[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for spne4:ACF56852.1

[Show Plain Result]


## Summary of Sequence Search
    1::156
    1::156     7e-58  65%  157 aa  ARGR_STRSU RecName: Full=Arginine regulator;
    1::156     8e-56  62%  156 aa  ARGR_STRGC RecName: Full=Arginine regulator;
    1::154     3e-50  58%  157 aa  ARGR_STRPZ RecName: Full=Arginine repressor;
    1::154     3e-50  58%  157 aa  ARGR_STRP8 RecName: Full=Arginine regulator;
    1::154     3e-50  58%  157 aa  ARGR1_STRP6 RecName: Full=Arginine regulator;
    1::154     3e-50  58%  157 aa  ARGR1_STRP3 RecName: Full=Arginine regulator;
    1::154     3e-50  58%  157 aa  ARGR1_STRP1 RecName: Full=Arginine regulator;
    1::139     3e-24  41%  150 aa  ARGR_STAHJ RecName: Full=Arginine repressor;
    1::141     5e-24  42%  150 aa  ARGR_STAS1 RecName: Full=Arginine repressor;
    1::141     7e-24  40%  150 aa  ARGR_STAES RecName: Full=Arginine repressor;
    1::141     7e-24  40%  150 aa  ARGR_STAEQ RecName: Full=Arginine repressor;
    1::139     9e-24  41%  149 aa  ARGR_LISIN RecName: Full=Arginine repressor;
    1::139     1e-23  41%  150 aa  ARGR_STACT RecName: Full=Arginine repressor;
    1::148     1e-23  42%  149 aa  ARGR_BACLD RecName: Full=Arginine repressor;
    1::139     1e-23  40%  149 aa  ARGR_LISW6 RecName: Full=Arginine repressor;
    1::139     2e-23  40%  149 aa  ARGR_LISMO RecName: Full=Arginine repressor;
    1::139     2e-23  40%  149 aa  ARGR_LISMH RecName: Full=Arginine repressor;
    1::139     2e-23  40%  149 aa  ARGR_LISMF RecName: Full=Arginine repressor;
    1::139     2e-23  40%  149 aa  ARGR_LISMC RecName: Full=Arginine repressor;
    1::139     4e-23  40%  149 aa  ARGR_BACSU RecName: Full=Arginine repressor;AltName: Full=Arginine
    1::136     4e-23  43%  149 aa  ARGR2_BACCR RecName: Full=Arginine repressor;
    1::141     6e-23  40%  150 aa  ARGR_STAAW RecName: Full=Arginine repressor;
    1::141     6e-23  40%  150 aa  ARGR_STAAS RecName: Full=Arginine repressor;
    1::141     6e-23  40%  150 aa  ARGR_STAAR RecName: Full=Arginine repressor;
    1::141     6e-23  40%  150 aa  ARGR_STAAN RecName: Full=Arginine repressor;
    1::141     6e-23  40%  150 aa  ARGR_STAAM RecName: Full=Arginine repressor;
    1::141     6e-23  40%  150 aa  ARGR_STAAE RecName: Full=Arginine repressor;
    1::141     6e-23  40%  150 aa  ARGR_STAAC RecName: Full=Arginine repressor;
    1::141     6e-23  40%  150 aa  ARGR_STAAB RecName: Full=Arginine repressor;
    1::141     6e-23  40%  150 aa  ARGR_STAA9 RecName: Full=Arginine repressor;
    1::141     6e-23  40%  150 aa  ARGR_STAA8 RecName: Full=Arginine repressor;
    1::141     6e-23  40%  150 aa  ARGR_STAA3 RecName: Full=Arginine repressor;
    1::141     6e-23  40%  150 aa  ARGR_STAA2 RecName: Full=Arginine repressor;
    1::141     6e-23  40%  150 aa  ARGR_STAA1 RecName: Full=Arginine repressor;
   11::146     6e-23  41%  150 aa  ARGR_MACCJ RecName: Full=Arginine repressor;
    1::145     9e-23  40%  149 aa  ARGR_GEOSW RecName: Full=Arginine repressor;
    1::132     1e-22  44%  149 aa  ARGR_BACCZ RecName: Full=Arginine repressor;
    1::132     1e-22  44%  149 aa  ARGR_BACCQ RecName: Full=Arginine repressor;
    1::132     1e-22  44%  149 aa  ARGR_BACC7 RecName: Full=Arginine repressor;
    1::132     1e-22  44%  149 aa  ARGR_BACC3 RecName: Full=Arginine repressor;
    1::132     1e-22  44%  149 aa  ARGR_BACAN RecName: Full=Arginine repressor;
    1::132     1e-22  44%  149 aa  ARGR_BACAC RecName: Full=Arginine repressor;
    1::132     1e-22  44%  149 aa  ARGR_BACAA RecName: Full=Arginine repressor;
    1::132     1e-22  44%  149 aa  ARGR2_BACHK RecName: Full=Arginine repressor;
    1::132     1e-22  44%  149 aa  ARGR2_BACC1 RecName: Full=Arginine repressor;
    1::132     4e-22  43%  149 aa  ARGR_BACWK RecName: Full=Arginine repressor;
    6::148     5e-22  40%  149 aa  ARGR_BACA2 RecName: Full=Arginine repressor;
    6::139     3e-21  41%  149 aa  ARGR_OCEIH RecName: Full=Arginine repressor;
    6::139     4e-21  38%  149 aa  ARGR_BACP2 RecName: Full=Arginine repressor;
    1::145     7e-21  38%  149 aa  ARGR_BACST RecName: Full=Arginine repressor;
    1::145     2e-20  38%  149 aa  ARGR_GEOKA RecName: Full=Arginine repressor;
    1::145     3e-20  38%  149 aa  ARGR_GEOTN RecName: Full=Arginine repressor;
    5::148     4e-20  36%  153 aa  ARGR_CLOTH RecName: Full=Arginine repressor;
    1::134     4e-20  40%  149 aa  ARGR_BACHD RecName: Full=Arginine repressor;
    1::145     2e-19  38%  149 aa  ARGR_EXISA RecName: Full=Arginine repressor;
    5::147     4e-19  36%  150 aa  ARGR_DESHY RecName: Full=Arginine repressor;
    5::147     4e-19  36%  150 aa  ARGR_DESHD RecName: Full=Arginine repressor;
    5::148     6e-19  36%  150 aa  ARGR_CARHZ RecName: Full=Arginine repressor;
    1::132     2e-18  37%  149 aa  ARGR_BACSK RecName: Full=Arginine repressor;
    5::146     5e-18  32%  153 aa  ARGR_SYNWW RecName: Full=Arginine repressor;
    2::145     5e-18  34%  149 aa  ARGR1_BACHK RecName: Full=Arginine regulator;
    2::133     2e-17  36%  149 aa  ARGR1_BACCR RecName: Full=Arginine regulator;
    2::145     2e-17  34%  149 aa  ARGR1_BACC1 RecName: Full=Arginine regulator;
   10::145     3e-17  34%  149 aa  ARGR_EXIS2 RecName: Full=Arginine repressor;
    2::135     5e-17  34%  148 aa  ARGR_STRR6 RecName: Full=Arginine repressor;
    2::135     5e-17  34%  148 aa  ARGR_STRPN RecName: Full=Arginine repressor;
    5::146     8e-17  36%  150 aa  ARGR_HALOH RecName: Full=Arginine repressor;
    5::148     1e-16  37%  151 aa  ARGR_MOOTA RecName: Full=Arginine repressor;
   22::174     2e-16  34%  179 aa  ARGR_RENSM RecName: Full=Arginine repressor;
    2::147     2e-16  31%  151 aa  ARGR_ENTFA RecName: Full=Arginine repressor;
    2::133     3e-16  35%  152 aa  ARGR2_LACPL RecName: Full=Arginine repressor;
    5::143     4e-16  37%  153 aa  ARGR_CLOTE RecName: Full=Arginine repressor;
    2::146     5e-16  32%  150 aa  ARGR_FINM2 RecName: Full=Arginine repressor;
    1::145     5e-16  33%  149 aa  ARGR_BREBN RecName: Full=Arginine repressor;
    1::145     7e-16  38%  148 aa  ARGR_ACIC5 RecName: Full=Arginine repressor;
    1::141     9e-16  35%  145 aa  ARGR_STRS7 RecName: Full=Arginine repressor;
    2::147     1e-15  31%  152 aa  ARGR_LACLS RecName: Full=Arginine repressor;
