PSEU5      DPHSFANGHISGSRHLDNHSL---PDFIAAAD---LDHPLIVTCYHGHSSQSAAAYLVNQGFSEVYSLDG
GLPE_PSEPW      DPQAYAAGHIAGARHLDNHSVAD---FIRNAD---LDAPTLVVCYHGNSSQSAAAYLVGQGFSDVYSVDG
GLPE_HAEIN      DNMRFAYSHPKGAFHLTNQSFLQFEELAD------FDSPIIVSCYHGVSSRNVATFLVEQGYKNVFSMIG
GLPE_HAEIG      DNMRFAYSHPKGAFHLTNQSFLQFEELAD------FDSPIIVSCYHGVSSRNVATFLVEQGYKNVFSMIG
GLPE_HAEI8      DNMRFAYSHPKGAFHLTNQSFLQFEELAD------FDSPIIVSCYHGVSSRNVATFLVEQGYKNVFSMIG
YAY7_SCHPO      EPDEFKQGAIETSYNLPVGKIEEAMKLSDEEFSKVFEDNVVVYCRSGRRSTTASDILTKLGYKNIGNYTG


                         .         .         .         +         .         .         .:280
query           GIATYGKDPEVQGELWDGKMYVFDERIAVDVNHVNPTIVGKDWFDGTPCERYVNCGNPFCNRRILTSEEN
Y154_STRZP      GIATYGKDPEVQGELWDGKMYVFDERIAVDVNHVNPTIVGKDWFDGTPCERYVNCGNPFCNRRILTSEEN
Y092_STRP4      GIATYGKDPEVQGELWDGKMYVFDERIAVDVNHVNPTIVGKDWFDGTPCERYVNCGNPFCNRRILTSEEN
Y125_STRZT      GIATYGKDPEVQGELWDGKMYVFDERIAVDVNHVNPTIVGKDWFDGTPCERYVNCGNPFCNRRILTSEEN
Y118_STRZJ      GIATYGKDPEVQGELWDGKMYVFDERIAVDVNHVNPTIVGKDWFDGTPCERYVNCGNPFCNRRILTSEEN
Y105_STRPJ      GIATYGKDPEVQGELWDGKMYVFDERIAVDVNHVNPTIVGKDWFDGTPCERYVNCGNPFCNRRILTSEEN
Y095_STRPN      GIATYGKDPEVQGELWDGKMYVFDERIAVDVNHVNPTIVGKDWFDGTPCERYVNCGNPFCNRRILTSEEN
Y091_STRP2      GIATYGKDPEVQGELWDGKMYVFDERIAVDVNHVNPTIVGKDWFDGTPCERYVNCGNPFCNRRILTSEEN
Y090_STRPS      GIATYGKDPEVQGELWDGKMYVFDERIAVDVNHVNPTIVGKDWFDGTPCERYVNCGNPFCNRRILTSEEN
Y084_STRR6      GIATYGKDPEVQGELWDGKMYVFDERIAVDVNHVNPTIVGKDWFDGTPCERYVNCGNPFCNRRILTSEEN
Y194_STRPI      GIATYGKDPEVQGELWDGKMYVFDERIAVDVNHVNPTIVGKDWFDGTPCERYVNCGNPFCNRRILTSEEN
Y154_STRP7      GIATYGKDPEVQGELWDGKMYVFDERIAVDVNHVNPTIVGKDWFDGTPCERYVNCGNPFCNRRILTSEEN
Y593_STRSV      GIATYGKDPEVQGELWDGKMYVFDERISVDINHVNPVVIGKDWFDGTPCERYVNCGNPECNRRILTSEEN
Y476_STRGC      GIATYGKDPEVQGELWDGKMYVFDERISVDINHVDPVVIGKDWFDGTPCERYVNCGNPECNRRILTSEEN
Y548_STRT1      GIVTYGKDPEVQGELWDGKLYVFDERIAVDVNHVDPIVVGKDWFDGTPCERYVNCGNPFCNRRILTSEEN
Y548_STRT2      GIVTYGKDPEVQGELWDGKLYVFDERIAVDVNHVDPIVVGKDWFDGTPCERYVNCGNPFCNRRILTSEEN
Y588_STRTD      GIVTYGKDPEVQGELWDGKLYVFDERIAVDVNHVDPIVVGKDWFDGTPCERYVNCGNPFCNRRILTSEEN
Y406_STRSY      GIATYGKDPEVRGELWDGKMYVFDERIAXXXXXXXXXXXGKDWFDGTPCERYVNCGNPFCNRRILTSEEN