    2::147     1e-15  31%  152 aa  ARGR_LACLA RecName: Full=Arginine repressor;
    5::146     2e-15  32%  151 aa  ARGR_CLONN RecName: Full=Arginine repressor;
    5::146     2e-15  30%  150 aa  ARGR_CLOB8 RecName: Full=Arginine repressor;
   21::148     4e-15  36%  151 aa  ARGR_THEP3 RecName: Full=Arginine repressor;
    1::143     4e-15  32%  153 aa  ARGR1_LACPL RecName: Full=Arginine regulator;
    6::146     6e-15  32%  150 aa  ARGR_SYMTH RecName: Full=Arginine repressor;
    2::147     6e-15  30%  152 aa  ARGR_LACLM RecName: Full=Arginine repressor;
   20::147     7e-15  37%  150 aa  ARGR_THEPX RecName: Full=Arginine repressor;
    1::141     7e-15  34%  145 aa  ARGR2_STRP6 RecName: Full=Arginine repressor;
    1::141     7e-15  34%  145 aa  ARGR2_STRP1 RecName: Full=Arginine repressor;
    5::146     9e-15  32%  150 aa  ARGR_CLOBL RecName: Full=Arginine repressor;
    5::146     9e-15  32%  150 aa  ARGR_CLOBK RecName: Full=Arginine repressor;
    5::146     9e-15  33%  150 aa  ARGR_CLOBJ RecName: Full=Arginine repressor;
    5::146     9e-15  33%  150 aa  ARGR_CLOB6 RecName: Full=Arginine repressor;
   21::174     1e-14  32%  178 aa  ARGR_STRAW RecName: Full=Arginine repressor;
    6::145     1e-14  31%  148 aa  ARGR_ACIBL RecName: Full=Arginine repressor;
    1::141     1e-14  34%  145 aa  ARGR2_STRP3 RecName: Full=Arginine repressor;
   21::166     2e-14  32%  171 aa  ARGR_CORGL RecName: Full=Arginine repressor;
   21::166     2e-14  32%  171 aa  ARGR_CORGB RecName: Full=Arginine repressor;
    1::138     2e-14  36%  145 aa  ARGR_SOLUE RecName: Full=Arginine repressor;
    1::142     3e-14  30%  158 aa  ARGR_BACV8 RecName: Full=Arginine repressor;
   22::175     4e-14  31%  179 aa  ARGR_STRCO RecName: Full=Arginine repressor;
   21::148     5e-14  34%  151 aa  ARGR_THETN RecName: Full=Arginine repressor;
    6::148     5e-14  29%  152 aa  ARGR_THESQ RecName: Full=Arginine repressor;
    6::148     5e-14  29%  152 aa  ARGR_THEP1 RecName: Full=Arginine repressor;
    6::148     5e-14  29%  152 aa  ARGR_THEMA RecName: Full=Arginine repressor;
    5::146     6e-14  30%  150 aa  ARGR_CLOK5 RecName: Full=Arginine repressor;
    5::146     6e-14  30%  150 aa  ARGR_CLOK1 RecName: Full=Arginine repressor;
    5::146     8e-14  30%  151 aa  ARGR_EUBE2 RecName: Full=Arginine repressor;
    5::150     8e-14  33%  152 aa  ARGR_DESRM RecName: Full=Arginine repressor;
    5::129     8e-14  32%  150 aa  ARGR_DESAP RecName: Full=Arginine repressor;
    5::146     8e-14  30%  150 aa  ARGR_CLOAB RecName: Full=Arginine repressor;
    5::148     1e-13  33%  151 aa  ARGR_PELTS RecName: Full=Arginine repressor;
   21::173     1e-13  31%  178 aa  ARGR_STRCL RecName: Full=Arginine repressor;
    1::127     1e-13  37%  148 aa  ARGR_CHLCH RecName: Full=Arginine repressor;
   21::174     2e-13  31%  178 aa  ARGR_STRGG RecName: Full=Arginine repressor;
   15::162     3e-13  32%  164 aa  ARGR_MYCA1 RecName: Full=Arginine repressor;
    9::150     3e-13  29%  157 aa  ARGR_DEIRA RecName: Full=Arginine repressor;
   19::162     5e-13  32%  164 aa  ARGR_MYCPA RecName: Full=Arginine repressor;
   28::146     7e-13  33%  150 aa  ARGR_CLOCE RecName: Full=Arginine repressor;
   20::146     7e-13  30%  150 aa  ARGR_CLOBA RecName: Full=Arginine repressor;
    1::154     7e-13  27%  157 aa  ARGR_BACTN RecName: Full=Arginine repressor;
   11::158     1e-12  27%  163 aa  ARGR_CORDI RecName: Full=Arginine repressor;
   11::156     1e-12  27%  161 aa  ARGR_CORA7 RecName: Full=Arginine repressor;
    1::128     2e-12  36%  149 aa  ARGR_CHLP8 RecName: Full=Arginine repressor;
   23::160     2e-12  30%  172 aa  ARGR_BIFAA RecName: Full=Arginine repressor;
   19::153     2e-12  28%  177 aa  ARGR_COREF RecName: Full=Arginine repressor;
    1::128     2e-12  35%  149 aa  ARGR_CHLTE RecName: Full=Arginine repressor;
    5::146     2e-12  30%  149 aa  ARGR_ALKOO RecName: Full=Arginine repressor;
   21::170     3e-12  31%  170 aa  ARGR_MYCTU RecName: Full=Arginine repressor;
   21::170     3e-12  31%  170 aa  ARGR_MYCTA RecName: Full=Arginine repressor;
   21::170     3e-12  31%  170 aa  ARGR_MYCBT RecName: Full=Arginine repressor;
   21::170     3e-12  31%  170 aa  ARGR_MYCBP RecName: Full=Arginine repressor;
   21::170     3e-12  31%  170 aa  ARGR_MYCBO RecName: Full=Arginine repressor;
    5::146     3e-12  31%  152 aa  ARGR_CLOPH RecName: Full=Arginine repressor;
    2::145     3e-12  31%  152 aa  ARGR_ANATD RecName: Full=Arginine repressor;
    2::145     4e-12  31%  152 aa  ARGR_CALS8 RecName: Full=Arginine repressor;
    5::138     6e-12  30%  150 aa  ARGR2_CLOPE RecName: Full=Arginine repressor;
    1::145     1e-11  35%  146 aa  ARGR_PARD8 RecName: Full=Arginine repressor;
    3::146     1e-11  31%  164 aa  ARGR_THET8 RecName: Full=Arginine repressor;
    3::146     1e-11  31%  164 aa  ARGR_THET2 RecName: Full=Arginine repressor;
   17::157     2e-11  31%  167 aa  ARGR_MYCLE RecName: Full=Arginine repressor;
   17::157     2e-11  31%  167 aa  ARGR_MYCLB RecName: Full=Arginine repressor;
   20::146     2e-11  29%  150 aa  ARGR_CLOBB RecName: Full=Arginine repressor;
    5::149     2e-11  25%  151 aa  ARGR_HELMI RecName: Full=Arginine repressor;
    1::127     2e-11  36%  149 aa  ARGR_CHLPD RecName: Full=Arginine repressor;
   17::157     3e-11  29%  170 aa  ARGR_BIFLI RecName: Full=Arginine repressor;
   26::175     6e-11  28%  175 aa  ARGR_NOCFA RecName: Full=Arginine repressor;
   17::157     6e-11  29%  170 aa  ARGR_BIFLO RecName: Full=Arginine repressor;
   17::157     6e-11  29%  170 aa  ARGR_BIFLD RecName: Full=Arginine repressor;
    6::127     1e-10  31%  148 aa  ARGR_CHLPB RecName: Full=Arginine repressor;
    1::143     2e-10  32%  148 aa  ARGR_PROVI RecName: Full=Arginine repressor;
    1::136     2e-10  32%  157 aa  ARGR_LACDB RecName: Full=Arginine repressor;
    1::136     2e-10  32%  157 aa  ARGR_LACDA RecName: Full=Arginine repressor;
    1::142     2e-10  30%  148 aa  ARGR_CHLT3 RecName: Full=Arginine repressor;
    1::127     4e-10  31%  148 aa  ARGR_PELPB RecName: Full=Arginine repressor;
    1::127     4e-10  32%  148 aa  ARGR_CHLL2 RecName: Full=Arginine repressor;
   17::164     5e-10  29%  166 aa  ARGR_MYCUA RecName: Full=Arginine repressor;
   17::164     5e-10  29%  166 aa  ARGR_MYCMM RecName: Full=Arginine repressor;
    9::146     9e-10  28%  151 aa  ARGR1_CLOPE RecName: Full=Arginine regulator;