Y392_STRS2      GIATYGKDPEVRGELWDGKMYVFDERIAXXXXXXXXXXXGKDWFDGTPCERYVNCGNPFCNRRILTSEEN
Y1504_STRA3     GIATYGKDPEVQGELWDGAMYVFDDRISVPINHVNPTVISKDYFDGTPCERYVNCANPFCNKQIFASEEN
Y1469_STRA1     GIATYGKDPEVQGELWDGAMYVFDDRISVPINHVNPTVISKDYFDGTPCERYVNCANPFCNKQIFASEEN
Y1434_STRA5     GIATYGKDPEVQGELWDGAMYVFDDRISVPINHVNPTVISKDYFDGTPCERYVNCANPFCNKQIFASEEN
Y630_STRP3      GIATYGKDPEVQGELWDGAMYVFDDRISVPINHVNPTVVSKDYFDGTPCERYVNCANPFCNKQIFASEEN
Y973_STRP8      GIATYGKDPEVQGELWDGAMYVFDDRISVPINHVNPTVISKDYFDGTPCERYVNCANPFCNKQIFASEEN
Y915_STRP1      GIATYGKDPEVQGELWDGAMYVFDDRISVPINHVNPTVISKDYFDGTPCERYVNCANPFCNKQIFASEEN
Y811_STRPF      GIATYGKDPEVQGELWDGAMYVFDDRISVPINHVNPTVISKDYFDGTPCERYVNCANPFCNKQIFASEEN
Y743_STRP6      GIATYGKDPEVQGELWDGAMYVFDDRISVPINHVNPTVISKDYFDGTPCERYVNCANPFCNKQIFASEEN
Y726_STRPZ      GIATYGKDPEVQGELWDGAMYVFDDRISVPINHVNPTVISKDYFDGTPCERYVNCANPFCNKQIFASEEN
Y1090_STRPG     GIATYGKDPEVQGELWDGAMYVFDDRISVPINHVNPTVISKDYFDGTPCERYVNCANPFCNKQIFASEEN
Y776_STRPD      GIATYGKDPEVQGELWDGAMYVFDDRISVPINHVNPTVISKDYFDGTPCERYVNCTNPFCNKQIFASEEN
Y789_STRPB      GIATYGKDPEVQGELWDGAMYVFDDRISVPINHVNPTVISKDYFDGTPCERYVNCANPFCNKQIFASEEN
Y773_STRPC      GIATYGKDPEVQGELWDGAMYVFDDRISVPINHVNPTVISKDYFDGTPCERYVNCANPFCNKQIFASEEN
Y697_STRPM      GIATYGKDPEVQGELWDGAMYVFDDRISVPINHVNPTVISKDYFDGTPCERYVNCANPFCNKQIFASEEN
Y1138_STRU0     GIATYGKDPEVQGELWDGAMYVFDERISVPINHVDPTVISKDHFDGRPCERYVNCANPFCNKQIFASEEN
YMDE_LACLA      GIATYGKDPEVQGDLWDGQMYVFDSRIAVPINQKEHVIVGRDWFDGSPCERYINCGNPECNRQMLASEEN
Y1287_LACLM     GIATYGKDPEVQGDLWDGQMYVFDSRIAVPINQKEHVIVGRDWFDGSPCERYINCGNPECNRQMLASKEN
Y1324_LACLS     GIATYGKDPEVQGDLWYGQMYVFDSRIAVPINQKEHVIVGRDWFDGSPCERYINCGNPECNRQMLASKEN
Y748_ENTFA      GIANYGKNPETRGELWDGKMYVFDDRISVEINHVDKKVIGKDWFDGTPCERYINCANPECNRQILTSEEN
Y2654_BACSK     GIVTYGKDPEVKGELWDGKCYVFDERLTVPINHVAPTVVGKDYFDGKPCERYVNCANPECNKQILCSEEN
Y3574_BACLD     GIVTYGKDPEVQGELWDGKCYVFDERISVPVNQKEHVIVGKDYFTGEPCERYVNCANPECNKQIICSEEN
Y1400_LISW6     GIATYGKNEETKGELWDGQMYVFDERIAVPINQVNPTIVGKDYFDGTPCERYINCANPYCNKQILASIEN
Y1185_LISMH     GIATYGKNEETKGELWDGQMYVFDERIAVPINQVNPTIVGKDYFDGTPCERYINCANPYCNKQILASVEN
Y1403_LISMF     GIATYGKNEETKGELWDGQMYVFDERIAVPINQVNPTIVGKDYFDGTPCERYINCANPYCNKQILASIEN