    5::146     1e-09  28%  150 aa  ARGR_CLOBM RecName: Full=Arginine repressor;
    5::146     1e-09  28%  150 aa  ARGR_CLOBH RecName: Full=Arginine repressor;
    5::146     1e-09  28%  150 aa  ARGR_CLOB1 RecName: Full=Arginine repressor;
    1::136     1e-08  30%  145 aa  ARGR_STRMU RecName: Full=Arginine repressor;
   20::128     1e-08  36%  158 aa  ARGR_ANADF RecName: Full=Arginine repressor;
    6::127     1e-08  30%  148 aa  ARGR_PROA2 RecName: Full=Arginine repressor;
    9::150     2e-08  25%  157 aa  ARGR_DEIDV RecName: Full=Arginine repressor;
    5::146     9e-08  24%  149 aa  ARGR_ALKMQ RecName: Full=Arginine repressor;
   19::143     1e-07  28%  148 aa  ARGR_PELLD RecName: Full=Arginine repressor;
    1::141     3e-07  24%  157 aa  ARGR_BACFR RecName: Full=Arginine repressor;
    1::141     3e-07  24%  157 aa  ARGR_BACFN RecName: Full=Arginine repressor;
   22::126     3e-06  27%  160 aa  ARGR_ANASK RecName: Full=Arginine repressor;
   22::126     3e-06  27%  160 aa  ARGR_ANAD2 RecName: Full=Arginine repressor;
    1::123     4e-06  26%  147 aa  ARGR_CHLFF RecName: Full=Arginine repressor;
    1::141     8e-06  23%  147 aa  ARGR_CHLCV RecName: Full=Arginine repressor;
    1::123     2e-05  24%  147 aa  ARGR_CHLPN RecName: Full=Arginine repressor;
    4::150     2e-04  25%  157 aa  ARGR_COLP3 RecName: Full=Arginine repressor;
    1::149     6e-04  21%  156 aa  ARGR_SHELP RecName: Full=Arginine repressor;
    1::156

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MNKSEHRHQLIRALITKNKIHTQAELQALLAKNDIQVTQATLSRDIKNMNLSKVREEDSAYYVLNNGSIS
ARGR_STRSU      MNKIESRHQLILSLIMEKKIHTQQELQELLEVNGVSVTQSTLSRDIKMLNLVKVNEDDSSHYVINPIAPT
ARGR_STRGC      MNKIESRHRLIRSLIMEKKVHTQQELQELLEANGVIVTQSTLSRDMKALNLVKVTENNISYYVINSIAPS
ARGR_STRPZ      MNKKETRHQLIRSLISETTIHTQQELQERLQKNGITITQATLSRDMKELNLVKVTSGNDTHYEALAISQT
ARGR_STRP8      MNKKETRHQLIRSLISETTIHTQQELQERLQKNGITITQATLSRDMKELNLVKVTSGNDTHYEALAISQT
ARGR1_STRP6     MNKKETRHQLIRSLISETTIHTQQELQERLQKNGITITQATLSRDMKELNLVKVTSGNDTHYEALAISQT
ARGR1_STRP3     MNKKETRHQLIRSLISETTIHTQQELQERLQKNGITITQATLSRDMKELNLVKVTSGNDTHYEALAISQT
ARGR1_STRP1     MNKKETRHQLIRSLISETTIHTQQELQERLQKNGITITQATLSRDMKELNLVKVTSGNDTHYEALAISQT
ARGR_STAHJ      MAKKSVRHIKIREIISSEQIETQDELVKRLNEYDLNVTQATVSRDIKELQLIKVPAPSGQYYSLPNDRKY
ARGR_STAS1      MAKKSVRHIKIREIISNEKIETQDELVKRLNEYELNVTQATVSRDIKELQLIKVPTPAGQYYSLPNDRKY
ARGR_STAES      MPKKSVRHIKIREIISNEQIETQDELVKRLNEYDLNVTQATVSRDIKELQLIKVPAPTGQYYSLPNDRRY
ARGR_STAEQ      MPKKSVRHIKIREIISNEQIETQDELVKRLNEYDLNVTQATVSRDIKELQLIKVPAPTGQYYSLPNDRRY
ARGR_LISIN      MNKG-HRHIIIRELITSNEIDTQXXXXXXXXXXXXKVTQATVSRDIKELHLVKVPTQTGGYYSLPADNSF
ARGR_STACT      MAKKSVRHIKIREIISTEQVETQDELVRRLNQFDLNVTQATVSRDIKELQLIKVPAPTGQYYSLPNDRKY
ARGR_BACLD      MNKGQ-RHIKIREIITANEIETQDELVDILKKDGYNVTQATVSRDIKELHLVKVPTNNGSYYSLPADQRF
ARGR_LISW6      MNKG-HRHIIIRELITSNEIDTQXXXXXXXXXXXXKVTQATVSRDIKELHLVKVPTQTGGYYSLPADNSF
ARGR_LISMO      MNKG-HRHIIIRELITSNEIDTQXXXXXXXXXXXXKVTQATVSRDIKELHLVKVPTQTGGYYSLPADNSF
ARGR_LISMH      MNKG-HRHIIIRELITSNEIDTQXXXXXXXXXXXXKVTQATVSRDIKELHLVKVPTQTGGYYSLPADNSF
ARGR_LISMF      MNKG-HRHIIIRELITSNEIDTQXXXXXXXXXXXXKVTQATVSRDIKELHLVKVPTQTGGYYSLPADNSF
ARGR_LISMC      MNKG-HRHIIIRELITSNEIDTQXXXXXXXXXXXXKVTQATVSRDIKELHLVKVPTQTGGYYSLPADNSF
ARGR_BACSU      MNKGQ-RHIKIREIITSNEIETQDELVDMLKQDGYKVTQATVSRDIKELHLVKVPTNNGSYYSLPADQRF
ARGR2_BACCR     MNKGQ-RHIKIREIIANKEIETQDELVDILRNEGFNVTQATVSRDIKELHLVKVPLHDGRYYSLPADQRF
ARGR_STAAW      MPKKSVRHIKIREIISNEQIETQDELVKRLNDYDLNVTQATVSRDIKELQLIKVPIPSGQYYSLPNDRKF
ARGR_STAAS      MPKKSVRHIKIREIISNEQIETQDELVKRLNDYDLNVTQATVSRDIKELQLIKVPIPSGQYYSLPNDRKF
ARGR_STAAR      MPKKSVRHIKIREIISNEQIETQDELVKRLNDYDLNVTQATVSRDIKELQLIKVPIPSGQYYSLPNDRKF
ARGR_STAAN      MPKKSVRHIKIREIISNEQIETQDELVKRLNDYDLNVTQATVSRDIKELQLIKVPIPSGQYYSLPNDRKF
ARGR_STAAM      MPKKSVRHIKIREIISNEQIETQDELVKRLNDYDLNVTQATVSRDIKELQLIKVPIPSGQYYSLPNDRKF
ARGR_STAAE      MPKKSVRHIKIREIISNEQIETQDELVKRLNDYDLNVTQATVSRDIKELQLIKVPIPSGQYYSLPNDRKF
ARGR_STAAC      MPKKSVRHIKIREIISNEQIETQDELVKRLNDYDLNVTQATVSRDIKELQLIKVPIPSGQYYSLPNDRKF
ARGR_STAAB      MPKKSVRHIKIREIISNEQIETQDELVKRLNDYDLNVTQATVSRDIKELQLIKVPIPSGQYYSLPNDRKF
ARGR_STAA9      MPKKSVRHIKIREIISNEQIETQDELVKRLNDYDLNVTQATVSRDIKELQLIKVPIPSGQYYSLPNDRKF
ARGR_STAA8      MPKKSVRHIKIREIISNEQIETQDELVKRLNDYDLNVTQATVSRDIKELQLIKVPIPSGQYYSLPNDRKF
ARGR_STAA3      MPKKSVRHIKIREIISNEQIETQDELVKRLNDYDLNVTQATVSRDIKELQLIKVPIPSGQYYSLPNDRKF
ARGR_STAA2      MPKKSVRHIKIREIISNEQIETQDELVKRLNDYDLNVTQATVSRDIKELQLIKVPIPSGQYYSLPNDRKF
ARGR_STAA1      MPKKSVRHIKIREIISNEQIETQDELVKRLNDYDLNVTQATVSRDIKELQLIKVPIPSGQYYSLPNDRKF
ARGR_MACCJ      ----------IREIISNQHIETQEELVERLNEFNLNVTQATISRDIKELQLIKVPTKDGQYYSLPRDRKY
ARGR_GEOSW      MNKGQ-RHIKIREIIMSHDIETQDELVDMLKKAGFNVTQATVSRDIKEMQLVKVPMANGRYYSLPSDQRF
ARGR_BACCZ      MNKGQ-RHIKIREIIANKEIETQDELVDILRNEGFNVTQATVSRDIKELHLVKVPLHDGRYYSLPADQRF
ARGR_BACCQ      MNKGQ-RHIKIREIIANKEIETQDELVDILRNEGFNVTQATVSRDIKELHLVKVPLHDGRYYSLPADQRF
ARGR_BACC7      MNKGQ-RHIKIREIIANKEIETQDELVDILRNEGFNVTQATVSRDIKELHLVKVPLHDGRYYSLPADQRF
ARGR_BACC3      MNKGQ-RHIKIREIIANKEIETQDELVDILRNEGFNVTQATVSRDIKELHLVKVPLHDGRYYSLPADQRF
ARGR_BACAN      MNKGQ-RHIKIREIIANKEIETQDELVDILRNEGFNVTQATVSRDIKELHLVKVPLHDGRYYSLPADQRF
ARGR_BACAC      MNKGQ-RHIKIREIIANKEIETQDELVDILRNEGFNVTQATVSRDIKELHLVKVPLHDGRYYSLPADQRF
ARGR_BACAA      MNKGQ-RHIKIREIIANKEIETQDELVDILRNEGFNVTQATVSRDIKELHLVKVPLHDGRYYSLPADQRF
ARGR2_BACHK     MNKGQ-RHIKIREIIANKEIETQDELVDILRNEGFNVTQATVSRDIKELHLVKVPLHDGRYYSLPADQRF
ARGR2_BACC1     MNKGQ-RHIKIREIIANKEIETQDELVDILRNEGFNVTQATVSRDIKELHLVKVPLHDGRYYSLPADQRF
ARGR_BACWK      MNKGQ-RHIKIREIIANKEIETQDELVDILRNVGFNVTQATVSRDIKELHLVKVPLHDGRYYSLPADQRF
ARGR_BACA2      ------RHIKIRELITSHEIETQDDLVDMLREEGYKVTQATVSRDIKELHLVKVPTNNGSYYSLPADQRF
ARGR_OCEIH      ------RHIKIRELITENIIETQDELVDSLKALDFNVTQATVSRDIKELQLVKVPTTTGQYYSLPADQRF
ARGR_BACP2      ------RHIKIREIIASQEIETQDELVDILKADGYNITQATVSRDIKELHLVKVPTNNGTYYSLPADQRF
ARGR_BACST      MNKGQ-RHIKIREIIMSNDIETQDELVDRLREAGFNVTQATVSRDIKEMQLVKVPMANGRYYSLPSDQRF
ARGR_GEOKA      MNKGQ-RHIKIREIIMNHDIETQDELVDRLREAGFNVTQATVSRDIKEMQLVKVPMANGRYYSLPSDQRF
ARGR_GEOTN      MNKGQ-RHIKIREIIMNSDIETQDELVDRLKEAGFNVTQATVSRDIKEMQLVKVPMANGRYYSLPSDQRF
ARGR_CLOTH      ------RQAKILEIIDKEVIETQEEIADRLKKAGMEVTQATISRDIKELRLIKVMTEDGRYYAPFNSTDN
ARGR_BACHD      MNKGQ-RHIKIREIIANNDVETQDELVEQLKAAGYNVTQATVSRDIKELHLVKVPMMDGRYYSLPADQRF
ARGR_EXISA      MNKGQ-RLIKIRDIVTNREIETQDELVDELRRSGYPVTQATVSRDIKELHLVKVPLNDGRYYSLPADQRF