Y1393_LISMC     GIATYGKNEETKGELWDGQMYVFDERIAVPINQVNPTIVGKDYFDGTPCERYINCANPYCNKQILASIEN
Y1384_LISMO     GIATYGKNEETKGELWDGQMYVFDERIAVPINQVNPTIVGKDYFDGTPCERYINCANPYCNKQILASVEN
Y1421_LISIN     GIATYGKNEETKGELWDGQMYVFDERIAVPINQVNPTIVGKDYFDGTPCERYINCANPYCNKQILASLEN
Y127_STAS1      GIATYGKDPETKGEFWDGKMYVFDERISVEVNHVDKTVVGKEWFDGTPCERYINCSNPECNKQILVSEEN
Y1961_BACC1     GIVTYGKDPEVQGELWDGQCYVFDERIAVPVNQKEHVIVGKDYFTGEPCERYVNCANPECNKKILCSEEN
Y1989_BACC7     GIVTYGKDPEVQGELWDGQCYVFDERIAVPVNQKEHVIVGKDHFTGEPCERYVNCSNPECNKKILCSEEN
Y1948_BACC3     GIVTYGKDPEVQGELWDGQCYVFDERIAVPVNQKEHVIVGKDHFTGEPCERYVNCANPECNKKILCSEEN
Y1658_BACAH     GIVTYGKDPEVQGELWDGQCYVFDERIAVPVNQKEHVIVGKDHFTGEPCERYVNCANPECNKKILCSEEN
Y1875_BACCQ     GIVTYGKDPEVQGELWDGQCYVFDERIAVPVNQKEHVIVGKDHFTGEPCERYVNCSNPECNKKILCSEEN
Y3469_BACC2     GIVTYGKDPEVQGELWDGQCYVFDERIAVPVNQKEHVIVGKDHFTGEPCERYVNCSNPECNKKILCSEEN
Y299_STAHJ      GIATYGKDPETKGQYWDGKMYVFDERISVDVNQVEKTVIGKEHFDGTPCERYINCSNPECNKQILVSEEN
Y2712_BACAC     GIVTYGKDPEVQGELWDGQCYVFDERIAVPVNQKEHVIVGKDHFTGEPCERYVNCANPECNKKILCSEEN
Y1948_BACAA     GIVTYGKDPEVQGELWDGQCYVFDERIAVPVNQKEHVIVGKDHFTGEPCERYVNCANPECNKKILCSEEN
Y1916_BACC0     GIVTYGKDPEVQGELWDGQCYVFDERIAVPVNQKEHVIVGKDHFTGEPCERYVNCANPECNKKILCSEEN
Y1881_BACAN     GIVTYGKDPEVQGELWDGQCYVFDERIAVPVNQKEHVIVGKDHFTGEPCERYVNCANPECNKKILCSEEN
Y1875_BACC4     GIVTYGKDPEVQGELWDGQCYVFDERIAVPVNQKEHVIVGKDHFTGEPCERYVNCSNPECNKKILCSEEN
Y1804_BACCR     GIVTYGKDPEVQGELWDGQCYVFDERIAVPVNQKEHVIVGKDHFTGEPCERYVNCSNPECNKKILCSEEN
Y1719_BACHK     GIVTYGKDPEVQGELWDGQCYVFDERIAVPVNQKEHVIVGKDHFTGEPCERYVNCANPECNKKILCSEEN
Y1694_BACCZ     GIVTYGKDPEVQGELWDGQCYVFDERIAVPVNQKEHVIVGKDHFTGEPCERYVNCANPECNKKILCSEEN
Y1736_BACWK     GIVTYGKDPEVQGELWDGQCYVFDERIAVPVNQKEHVIVGKDHFTGEPCERYVNCANPECNKKILCSEES
Y572_OCEIH      GIVTYGQDPEVQGDLWDGQLYVFDERISVPVNRKEHVIVGKDYFDGEPCERYVNCANPECNKQILASEEN
Y1464_BACCN     GIVTYGKDPEVQGELWDGQCYVFDERIAVPVNQKEHVIVGRDHFTNEPCERYVNCANPECNKQILCSEEN
Y2770_STAA2     GIATYGKDPETKGQYWDGKMYVFDDRISVDINQVEKTIIGKDWFDGKPCERYINCANPECNKQILVSEEN
Y2713_STAA9     GIATYGKDPETKGQYWDGKMYVFDDRISVDINQVEKTIIGKDWFDGKPCERYINCANPECNKQILVSEEN
Y2689_STAAM     GIATYGKDPETKGQYWDGKMYVFDDRISVDINQVEKTIIGKDWFDGKPCERYINCANPECNKQILVSEEN