ARGR_DESHY      ------RQMKIQEIINNQVIHTQEELAELLRKAGFDVTQATVSRDIKEMGLIKVSEDDYRYAVPGTAQPL
ARGR_DESHD      ------RQMKIQEIINNQVIHTQEELAELLRKAGFDVTQATVSRDIKEMGLIKVSEDDYRYAVPGTAQPL
ARGR_CARHZ      ------RQKKILELVEQKVIRTQEELAEALKEAGFDVTQATVSRDIKELGLVKIPQKDSYRYALPQKTVS
ARGR_BACSK      MNKGQ-RHIKIREIITNYEIETQDDLVDRLKSDGYNVTQATVSRDIKELHLVKVPLQDGRYYSLPADQKF
ARGR_SYNWW      ------RQLCIIDIINQKEVATQEELCETLKNQGFDVTQATVSRDIKELKLIKVADKDGYHYALDTPGVK
ARGR1_BACHK     --KKEKRQRLIKQFVKEYEIEKQERLVELLAKKDVLVTQATVSRDIRELNLTKVSQEGLMIYKIFSEEHL
ARGR1_BACCR     --KKEKRQRLIKQFVKEYEIDKQERLVELLAKKDVLVTQATVSRDIRELNLTKVSQEGLMIYKVFSEEHL
ARGR1_BACC1     --KKEKRQRLIKQFVKEYEIEKQERLVELLAKKDVLVTQATVSRDIRELNVTKVSQEGLMIYKIFSEEHL
ARGR_EXIS2      ----------IREIITQSEIETQDELVEELRNAGYKVTQATVSRDIKELHLVKVPLNDGRYYSLPADQRF
ARGR_STRR6      --RKRDRHQLIKKMITEEKLSTQKEIQDRLEAHNVCVTQTTLSRDLREIGLTKVKKNDMVYYVLVNET--
ARGR_STRPN      --RKRDRHQLIKKMITEEKLSTQKEIQDRLEAHNVCVTQTTLSRDLREIGLTKVKKNDMVYYVLVNET--
ARGR_HALOH      ------RHLKILNIIKNEDISTQEELVERLHESGIDVTQATVSRDIKRLGLIKVPDGKGGYYSLPNGDII
ARGR_MOOTA      ------RQQLILKLIASTPIATQDQLARELRRRGLRVTQATVSRDIKELGLIKVPAGENLYYAAPPGQLI
ARGR_RENSM      ------RQARIAALLTAQSVRSQAELAALLADDGVQVTQATLSRDLVELGAVRVRADGGLVYAVPQAGVD
ARGR_ENTFA      --KKAERQRLIKQLIMQQEIETQDELITRLEEIGVRATQATVSRDIREMSIVKTHGADGKYAIFSQAQGT
ARGR2_LACPL     --KKQERQRYIKRLLSSNEIERQEDFVKLLRAEDIDVTQATISRDIKDMQLVKVPSATGGYYSMPVQKQM
ARGR_CLOTE      ------RHEKILELIERKDIETQEELAEELRKSGIEITQATVSRDIKELKLIKVLGEQGKYIVKNENDLS
ARGR_FINM2      --KKYTRQRLILDLIEENEIRTQEELSDYLEAHGVRATQATISRDIKELRISKVQTREGEYYAIIDTVHD
ARGR_BREBN      MNKGQ-RHIRIRDIISNQEVETQDDLVDRLRTAGFNVTQATVSRDIKELHLVKVPLPDGRYYSMPAEQKF
ARGR_ACIC5      MSKHE-RHNAIRELIAQRPIASQDELRRKLVRRGFDVTQATLSRDIHELRIYK----GPGGYALPNGNGH
ARGR_STRS7      MNKIE-RQQQIKQLIQAEHIGTQEEIRRLLQKDGIVVTQATLSRDLREIGLLKLRDDGKLYYSLSEPVAT
ARGR_LACLS      --KRDKRLEIIKEIVTNNKISTXXXXXXXXXXRGVEVTQATLSRDIRKLNIIKKRDKGESFYSFLTSGNS
ARGR_LACLA      --KRDKRLEIIKEIVTNNKISTXXXXXXXXXXRGVEVTQATLSRDIRKLNIIKKRDKGESFYSFLTSGNS
ARGR_CLONN      ------RHSKILEIINTKDVETQEELAEELKKRGVDVTQATVSRDIKELKLIKVLSENGRYYATIAKSDG
ARGR_CLOB8      ------RHTKILEIIGSREIETQEELADALKKEGFDVTQATVSRDIKNLKLIKMQSTNKSKYAVSTGEQK
ARGR_THEP3      ---------------------TQEELAAELQKQGIDVTQATVSRDIKELRLIKVLTEDKRYKYAPMGKVS
ARGR1_LACPL     MKKSE-RQAVIEQLISEYPIATQEELMAKLKAEGIAATQATISRDIREMQIVKTPDEGQTRYAIFKTTNK
ARGR_SYMTH      ------RQAKILELVRTRVIETQXXXXXXXXXXGIPVTQATISRDIKELQLTKVPMPDGRYYALXXXXXX
ARGR_LACLM      --KRDKRLEIIKEIVTNNKIXXXXXXXXXXXXRGVEVTQATLSRDIRKLNIIKKRDKGESFYSFLTSGNS
ARGR_THEPX      ---------------------TQEELAAELQKQGIDVTQATVSRDIKELRLIKVLTEDGKRYKYADGHIT
ARGR2_STRP6     MNKME-RQQQIKRIIQAEHIGTQEDIKNHLQKEGIVVTQATLSRDLREIGLLKLRDEQKLYYSLSEHVAT
ARGR2_STRP1     MNKME-RQQQIKRIIQAEHIGTQEDIKNHLQKEGIVVTQATLSRDLREIGLLKLRDEQKLYYSLSEPVAT
ARGR_CLOBL      ------RHAKILEIINSKDIDTQEELAEELKKMGMNVTQATVSRDIKELKLIKVLGNTGKYYATINHTES
ARGR_CLOBK      ------RHAKILEIINSKDIDTQEELAEELKKMGMNVTQATVSRDIKELKLIKVLGNTGKYYATINHTES
ARGR_CLOBJ      ------RHAKILEIINSKDIDTQEELAEELKKMGMNVTQATVSRDIKELKLIKVLGNTGKYYATINHTES
ARGR_CLOB6      ------RHAKILEIINSKDIDTQEELAEELKKMGMNVTQATVSRDIKELKLIKVLGNTGKYYATINHTES
ARGR_STRAW      ------RHRRIVDILNRQPVRSQSQLAKLLADDGLSVTQATLSRDLDELNAVKIRNNDGIYAVPSEGGFS
ARGR_ACIBL      ------RHAAIRDAITSHPVQNQDELRRLLFKRGHRVTQATLSRDIHELGLVKT-GEGYQFPSSEDDSNA
ARGR2_STRP3     MNKME-RQQQIKRIIQAEHIGTQEDIKNHLQKEGIVVTQATLSRDLRAIGLLKLRDEQKLYYSLSEPVAT
ARGR_CORGL      ------RQALILQILDKQKVTSQVQLSELLLDEGIDITQATLSRDLDELGARKVRPDGGAYYAVGPDSIA
ARGR_CORGB      ------RQALILQILDKQKVTSQVQLSELLLDEGIDITQATLSRDLDELGARKVRPDGGAYYAVGPDSIA
ARGR_SOLUE      MTKSYRQGQILK-LIRGKRIGTQDELAQELKSQGIAATQVTLSRDIRDLRLVKTREGYKEMAEEEQGP--
ARGR_BACV8      MKSKNSRLDAIKIIISSKEVGSQEELLQELAKEGFRLTQATLSRDLKQLKVAKAASMNGNYYVLPNNTMY
ARGR_STRCO      ------RHRRIVDILNRQAVRSQSQLAKLLADDGLTVTQATLSRDLDELNAVKIRNTDGIYAVPSEGGFS
ARGR_THETN      ---------------------TQEELAAELQKRGIDVTQATVSRDIKELRLIKVLTEDGKRY--KYAPMT
ARGR_THESQ      ----KRRQELIRKIIHEKKISNQFQIVEELKKYGIKAVQPTVARDLKEIGAVKIMDESGNYYKLLDETID
ARGR_THEP1      ----KRRQELIRKIIHEKKISNQFQIVEELKKYGIKAVQPTVARDLKEIGAVKIMDESGNYYKLLDETID
ARGR_THEMA      ----KRRQELIRKIIHEKKISNQFQIVEELKKYGIKAVQPTVARDLKEIGAVKIMDESGNYYKLLDETID
ARGR_CLOK5      ------RHAKILEIINSNNIETQEELAEKLKNSGMNVTQATVSRDIKELKLIKVLSDNGRYYATISRTES
ARGR_CLOK1      ------RHAKILEIINSNNIETQEELAEKLKNSGMNVTQATVSRDIKELKLIKVLSDNGRYYATISRTES
ARGR_EUBE2      ------RHKKILEVIDRYEVGTQEELAKILNDEGYNVTQATVSRDIRELNLSKVSVDGTRYATLTKDKPV
ARGR_DESRM      ------RQAKILELVRERTIETQEELAAALRAEGFEVTQATVSRDIKELSLIKIPGENNTSYYASPG---
ARGR_DESAP      ------RQRKIIEIIHRQVIATQAELAQVLRKAGFAVTQATVSRDVKELGLLKASDGQTVRYLPGEQPVA
ARGR_CLOAB      ------RHTKILEIINLKDIETQEELAEELRRSGMEVTQATVSRDIKELKLIKVLSSKGRYYATISPTES
ARGR_PELTS      ------RQRKILELIKAGLVKTQEDMVNALKECGFNVTQATVSRDIKELGLIKIPGGNNAFYALGDRPFI
ARGR_STRCL      ------RHRRIVDILNRQPVRSQSQLAKLLADNGLSVTQATLSRDLDELGAVKIRNTMAIYAVPARGGES
ARGR_CHLCH      MNK-QARHFKIREILQRHSVENQHDLLQLLREQGMSVAQATLSRDCAELGLMRVRVNGSYRMVVNAGRII
ARGR_STRGG      ------RHRRIVDILNRQPVRSQSQLAKLLADDGLSVTQATLSRDLDELGAVKIRNTELIYAVPSEGGFS
ARGR_MYCA1      ------RQARIVAILSSAQVRSQSELAALLADEGIEVTQATLSRDLEELGAVKLRGADGVYMVPEDGSVS
ARGR_DEIRA      ----DQRQKRIQDIILRESVSTQAELVKLLAKEGVQVTQATVSRDINELRLVRVGKGRHRYALAQYGGDS
ARGR_MYCPA      ----------IVAILSSAQVRSQSELAALLADEGIEVTQATLSRDLEELGAVKLRGADGVYMVPEDGSVS
ARGR_CLOCE      -----------------------------LKQQGMDVTQATVSRDIKELRLIKVMTPEGYYYSAFAQSEK
ARGR_CLOBA      ---------------------TQEDLAEELKLQGFDVTQATVSRDIKNLKLIKIQGASGNYYVVSSGEEK
ARGR_BACTN      MKKKANRLDAIKMIISSKEVGSQEELLQELNREGFELTQATLSRDLKQLKVAKAASMNGKYYVLPNNIMY
ARGR_CORDI      ------RQALILDLLEQNQVSSQMQLSELLKQRGVDITQGTLSRDLDELGAKKIRPNGGAFYAVGSSTTA
ARGR_CORA7      ------RQAKILEILDRTRVTSQVQLSELLLDEGIDITQATLSRDLDELGAKKVKRDGGRSFYVVGGELE
ARGR_CHLP8      MNKAL-RQKKIRELVENNDVSGQQELLGMLEKEGFSVAQPTLSRDFAEMGIVRNRTADGGY------RLS
ARGR_BIFAA      -----------QALLTRI-VTSQSQLSQILADQGIEVTQATLSRDLDEIHATKTRLADGTVYAVGKQNIA
ARGR_COREF      ------RQALIVQILNRQRVTSQVQLSELLLDEGIDITQATLSRDLDELGARKVRDRGRAFYAIGGEDLR
ARGR_CHLTE      MNKAS-RQKKIRELIENHEVSGQQELLGMLEKEGIVVAQATLSRDFAEMGVVRNRTSDGGYRL-------
ARGR_ALKOO      ------RHSKILELIDKNEIETQEELSERLKDMGFTVTQATVSRDIKELRLIKVLTKNGKYYATLQSQEN
ARGR_MYCTU      ------RQARIVAILSSAQVRSQNEXXXXXXXEGIEVTQATLSRDLEELGAVKLRGADGGYVVPEDGSVS
ARGR_MYCTA      ------RQARIVAILSSAQVRSQNEXXXXXXXEGIEVTQATLSRDLEELGAVKLRGADGGYVVPEDGSVS
ARGR_MYCBT      ------RQARIVAILSSAQVRSQNEXXXXXXXEGIEVTQATLSRDLEELGAVKLRGADGGYVVPEDGSVS
ARGR_MYCBP      ------RQARIVAILSSAQVRSQNEXXXXXXXEGIEVTQATLSRDLEELGAVKLRGADGGYVVPEDGSVS
ARGR_MYCBO      ------RQARIVAILSSAQVRSQNEXXXXXXXEGIEVTQATLSRDLEELGAVKLRGADGGYVVPEDGSVS
ARGR_CLOPH      ------RQSKIVELISKHNIETQEELADLLVKAGYRVTQATISRDIRELKLTKVATDNQKYIVLTNQESG
ARGR_ANATD      --KSE-RQQKILEIIQNEDIETQEELVERLKALGYDVTQATVSRDIKELRLTKVLTETGKYYAVLSGPEA
ARGR_CALS8      --KSE-RQQKILEIIQSEDIETQEELVEKLRELGYDVTQATVSRDIKELRLTKVLTETGKYYAVLSGPEA
ARGR2_CLOPE     ------RHSKIIEIIKSTAIETQEELAEELKKAGFDVTQATVSRDIKNLKLVKKQDNKGHYYTIIEEEKN
ARGR_PARD8      MSTKKERLDAICGIIQTKVISNQEELLKELEDSGFSVTQATLSRDIKQLKVAKVHDGNGDYYRLPEESIS
ARGR_THET8      -NKAE-RHRAIQEIVRREEIGTQKELVERLRQLGFEVTQATVSRDIAELGLARIALGKGRHYVLPAADLP
ARGR_THET2      -NKAE-RHRAIQEIVRREEIGTQKELVERLRQLGFEVTQATVSRDIAELGLARIALGKGRHYVLPAADLP
ARGR_MYCLE      ------RQARIVAILSSTSVRSQSELATLLADDGIDVTQATLSRDLEELGAVKLRGADGVYVVPEDGSVS
ARGR_MYCLB      ------RQARIVAILSSTSVRSQSELATLLADDGIDVTQATLSRDLEELGAVKLRGADGVYVVPEDGSVS
ARGR_CLOBB      ---------------------TQEDLAEELKLQGFDVTQATVSRDIKNLKLIKIQGASGNYYVVSSGEEK
ARGR_HELMI      ------RQRAILEIIGAEVVRTQEELAQRLRERGMEVTQATVSRDIKELGLIKVKDESRYXXXXXXXXXX
ARGR_CHLPD      MNK-QLRQLKVREILCQHDVGNQHDLMRLLNSAGIRVAQATLSRDCNEIGV--VRSRDSKGYRLNPGWII
ARGR_BIFLI      ------RLSAIEQALATHIITSQSQLSKILIDEGIAVTQATLSRDLDEMHAVKTRLKDTVAYTVGRSAVA
ARGR_NOCFA      ------RQSRIVELLSAHAVRSQSEXXXXXXXEGIETTQATLSRDLDELGAVKLRAADGGYVVPEDGSVT
ARGR_BIFLO      ------RLSAIEQALATHIITSQSQLSKILIDEGIAVTQATLSRDLDEMHAVKTRLKDTVAYTVGRSVVA
ARGR_BIFLD      ------RLSAIEQALATHIITSQSQLSKILIDEGIAVTQATLSRDLDEMHAVKTRLKDTVAYAVGRSVVA
ARGR_CHLPB      ------RHRKIKEILLSSTVTNQHELILLLEKRGIDVAQATLSRDCSELGVLRSRTASGYRLMIPEDNPG
ARGR_PROVI      MNKPA-RQLRIREIIQQEHVENQHDLLRLLKEKGVKVAQATLSRDCAELGI--IRSKTHAGYRLHSGRII
ARGR_LACDB      MNYKERR-QLIYELIQTNKIETQEXXXXXXXAHGANATQATISRDIRALHISKVPDDDGSYYVKAPSAAV
ARGR_LACDA      MNYKERR-QLIYELIQTNKIETQEXXXXXXXAHGANATQATISRDIRALHISKVPDDDGSYYVKAPSAAV
ARGR_CHLT3      MTKQE-RQLKIKELISGQTVSSQYELLSELKSVGIEITQATLSRDCAELGIVRMYSGDSYKLSIPASGEK
ARGR_PELPB      MNKYA-RQLKIREILHQNSVGNQHDLLQLLHDSGMRVAQATLSRDCAELGIIRSRTNGNFKMLLPDDDPD
ARGR_CHLL2      MNK-QVRQSKIREMLHLHEVGNQHDLIRLLEEAGIRVAQATLSRDCSELGIIRSKGLNGYRLALNPGNII
ARGR_MYCUA      ------RQARIVAILSTESVSSQSELAALLAVQGIEATQATLSRDLEELGAVKLRGADGVYVVPEDGSPX
ARGR_MYCMM      ------RQARIVAILSTESVSSQSELAALLAVQGIEATQATLSRDLEELGAVKLRGADGVYVVPEDGSPX
ARGR1_CLOPE     ------RHEVILDIIESKCICKQEELIIELKECGINVTQATLSRDLHEMNIIRKSFENHEHYIVTKEDXX
ARGR_CLOBM      ------RHAKILEIINSKDIDTQEELAEELKKMGMNVTQATVSRDIKELKLIKVLGNTGKYYATINHTES
ARGR_CLOBH      ------RHAKILEIINSKDIDTQEELAEELKKMGMNVTQATVSRDIKELKLIKVLGNTGKYYATINHTES
ARGR_CLOB1      ------RHAKILEIINSKDIDTQEELAEELKKMGMNVTQATVSRDIKELKLIKVLGNTGKYYATINHTES
ARGR_STRMU      MNKLSRQNK-IKQIIRSKHIGTXXXXXXXXXXXXVFVTQATLSRDMRELGLFKSRDKEGYLYIPENGS--
ARGR_ANADF      -------------------IGTQEELLEALRAGGIEATQATLSRDLAQLGARRVRPEGGTVYELPAGAAE
ARGR_PROA2      ------RQMKIKEILHNHDVGNQNDLIRLLDKAGIEVAQATLSRDCTELGIIRSRTHQGFRLVLPEDSPG
ARGR_DEIDV      ----EQRQKRIQDIIARESISTQGELVQRLRADNIQVTQATISRDINELRLVRIGKGRHRYALAQMTGHT
ARGR_ALKMQ      ------RHAKILEIIDTMXXXXXXXXXXXLRKIGFNVTQATVSRDIKELRLIKVLSKSGNYYATLRSQEN
ARGR_PELLD      -------------------VGNQHDLLRLLRESGIKVAQATLSRDCAELGIVRSKTHAGYRLLLGDESTG
ARGR_BACFR      MKKKANRLDAIKMIISSKXXXXXXXXXXXXXXXXXXXXXATLSRDLKQLKVAKAASMNGKYYVLPNDIMY
ARGR_BACFN      MKKKANRLDAIKMIISSKXXXXXXXXXXXXXXXXXXXXXATLSRDLKQLKVAKAASMNGRYYVLPNDIMY
ARGR_ANASK      ---------------------TQEELLAALERAGFRATQATLSRDLARLGARRVSGPEGAVYEXXXXXXX
ARGR_ANAD2      ---------------------TQEELLAALERAGFRATQATLSRDLARLGARRVSGPEGAVYEXXXXXXX
ARGR_CHLFF      MKKNVAVDEALKEILNKEGASTQEEICEKLSSLGIAMTQSSVSRWLRKVHAIKIPGEKGARYSLPT-SID
ARGR_CHLCV      MKKNVALDKALKEILNEEGASTQEEICEKLSSLGIATTQSSVSRWLKKVHAIKIPGDKGARYSLPPSIDD
ARGR_CHLPN      MKKKVTIDEALKEILRLEGAATQEELCAKLLAQGFATTQSSVSRWLRKIQAVKVAGERGARYSLPSSTEK
ARGR_COLP3      LQKQEALVQEFKDLLKQEQFGSQGEIDALKANGFDNISQSKISRMLSKFGAVRTRNQEMVYCLLGVPTAQ
ARGR_SHELP      MQANKNQDELVKAILKEERFGSQSEINALQSEGFNNINQSKVSRMLSKFGAVRTRKQEMVYCLPAELGVP


                         .         .         *         .         .         .         .:140
query           KWEKRLELYMEDALVWMRPVQHQVLLKTLPGLAQSFGSIIDTLSFPDAIATLCGNDVCLIICEDADTAQK
ARGR_STRSU      RWEKRLRLYMEDALVMLKPIQHQVVLKTLPGLANSFGSILDAMEIPQIVATVCGDDVCLIICEDVEGAQA
ARGR_STRGC      RWEKRLRFYMEDALIMLRPVQNQVVMKTLPGLAQSFGAILDALELPQIVATVCGDDVCLIICEDNPSAIE
ARGR_STRPZ      RWEHRLRFYMEDALVMLKIVQHQIILKTLPGLAQSFGSILDAMQIPEIVATVCGDDTCLIVCEDNEQAKA
ARGR_STRP8      RWEHRLRFYMEDALVMLKIVQHQIILKTLPGLAQSFGSILDAMQIPEIVATVCGDDTCLIVCEDNEQAKA
ARGR1_STRP6     RWEHRLRFYMEDALVMLKIVQHQIILKTLPGLAQSFGSILDAMQIPEIVATVCGDDTCLIVCEDNEQAKA
ARGR1_STRP3     RWEHRLRFYMEDALVMLKIVQHQIILKTLPGLAQSFGSILDAMQIPEIVATVCGDDTCLIVCEDNEQAKA
ARGR1_STRP1     RWEHRLRFYMEDALVMLKIVQHQIILKTLPGLAQSFGSILDAMQIPEIVATVCGDDTCLIVCEDNEQAKA
ARGR_STAHJ      HPLEKLGRYLMDSFVNIEGTGNLLVLKTLPGNAQSIGAILDQIDWDEVLGTICGDDTCLLICKDEDAS--
ARGR_STAS1      HPLEKLGRYLIDSFVNIDGTGNLLVLKTLPGNAQSIGAILDQIDWEDVLGTICGDDTCLIICRDDAASEK
ARGR_STAES      HPLEKLGRYLMDSFVNIEGTGNLLVLKTLPGNAQSIGAILDQIDWDEVLGTICGDDTCLLICRDEEASEE
ARGR_STAEQ      HPLEKLGRYLMDSFVNIEGTGNLLVLKTLPGNAQSIGAILDQIDWDEVLGTICGDDTCLLICRDEEASEE
ARGR_LISIN      NPHQKLKRALIDCFICIDTVQFMIILKVMPGNGNSVGALIDNLDWPEKAGTLCGDDTCLIICRSEENAK-
ARGR_STACT      HPLEKLGRYLMDSFVNIEGTGNLLVLKTLPGNAQSIGAILDQIDWEEVLGTICGDDTCLLICHDEESA--
ARGR_BACLD      NPLSKLKRSLMDAFVKIDSASHLIVLKTMPGNAQAIGALMDNLDWEEIMGTICGDDTILIICDDTKVVQK
ARGR_LISW6      NPHQKLKRALIDCFIGIDTVQFMIILKVMPGNGNSVGALIDNLDWPEKAGTICGDDTCLIICRSEENAK-
ARGR_LISMO      NPHQKLKRALIDCFIGIDNVQFMIILKVMPGNGNSVGALIDNLDWPEKAGTICGDDTCLIICRSEENAK-
ARGR_LISMH      NPHQKLKRALIDCFIGIDNVQFMIILKVMPGNGNSVGALIDNLDWPEKAGTICGDDTCLIICRSEENAK-
ARGR_LISMF      NPHQKLKRALIDCFIGIDNVQFMIILKVMPGNGNSVGALIDNLDWPEKAGTICGDDTCLIICRSEENAK-
ARGR_LISMC      NPHQKLKRALIDCFIGIDNVQFMIILKVMPGNGNSVGALIDNLDWPEKAGTICGDDTCLIICRSEENAK-
ARGR_BACSU      NPLSKLKRALMDAFVKIDSASHMIVLKTMPGNAQAIGALMDNLDWDEMMGTICGDDTILIICRTPEDTE-
ARGR2_BACCR     NPLQKLKRNLVDSFVKLDTAGHMLVLKTLPGNAHSLGALIDHLEWDEIIGTICGDDTCLIICRTPD----
ARGR_STAAW      HPLEKLGRYLMDSFVNIDGTDNLLVLKTLPGNAQSIGAILDQINWEEVLGTICGDDTCLIICRSKEASDE
ARGR_STAAS      HPLEKLGRYLMDSFVNIDGTDNLLVLKTLPGNAQSIGAILDQINWEEVLGTICGDDTCLIICRSKEASDE
ARGR_STAAR      HPLEKLGRYLMDSFVNIDGTDNLLVLKTLPGNAQSIGAILDQINWEEVLGTICGDDTCLIICRSKEASDE