Y2673_STAA1     GIATYGKDPETKGQYWDGKMYVFDDRISVDINQVEKTIIGKDWFDGKPCERYINCANPECNKQILVSEEN
Y2481_STAAN     GIATYGKDPETKGQYWDGKMYVFDDRISVDINQVEKTIIGKDWFDGKPCERYINCANPECNKQILVSEEN
Y2609_STAAW     GIATYGKDPETKGEYWDGKMYVFDDRISVNINQVEKTIIGKDWFDGKPCERYINCANPECNKQILVSEEN
Y2575_STAAS     GIATYGKDPETKGEYWDGKMYVFDDRISVNINQVEKTIIGKDWFDGKPCERYINCANPECNKQILVSEEN
Y3024_STAA8     GIATYGKDPETKGEYWDGKMYVFDDRISVDINQVEKTIIGKDWFDGKPCERYINCANPECNKQILVSEEN
Y2691_STAAT     GIATYGKDPETKGEYWDGKMYVFDDRISVDINQVEKTIIGKDWFDGKPCERYINCANPECNKQILVSEEN
Y2622_STAA3     GIATYGKDPETKGEYWDGKMYVFDDRISVDINQVEKTIIGKDWFDGKPCERYINCANPECNKQILVSEEN
Y2587_STAAE     GIATYGKDPETKGEYWDGKMYVFDDRISVDINQVEKTIIGKDWFDGKPCERYINCANPECNKQILVSEEN
Y262_STAES      GIATYGKDPETKGQYWDGKMYVFDERISVDVNQIDKTVIGKEHFDGTPCERYINCANPECNKQILVSEEN
Y1123_ACHLI     GIHNYGTSKDTEGKLWDGKMYVFDERIAVDINKHEHVVVGRDYFTNEPCERYINCGNPECNKQILASEAS
Y2316_STAEQ     GIATYGKDPETKGLYWDGKMYVFDERISVDVNQIDKTVIGKEHFDGTPCERYINCANPECNKQILVSEEN
Y2713_STAAC     GIATYGKDPETKSEYWDGKMYVFDDRISVDINQVEKTIIGKDWFDGKPCERYINCANPECNKQILVSEEN
Y2771_STAAR     GIATYGKDPETKGQYWDGKMYVFDDRISVDINQVEKTIIGKDWFDGKPCERYINCANPECNKQILVSEEN
YBFQ_BACSU      GIVTYGKDPEVQGKLWDGQCYVFDERISVPVNRVEHVIVGKDYFTGEPCERYVNCANPSCNKKMICTPEN
Y2565_STAAB     GIATYGKDPETKGQYWDGKMYVFDDRISVDINEVEKTIIGKDWFDGKPCERYINCANPECNKQILVSEEN
Y2303_STACT     GIATYGKDPETKGELWDGKMYVFDERISVDVNQVEKTVIGKEWFDGTPCERYINCSNPECNKQILVSEEN
Y205_BACP2      GIVTYGKDPEVQGKLWDGQCYVFDTRLTVPVNQTEHVVVGKDFFTGEPCERYVNCANPACNRKMIATEES
Y274_BACA2      GIVTYGKDPEVKGQMWDGQCYVFDERISVPVNRVEHVIIGKDYFTGEPCERYVNCANPACNKKMICTPEN
Y085_ONYPE      GIISYGKHPETQGALWDGQMYVFDQRIAVPVNQKEHVIVGKDYFDGTPCERYINCSNPQCNKQILCHEYN
Y630_AYWBP      GIISYGKHPETQGVLWDGQMYVFDQRIAVTVNQKEHVIVGKDYFDGTPCERYINCSNPQCNKQILCHEHN
Y2691_CYTH3     GIIKYG--IEQGGEDFEGKCYVFDGRVIADVNKVNPSIISTCYVCGTLSDRMVNCSNPVCNRHEPMCEAC
Y2281_BRUO2     GILKYLEEVPREQSMWNGECFVFDERVAVGHGLAESDV-----------ELCRACRRPLTPQDKLSQFFE
Y3086_BRUSU     GILKYLEEVPREQSVWNGECFVFDERVAVGHGLAESDV-----------ELCRACRRPLTPQDKLSQFFE
Y2589_BRUC2     GILKYLEEVPREQSVWNGECFVFDERVAVGHGLAESDV-----------ELCRACRRPLTPQDKLSQFFE
Y800_BRUA1      GILKYLEEVPREQSMWNGECFVFDERVAVGHGLAESDV-----------ELCRACRR