ARGR_STAAN      HPLEKLGRYLMDSFVNIDGTDNLLVLKTLPGNAQSIGAILDQINWEEVLGTICGDDTCLIICRSKEASDE
ARGR_STAAM      HPLEKLGRYLMDSFVNIDGTDNLLVLKTLPGNAQSIGAILDQINWEEVLGTICGDDTCLIICRSKEASDE
ARGR_STAAE      HPLEKLGRYLMDSFVNIDGTDNLLVLKTLPGNAQSIGAILDQINWEEVLGTICGDDTCLIICRSKEASDE
ARGR_STAAC      HPLEKLGRYLMDSFVNIDGTDNLLVLKTLPGNAQSIGAILDQINWEEVLGTICGDDTCLIICRSKEASDE
ARGR_STAAB      HPLEKLGRYLMDSFVNIDGTDNLLVLKTLPGNAQSIGAILDQINWEEVLGTICGDDTCLIICRSKEASDE
ARGR_STAA9      HPLEKLGRYLMDSFVNIDGTDNLLVLKTLPGNAQSIGAILDQINWEEVLGTICGDDTCLIICRSKEASDE
ARGR_STAA8      HPLEKLGRYLMDSFVNIDGTDNLLVLKTLPGNAQSIGAILDQINWEEVLGTICGDDTCLIICRSKEASDE
ARGR_STAA3      HPLEKLGRYLMDSFVNIDGTDNLLVLKTLPGNAQSIGAILDQINWEEVLGTICGDDTCLIICRSKEASDE
ARGR_STAA2      HPLEKLGRYLMDSFVNIDGTDNLLVLKTLPGNAQSIGAILDQINWEEVLGTICGDDTCLIICRSKEASDE
ARGR_STAA1      HPLEKLGRYLMDSFVNIDGTDNLLVLKTLPGNAQSIGAILDQINWEEVLGTICGDDTCLIICRSKEASDE
ARGR_MACCJ      HPIDKLGRYLMDSFVKLDGTDNLLVLKTLPGNAQSIGAIIDQLEWDEVIGTICGDDTCLLICRDESAAAQ
ARGR_GEOSW      NPVQKLKRALMDVFIKLDGAGNLLVLKTLPGNAHAIGVLLDNLDWNEIVGTICGDDTCLIICRTAEDAEK
ARGR_BACCZ      NPLQKLKRNLVDSFVKLDTAGHMLVLKTLPGNAHSLGALIDHLEWDEIIGTICGDDTCLIIC--------
ARGR_BACCQ      NPLQKLKRNLVDSFVKLDTAGHMLVLKTLPGNAHSLGALIDHLEWDEIIGTICGDDTCLIIC--------
ARGR_BACC7      NPLQKLKRNLVDSFVKLDTAGHMLVLKTLPGNAHSLGALIDHLEWDEIIGTICGDDTCLIIC--------
ARGR_BACC3      NPLQKLKRNLVDSFVKLDTAGHMLVLKTLPGNAHSLGALIDHLEWDEIIGTICGDDTCLIIC--------
ARGR_BACAN      NPLQKLKRNLVDSFVKLDTAGHMLVLKTLPGNAHSLGALIDHLEWDEIIGTICGDDTCLIIC--------
ARGR_BACAC      NPLQKLKRNLVDSFVKLDTAGHMLVLKTLPGNAHSLGALIDHLEWDEIIGTICGDDTCLIIC--------
ARGR_BACAA      NPLQKLKRNLVDSFVKLDTAGHMLVLKTLPGNAHSLGALIDHLEWDEIIGTICGDDTCLIIC--------
ARGR2_BACHK     NPLQKLKRNLVDSFVKLDTAGHMLVLKTLPGNAHSLGALIDHLEWDEIIGTICGDDTCLIIC--------
ARGR2_BACC1     NPLQKLKRNLVDSFVKLDTAGHMLVLKTLPGNAHSLGALIDHLEWDEIIGTICGDDTCLIIC--------
ARGR_BACWK      NPLQKLKRNLVDSFVKLDTAGHMLVLKTLPGNAHSLGALIDHLEWDEIVGTICGDDTCLIIC--------
ARGR_BACA2      NPLSKLKRSLMDAFVKIDSASHMIVLKTMPGNAQAIGALMDNLEWEEIMGTICGDDTILIICEDTEGVQS
ARGR_OCEIH      NPLQKLKRLIVDTFVKIEHASHFIILHTLPGNAHAVGVLIDNLDWEEIMGTICGDDTCLIICRTPEQAE-
ARGR_BACP2      NPLSKLKRSLMDAFIKMDAASHLIVLKTMPGNAQAIGALMDNLDWEEIMGTICGDDTILIICRTPDDTE-
ARGR_BACST      NPLQKLKRALVDVFIKLDGTGNLLVLRTLPGNAHAIGVLLDNLDWDEIVGTICGDDTCLIICRTPKDAKK
ARGR_GEOKA      NPLQKLKRALVDVFVKLDGTGNLLVLRTLPGNAHAVGVLLDNLDWNEIVGTICGDDTCLIICRTPKDAEK
ARGR_GEOTN      NPLQKLKRALVDVFIKLDGTGNLLVLRTLPGNAHAIGVLLDNLDWGEIVGTICGDDTCLIICRTPKDAKK
ARGR_CLOTH      TVFNRLMTVFSKSYVSSDYANNIVVVKTLPGMAPAAASAIDSMNYPEIVGSIAGDDTVLIVCRSEKIAKE
ARGR_BACHD      NPLQKLKRGLVDSFVSIDRTDNLIVMKTLPGNAHAIGALIDNLDWTEIMGTICGDDTILIICKD------
ARGR_EXISA      NPYGKMKRILSDSFVSVDSAQNLVVMKVLPGNADAIGVLIDHLSWDELIGTVCGDDTILMIARDEEKAKQ
ARGR_DESHY      STPDRLKRRLRETVVTVNDSENLVVLRTIPGNAQALASLIDHSNWEEVIGTVAGDDTILLVVKPAGAVPS
ARGR_DESHD      STPDRLKRRLRETVVTVNDSENLVVLRTIPGNAQALASLIDHSNWEEVIGTVAGDDTILLVVKPAGAVPS
ARGR_CARHZ      AASERLKRLFADAVSSYDQSENLIVIKTLPGAAQGVASAIDQVAFPEILGTIAGDDTILIIARDREQVPK
ARGR_BACSK      NPQQKLKRILTDSFISIDRTGNLVVMKAMPGNANAIAVLIDNLDWNELMGTICGDDTILIIC--------
ARGR_SYNWW      GSFERMKRVIEDSVLGLDYSENLIIIKTLPGSAHAVASLIDSAEWPTIIGTVAGDDTILAVVKPKEAAPG
ARGR1_BACHK     QTDIXXXXXXXXXXXXIDCVEQLMVIKTLPGNAHVIGVLFDELDWKEKIGCICGNDTCLIISQSKSDREI
ARGR1_BACCR     QTDIXXXXXXXXXXXXIDCVDQLMVIKTLPGNAHVIGVLFDELDWKEKIGCICGNDTCLIISQ-------
ARGR1_BACC1     QTDIXXXXXXXXXXXXIDCVDQLMVIKTLPGNAHVIGVLFDELDWKEKIGCICGNDTCLIISQSKSDREI
ARGR_EXIS2      NPLGKLRRLLGDSFISIDSAQNLIVMHVLPGNANALGVLLDHLNWPELLGTVCGDDTILMITRNEEAATE
ARGR_STRR6      ---EKIDLFLSHHLEGVARAEFTLVLHTKLGEASVLANIVDVNKDEWILGTVAGANTLLVICRDQHVAK-
ARGR_STRPN      ---EKIDLFLSHHLEGVARAEFTLVLHTKLGEASVLANIVDVNKDEWILGTVAGANTLLVICRDQHVAK-
ARGR_HALOH      SWLKKM---FQDFVIDMDFSENIIVVQTMPGTAEGLGSAIDNAEIEGVIGTVAGDDTIMIVTKPIEKTPE
ARGR_MOOTA      NPYGRLQRLFADSVTKIDDSENLILIRTLPGTAHAVASCLDSLDWPEVIGTVAGDDTILVIVEAVATVLQ
ARGR_RENSM      RLDARMTRLCAELLVTAEASANLVVLRTPPGAANFLAMAIDHSVLPDILGTIAGDDTVLVIARDPFGGAA
ARGR_ENTFA      SSEEKLRESVKDSVVRMERVQFIVILHTEMGNADVVSNFLDEVAYPEVAGTVAGADTIIVITRSEEDAEH
ARGR2_LACPL     DTEKKLKRTLKDAYVSYATQDKFVLIKVLPGNGPALATLIEAMHYDEIFGTLGDDAHVLIICK-------
ARGR_CLOTE      ---DKLANIFSHSVVSVENINNFVVVKTLSGSGNAAAEAIDSLNFKEIAGTIAGDNTIFIM---ARTSEQ
ARGR_FINM2      SLNERLDKIFRSAVLTIKHNEDMVIIKTISHTATVCGMAITNAKLDNIAGILTGNDTIYITVEDKSGLEK
ARGR_BREBN      NPLQKLKRMLVDSFISIDQADHFIVLKTLSGHANAVAELIDNLPWEEIMGTISGDNTILIICRSKENTNE
ARGR_ACIC5      DEQDDLDEVMSSFGLKVKQAQNQLVLVTTAGSAQPVALAIDHEDWPEVVGTLAGDDTVLIICPDQKRATV
ARGR_STRS7      PFSPDVRFY----VLKVDRAGFMLVLHTNLGEADVLANLIDNDAIEDVLGTIAGADTLLVICRDEEIAKR
ARGR_LACLS      KINSDLQLYFYNFVISAKSVGALVVIRTKLGEADVLANALDDESRTDILGTIAGADTLLVICASEKAANI
ARGR_LACLA      KINSDLQLYFYNFVISAKSVGALVVIRTKLGEADVLANALDDESRTDILGTIAGADTLLVICASEKAANI
ARGR_CLONN      LLANKLVNVFSNTVISVENVQNFVVVKTLSGSGSAAAESIDSMNFDGIAGTIAGDNTIFILTINENKAEE
ARGR_CLOB8      NIIDRLSNILANTVLSVENVDKMVVIKTITGSAPITAEAIDNLESADIAGTVAGDNTIFILVRSLESAED
ARGR_THEP3      HITDRLMTLLSESIVSVDYAGNIIVIKTLSGTAPAAAEAIDTLNWKNIVGTLAGDNTIFVLVRNEEALQE
ARGR1_LACPL     NEQDRLFETLHDVVTSIDRVEFMNIIHTLPSNGNLLAAIIDDLNLPEVSGTLAGHDTIFVVSPNTTVAKQ
ARGR_SYMTH      XXXXRWRRIFREAVLTIDHSGNLVVIKSLPGTAQGVAAAIDHAGWPEMIGTVAGDDTVIVVVKPADATGE
ARGR_LACLM      KINSDLQLYFYNFVISAKSVGALVVIRTKLGEADVLANALDDESRTDILGTIAGADTLLVICASEKAANI
ARGR_THEPX      ---DRLMTLLSESIVSVDYAGNIIVIKTLSGTAPAAAEAIDTLNWKNIVGTLAGDNTIFVLVRNEEALQE
ARGR2_STRP6     PFSPEVRFY----VLKVDRAGFMLVLHTNLGEADVLANLIDNDAIEDILGTIAGADTLLVICRDEEIAKR
ARGR2_STRP1     PFSPEVRFY----VLKVDRAGFMLVLHTNLGEADVLANLIDNDAIEDILGTIAGADTLLVICRDEEIAKR
ARGR_CLOBL      YMSDKLINIFAQTVINVENIDKLIIIKTISGSAPAAAEAIDTLGFDGVAGTIAGDNTIFVMARTNEKAQE
ARGR_CLOBK      YMSDKLINIFAQTVINVENIDKLIIIKTISGSAPAAAEAIDTLGFDGVAGTIAGDNTIFVMARTNEKAQE
ARGR_CLOBJ      YMSDKLISIFAQTVISVENIDKLIIIKTISGSAPGAGEAIDTLGFDGIAGTIAGDNTIFAMTRTNEKAQE
ARGR_CLOB6      YMSDKLISIFAQTVISVENIDKLIIIKTISGSAPGAGEAIDTLGFDGIAGTIAGDNTIFAMTRTNEKAQE
ARGR_STRAW      AKEERMRRXXXXXXXXXXXXXXXVVLRTPPGAAQFLASAIDQAELHDILGTIAGDDTLLLISREPTGGQA
ARGR_ACIBL      AWLPSVERLIREFVYDVKIAQNTVVVKTSAGSAQPVAAALDAEGWPEVVGTVGGDDTIFVVTPSNKDAEK
ARGR2_STRP3     PFSPEVRFY----VLKVDRAGFMLVLHTNLGEADVLANLIDNDAIEDILGTIAGADTLLVICRDEEIAKR
ARGR_CORGL      REDEKLRRMLDELLVSTDHSGNIAMLRTPPGAAQYLASFIDRVGLKEVVGTIAGDDTVFVLARDPLTGKE
ARGR_CORGB      REDEKLRRMLDELLVSTDHSGNIAMLRTPPGAAQYLASFIDRVGLKEVVGTIAGDDTVFVLARDPLTGKE
ARGR_SOLUE      ----QFSLLAGEFLRDVLRAQNLVVLKTSPGHANSVAVALDNEEWPEVVGTIAGDDTILVIAPDTPTAEA
ARGR_BACV8      KQHSASEMLMHNGFISIEFSANLAVIKTRPGYASSLAYDIDNRNFDEILGTIAGDDTIMLVIREGCT---
ARGR_STRCO      AKEERMRRXXXXXXXXXXXXXXXVVLRTPPGAAQFLASAIDQAELHDILGTIAGDDTLMLISREPTGGQA
ARGR_THETN      KVDERLMTLLSESIVNVDYAGNIIVIKTLSGSASAAAEAIDTLNWKNIVGTIAGDNTIFVLVRNQEDIQE
ARGR_THESQ      PW-KELKRNFKSFVESIDRAGNLIVIKTIPGTASGIARVIDRLDIDEIVGTLAGDDTIFVAVRDPESCEK
ARGR_THEP1      PW-KELKRNFKSFVESIDRAGNLIVIKTIPGTASGIARVIDRLDIDEIVGTLAGDDTIFVAVRDPESCEK
ARGR_THEMA      PW-KELKRNFKSFVESIDRAGNLIVIKTIPGTASGIARVIDRLDIDEIVGTLAGDDTIFVAVRDPESCEK
ARGR_CLOK5      FLSNKLVNIFSQTVVSVENIDNFVVIKTIXXXXXXXXXXIDSLGFIGIAGTIAGDNTIFVMARDREKAHG
ARGR_CLOK1      FLSNKLVNIFSQTVVSVENIDNFVVIKTIXXXXXXXXXXIDSLGFIGIAGTIAGDNTIFVMARDREKAHG
ARGR_EUBE2      ASDKFLTV-LKEGFVSMDMAQNILVIKTAPGMAMAVCAAIDALEWNEIVGSIAGDDTIMCAVRTVNDTLL
ARGR_DESRM      --EPMIRRGGEDXXXXINSSENLIIIKTPPGEAQGMASAIDHVHWPQIIGTVAGDDTILVIVKPKEATPE
ARGR_DESAP      AAEERMVRLFRDYVWEVNANESLVIVKTLPGAAQGVASALDYARWPEILGTVAGDDTIFV----------
ARGR_CLOAB      FLSNKLVTIFAQTVLNVDRVNNMVVVKTISGSANAAAEAIDSLNLDGIAGSIAGDNTIFILSRSEETAFN
ARGR_PELTS      RGEERLRRVFRDSVIGLDSSENLIIVKTHPGGAQGVASAIDQAGWREIIGTVGGDDTILVVVKPAGAVLK
ARGR_STRCL      AKEERMRRLAGELLISAEASANLVVLRTPPGAAQFLASAIDQAELHDILGTIAGDDTLMLISRSPTGGQA
ARGR_CHLCH      KGLVGIEVLSINA------NETTVIIRTLPGRAHGVGSYLDQLKSPLVLGTIAGDDTVLVI---------
ARGR_STRGG      AKEERMRRXXXXXXXXXXXXXXXVVLRTPPGAAQFLASAIDQAELHDILGTIAGDDTLMLISRDPSGGQA
ARGR_MYCA1      GGTAXXXXXXXXXXVSADASANLAVLRTPPGAADYLASAIDRAALPYVVGTIAGDDTVFVAARDPMTGAE
ARGR_DEIRA      DIEEQLARLFQSFVQDVDRGENILVIRTADGHASGVALLLDRWKRDDIVGTLAGEDTIMVVARSTHDGES
ARGR_MYCPA      GGTAXXXXXXXXXXVSADASANLAVLRTPPGAADYLASAIDRAALPYVVGTIAGDDTVFVAARDPMTGAE
ARGR_CLOCE      QVSNRLITILTEAYVSSDYANNIVVVKTLSGMAQAAGSAIDSLKWNEILGTIAGDDTLIMVCRAEKIAED
ARGR_CLOBA      NIIDRLSNILSNTVISAENVDKMVVIKTLSGSGSAAAEAIDNLEGADVAGTVAGDNTIFILLRSLEKAEE
ARGR_BACTN      KRQSAGEMLRNNGFISLQFSGNIAVIRTRPGYASSMAYDIDNNEFSEILGTIAGDDTIMLVLREGVATSK
ARGR_CORDI      GTREKLRKMLDDLLVSVDHSGNIAVLRTPPAGAPFLASFIDRVGMDEVVGTIAGDDTVFVLARDPMTGKE
ARGR_CORA7      QFEDQLNRRMLDELVVSHDFSGNIMLRTPAGAAQYLASFIDRVGLPDVVGCIAGDDTIFVLAREGLGGRE
ARGR_CHLP8      VPEEPQEDILR-GLVGMEVLETSIIINTLPGRAHGVGSFLDRINSPEILGTIAGDDTVLVI---------
ARGR_BIFAA      KTEQQISRVLSGLVTSVAAARNLVVVHTPSGAAQYVASVIDKQPIEGVLGTIAGDDTVMVICSEDDVAKR
ARGR_COREF      GPQEKLRRMLDELLVSTDHSGNIAMLRTPPGAAQYLASFIDRVGLKEVVGTIAGDDTVFVLARE------
ARGR_CHLTE      AVPEEPQVDIIKGLVGMEVLETSIIIRTLPGRAHGVGSFLDRLTNDNILGTIAGDDTVLVI---------
ARGR_ALKOO      ILSDRVVKIFKNSVVSIDYAGNLIVIKTLTGSXXXXXXXXXXGDMNDVVGTIAGDDTIFIVIRDEKNVPS
ARGR_MYCTU      GGTDRMARLLGELLVSTDDSGNLAVLRTPPGAAHYLASAIDRAALPQVVGTIAGDDTILVVAREPTTGAQ
ARGR_MYCTA      GGTDRMARLLGELLVSTDDSGNLAVLRTPPGAAHYLASAIDRAALPQVVGTIAGDDTILVVAREPTTGAQ
ARGR_MYCBT      GGTDRMARLLGELLVSTDDSGNLAVLRTPPGAAHYLASAIDRAALPQVVGTIAGDDTILVVAREPTTGAQ
ARGR_MYCBP      GGTDRMARLLGELLVSTDDSGNLAVLRTPPGAAHYLASAIDRAALPQVVGTIAGDDTILVVAREPTTGAQ
ARGR_MYCBO      GGTDRMARLLGELLVSTDDSGNLAVLRTPPGAAHYLASAIDRAALPQVVGTIAGDDTILVVAREPTTGAQ
ARGR_CLOPH      MSEKYIRI-LRDGFVSMDMAQNIIIVKTVSGXXXXXXXXXXXXHIEGIVGCIAGDDTIMCAIRTVPDTIS
ARGR_ANATD      NITEKLIKVFSESIVKYDTADNLVXXXXXXXXXXXXXXXXDSLSWPEVVGTIAGDDTIFIATKGSAAADK
ARGR_CALS8      NITEKLIKVFSESIIKYDTADNLVXXXXXXXXXXXXXXXXDSLNWPEVIGTIAGDDTIFIATKGNAAAEK
ARGR2_CLOPE     EMVDRLSNILANTVTSVENVDKMVVVKTIXXXXXXXXXXIDTLHLGEIAGTIAGGNTIFILVRSLEKAE-
ARGR_PARD8      KGKKKPNIEFSGNL---------AVVKTRPGYAMGIASDIDSHAPSEILATIAGDDTILVIPRNGVSQEK
ARGR_THET8      --ENAYEELKRQFGLFVRDVDNLLVVKTAEGHASGIAYLLDRLRRDEIVGTLAGDDTILVVARTEEAAQA
ARGR_THET2      --ENAYEELKRQFGLFVRDVDNLLVVKTAEGHASGIAYLLDRLRRDEIVGTLAGDDTILVVARTEEAAQA
ARGR_MYCLE      GGTAXXXXXXXXXXVSADSSANLAVLRTPPGAADYLASAIDRAALPYVVGTIAGDDTVFVAAREPMTGSE
ARGR_MYCLB      GGTAXXXXXXXXXXVSADSSANLAVLRTPPGAADYLASAIDRAALPYVVGTIAGDDTVFVAAREPMTGSE
ARGR_CLOBB      NIIDRLSNILSNTVISAENVDKMVVIKTIXXXXXXXXEAIDNLEGSDVAGTVAGDNTIFILLRSLEKAEE
ARGR_HELMI      XXXDXXXXXXXDTVTHVDSSLNIVVIRTLPGHAHAVAGAIDHSHWPEVLGTVAGDDTIFIVVKPVEAVEA
ARGR_CHLPD      KGLVGVEVLS------VKANETSIIIRTLPGRAHGVGSFLDELKSPMILGTIAGDDTVLVI---------
ARGR_BIFLI      RGEAQMSRVLNGLVTSVAAAGNLVVVHTPSGAAQYVASVIDRQPIEGVLGTIAGDDTVMVICTNDDTA--
ARGR_NOCFA      GGTDRLSKLLGDLLVSTDASGNIAVLRTPPGAAGYLASALDRAALPYVVGTIAGDDTIAVIAREPLTGAE
ARGR_BIFLO      RGEAQMSRVLNGLVTSVAAAGNLVVVHTPSGAAQYVASVIDKQPIEGVLGTIAGDDTVMVICTNDDTA--
ARGR_BIFLD      RGEAQMSRVLNGLVTSVAAAGNLVVVHTPSGAAQYVASVIDKQPIEGVLGTIAGDDTVMVICTNDDTA--
ARGR_CHLPB      QMIKGL---VXXXXXXXXXXXXXXXXKTLPGRAHGVGSFIDHLKNPGILGTIAGDDTVLVI---------
ARGR_PROVI      KGLVGMEV------VSVAANETSVIVRTLPGRAHGVGSWLDQFHSPLILGTIAGDDTVLVIPDSVENISA
ARGR_LACDB      NRERQLKDAIRERXXXXXXXXXXXXXXXSMKLAPILAGLIDDIDNDDVVGTIAGTDTLLVILKD------
ARGR_LACDA      NRERQLKDAIRERXXXXXXXXXXXXXXXSMKLAPILAGLIDDIDNDDVVGTIAGTDTLLVILKD------
ARGR_CHLT3      NVIKNL---IGVEILSIQANEIFVIIKTLPGRASGVASFIDSFENPMIIGTLAGDDTVMVIPKTIKETKK
ARGR_PELPB      KIIKGL---VGVEVLSVNANETSIIIMTLPGRAHGVGSWLDQLKSPLILGTIAGDDTVLVI---------
ARGR_CHLL2      KGLVEVEVLS------IQSNEAVIIIKTLPGRAHGVGSFLDQLKNSQILGTIAGDDTVLVI---------
ARGR_MYCUA      XXXXXXXXXXXXXXXXXXXSSNLAVLRTPPGGAHYLASAIDRAALPYVVGTIAGDDTVFVAAREPMTGAE
ARGR_MYCMM      XXXXXXXXXXXXXXXXXXXSSNLAVLRTPPGGAHYLASAIDRAALPYVVGTIAGDDTVFVAAREPMTGAE
ARGR1_CLOPE     XXXXXXXXXSSVRSISMQ--EYFISVNTLDGMASLIGEFIDRLGDGRIAGTVAKKNHILVLCRSVNATQQ
ARGR_CLOBM      YMSDKLINIFAQTVINVENIDKLXXXXXXXXXXXXXXXXXDTLGFDGVAGTIAGDNTIFVMARTNEKAQE
ARGR_CLOBH      YMSDKLINIFAQTVINVENIDKLXXXXXXXXXXXXXXXXXDTLGFDGVAGTIAGDNTIFVMARTNEKAQE
ARGR_CLOB1      YMSDKLINIFAQTVINVENIDKLXXXXXXXXXXXXXXXXXDTLGFDGVAGTIAGDNTIFVMARTNEKAQE
ARGR_STRMU      ------TIFTPAALYYIKKVDALLVFHTNLGEADVLANLIDSESHSEILGTVAGADTLLVICKNEEIASQ
ARGR_ANADF      R----------DGLATLRGLVSEVVIRTHPGSAPAIARAIDLAGLPDVLGTIAGDDTIFV----------
ARGR_PROA2      QIIRGL-VGMEVQSISSN--ETAIVIKTLPGRAHGVASFLDQLKDIAILGTIAGDDTVLVI---------
ARGR_DEIDV      DVEEELGRLFQNFVHDVDRGENMLVIRTADGHATGVAXXXXXXXXXXIVGTLAGEDTIFVVARTTLEAES
ARGR_ALKMQ      VLSDRLVRLFKDSILSIEYAGNIMVMKTLXXXXXXXXXXXXXVDLKGVMGTIAGDDTIFVVVRDQDQMQE
ARGR_PELLD      RIIKGL-VGMEVTSVAAN--ETSVIVRTLPGRAHGVGSWLDQFKSQLILGTIAGDDTVLVIPDSVQNISV
ARGR_BACFR      KRQSASEMLMNNGFISLQFSGNIAVIKTRPGYASSMAYDIDNRESDTILGTIAGDDTIMLVLREGAT---
ARGR_BACFN      KRQSASEMLMNNGFISLQFSGNIAVIKTRPGYASSMAYDIDNRESDTILGTIAGDDTIMLVLREGAT---
ARGR_ANASK      XXXXXXXXXVSS----IAANASMVVIRTHPGSAPAIARAIDLAQPPEVLGTIAGDDTIFV----------
ARGR_ANAD2      XXXXXXXXXVSS----IAANASMVVIRTHPGSAPAIARAIDLAQPPEVLGTIAGDDTIFV----------
ARGR_CHLFF      ------ESSVKGLVFSVRYNSSLIVIRTAPGSASWIASLIDNKFSESILGTLAGDDTIFV----------
ARGR_CHLCV      SSIKHL-------VFSIRHNSSLIVIRTAPGSASWIASLIDNKFAESILGTLAGDDTIFITPITESTISL
ARGR_CHLPN      TTTRHLVLSI-------RHNASLIVIRTVPGSASWIAALLDQGLKDEILGTLAGDDTIFV----------
ARGR_COLP3      SPLKQLVLEIEHNEV-------MIIIQTSPGAAQLIARLLDSLSKSDGVGTIAGDDTIFIAPSDVSKINE
ARGR_SHELP      TAGSPLKNLVLD----VDHNQSMIVVRTSPGAAQLIARLLDSIGKPEGIGTIAGDDTIFICPSNIQEVDK


                         +         .         .         .         .         *         .:210
query           CFEELKKFAPPFFFEE
ARGR_STRSU      CFEHLKQFTPPFFFSK
ARGR_STRGC      CFDKLKEFAPPFFFSK
ARGR_STRPZ      CYETLSHYTPPFFF--
ARGR_STRP8      CYETLSHYTPPFFF--
ARGR1_STRP6     CYETLSHYTPPFFF--
ARGR1_STRP3     CYETLSHYTPPFFF--
ARGR1_STRP1     CYETLSHYTPPFFF--
ARGR_STAHJ      ----------------
ARGR_STAS1      ----------------
ARGR_STAES      ----------------
ARGR_STAEQ      ----------------
ARGR_LISIN      ----------------
ARGR_STACT      ----------------
ARGR_BACLD      KILEL-----------
ARGR_LISW6      ----------------
ARGR_LISMO      ----------------
ARGR_LISMH      ----------------
ARGR_LISMF      ----------------
ARGR_LISMC      ----------------
ARGR_BACSU      ----------------
ARGR2_BACCR     ----------------
ARGR_STAAW      ----------------
ARGR_STAAS      ----------------
ARGR_STAAR      ----------------
ARGR_STAAN      ----------------
ARGR_STAAM      ----------------
ARGR_STAAE      ----------------
ARGR_STAAC      ----------------
ARGR_STAAB      ----------------
ARGR_STAA9      ----------------
ARGR_STAA8      ----------------
ARGR_STAA3      ----------------
ARGR_STAA2      ----------------
ARGR_STAA1      ----------------
ARGR_MACCJ      VTERI-----------
ARGR_GEOSW      VSKQL-----------
ARGR_BACCZ      ----------------
ARGR_BACCQ      ----------------
ARGR_BACC7      ----------------
ARGR_BACC3      ----------------
ARGR_BACAN      ----------------
ARGR_BACAC      ----------------
ARGR_BACAA      ----------------
ARGR2_BACHK     ----------------
ARGR2_BACC1     ----------------
ARGR_BACWK      ----------------
ARGR_BACA2      RLLEL-----------
ARGR_OCEIH      ----------------
ARGR_BACP2      ----------------
ARGR_BACST      VSNQL-----------
ARGR_GEOKA      VSDQL-----------
ARGR_GEOTN      VSNQL-----------
ARGR_CLOTH      FVEKLSKLA-------
ARGR_BACHD      ----------------
ARGR_EXISA      IIDRL-----------
ARGR_DESHY      VRERIAK---------
ARGR_DESHD      VRERIAK---------
ARGR_CARHZ      ILARFDEF--------
ARGR_BACSK      ----------------
ARGR_SYNWW      IVEEFEQ---------
ARGR1_BACHK     LEERL-----------
ARGR1_BACCR     ----------------
ARGR1_BACC1     LEERL-----------
ARGR_EXIS2      VTERI-----------
ARGR_STRR6      ----------------
ARGR_STRPN      ----------------
ARGR_HALOH      IFNKLQ----------
ARGR_MOOTA      RFREL-----------
ARGR_RENSM      IAERFLQFA-------
ARGR_ENTFA      FIERIE----------
ARGR2_LACPL     ----------------
ARGR_CLOTE      AFEIVKK---------
ARGR_FINM2      LVSEIK----------
ARGR_BREBN      VTKRL-----------
ARGR_ACIC5      LAERLEK---------
ARGR_STRS7      FEKDL-----------
ARGR_LACLS      LTAEIK----------
ARGR_LACLA      LTAEIK----------
ARGR_CLONN      IVKKLKK---------
ARGR_CLOB8      LVDKIRK---------
ARGR_THEP3      LLEKFKK---------
ARGR1_LACPL     LYE-------------
ARGR_SYMTH      VAERLK----------
ARGR_LACLM      LTAEIK----------
ARGR_THEPX      LLEKFKK---------
ARGR2_STRP6     FEKDL-----------
ARGR2_STRP1     FEKDL-----------
ARGR_CLOBL      ITMKLKK---------
ARGR_CLOBK      ITMKLKK---------
ARGR_CLOBJ      ITLKLKK---------
ARGR_CLOB6      ITLKLKK---------
ARGR_STRAW      LADHLLRLA-------
ARGR_ACIBL      LQSRIKE---------
ARGR2_STRP3     FEKDL-----------
ARGR_CORGL      LGELL-----------
ARGR_CORGB      LGELL-----------
ARGR_SOLUE      VQEKL-----------
ARGR_BACV8      ----------------
ARGR_STRCO      LADHLLRLA-------
ARGR_THETN      LVEKFRK---------
ARGR_THESQ      IVEKL-----------
ARGR_THEP1      IVEKL-----------
ARGR_THEMA      IVEKL-----------
ARGR_CLOK5      ITQKMKK---------
ARGR_CLOK1      ITQKMKK---------
ARGR_EUBE2      VMNKIKK---------
ARGR_DESRM      VVQRFLELA-------
ARGR_DESAP      ----------------
ARGR_CLOAB      IVQKLKK---------
ARGR_PELTS      RFEEL-----------
ARGR_STRCL      LADHLLRLA-------
ARGR_CHLCH      ----------------
ARGR_STRGG      LADHLLRLA-------
ARGR_MYCA1      LADTLEK---------
ARGR_DEIRA      LMEE------------
ARGR_MYCPA      LADTLEK---------
ARGR_CLOCE      IVNKFNK---------
ARGR_CLOBA      LVAKIRK---------
ARGR_BACTN      VRQLLSLIIP------
ARGR_CORDI      LGEFLSQ---------
ARGR_CORA7      LAEKL-----------
ARGR_CHLP8      ----------------
ARGR_BIFAA      ----------------
ARGR_COREF      ----------------
ARGR_CHLTE      ----------------
ARGR_ALKOO      TIEHFRK---------
ARGR_MYCTU      MFENLR----------
ARGR_MYCTA      MFENLR----------
ARGR_MYCBT      MFENLR----------
ARGR_MYCBP      MFENLR----------
ARGR_MYCBO      MFENLR----------
ARGR_CLOPH      VMEKLSK---------
ARGR_ANATD      IVERIK----------
ARGR_CALS8      IVERIK----------
ARGR2_CLOPE     ----------------
ARGR_PARD8      VIAALSHF--------
ARGR_THET8      LEDE------------
ARGR_THET2      LEDE------------
ARGR_MYCLE      ----------------
ARGR_MYCLB      ----------------
ARGR_CLOBB      LVAKIRK---------
ARGR_HELMI      LMDKVRRW--------
ARGR_CHLPD      ----------------
ARGR_BIFLI      ----------------
ARGR_NOCFA      LAAKIEELA-------
ARGR_BIFLO      ----------------
ARGR_BIFLD      ----------------
ARGR_CHLPB      ----------------
ARGR_PROVI      LISYIHK---------
ARGR_LACDB      ----------------
ARGR_LACDA      ----------------
ARGR_CHLT3      VHQFIR----------
ARGR_PELPB      ----------------
ARGR_CHLL2      ----------------
ARGR_MYCUA      LAIALEK---------
ARGR_MYCMM      LAIALEK---------
ARGR1_CLOPE     IFKEL-----------
ARGR_CLOBM      ITMKLKK---------
ARGR_CLOBH      ITMKLKK---------
ARGR_CLOB1      ITMKLKK---------
ARGR_STRMU      ----------------
ARGR_ANADF      ----------------
ARGR_PROA2      ----------------
ARGR_DEIDV      LMEE------------
ARGR_ALKMQ      IEEKFRR---------
ARGR_PELLD      LMSYIQK---------
ARGR_BACFR      ----------------
ARGR_BACFN      ----------------
ARGR_ANASK      ----------------
ARGR_ANAD2      ----------------
ARGR_CHLFF      ----------------
ARGR_CHLCV      TAKDIENF--------
ARGR_CHLPN      ----------------
ARGR_COLP3      TIKKLEQ---------
ARGR_SHELP      TLETVK----------