[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for spne4:ACF54875.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1didA.bssp"
#ERROR : Can't open dsspfile "1dxiA.bssp"
#ERROR : Can't open dsspfile "2bzuA.bssp"
#ERROR : Can't open dsspfile "2aaaA.bssp"
#ERROR : Can't open dsspfile "3a21A.bssp"
#ERROR : Can't open dsspfile "3c0uA.bssp"
#ERROR : Can't open dsspfile "1a0cA.bssp"
#ERROR : Can't open dsspfile "1bplB.bssp"
#ERROR : Can't open dsspfile "2bhuA.bssp"
#ERROR : Can't open dsspfile "3cc1B.bssp"
#ERROR : Can't open dsspfile "3a5vA.bssp"
#ERROR : Can't open dsspfile "3cc1A.bssp"
#ERROR : Can't open dsspfile "1ea9C.bssp"
#ERROR : Can't open dsspfile "3dhuB.bssp"
#ERROR : Can't open dsspfile "1al0G.bssp"
#ERROR : Can't open dsspfile "2e8yA.bssp"
#ERROR : Can't open dsspfile "3dhuA.bssp"
#ERROR : Can't open dsspfile "1ehaA.bssp"

## Summary of PDB Search
:738
    2e-28  13%  1didA  [c.1.15] D-XYLOSE ISOMERASE
    3e-16  13%  1dxiA  [c.1.15] D-XYLOSE ISOMERASE
    9e-15  14%  2bzuA  [x.x.x] FIBER PROTEIN 2
    7e-14  10%  2aaaA  [x.x.x] ALPHA-AMYLASE
    1e-13  14%  3a21A  [x.x.x] PUTATIVE SECRETED ALPHA-GALACTOSIDASE
    2e-12  10%  3c0uA  [x.x.x] UNCHARACTERIZED PROTEIN YAEQ
    6e-12  12%  1a0cA  [c.1.15] XYLOSE ISOMERASE
    7e-12   8%  1bplB  [c.1.8 - b.71.1] ALPHA-1,4-GLUCAN-4-GLUCANOHYDROLASE
    1e-11  12%  2bhuA  [x.x.x] MALTOOLIGOSYLTREHALOSE TREHALOHYDROLASE
    2e-10  21%  3cc1B  [x.x.x] PUTATIVE ALPHA-N-ACETYLGALACTOSAMINIDASE
    2e-10  11%  3a5vA  [x.x.x] ALPHA-GALACTOSIDASE
    2e-10  17%  3cc1A  [x.x.x] PUTATIVE ALPHA-N-ACETYLGALACTOSAMINIDASE
    6e-10  13%  1ea9C  [b.1.18 - c.1.8 - b.71.1] CYCLOMALTODEXTRINASE
    5e-08  13%  3dhuB  [x.x.x] ALPHA-AMYLASE
    1e-07   5%  1al0G  [b.121.5] SPIKE PROTEIN GPG
    2e-07  11%  2e8yA  [x.x.x] AMYX PROTEIN
    5e-07  12%  3dhuA  [x.x.x] ALPHA-AMYLASE
    3e-05  20%  1ehaA  [b.1.18 - c.1.8 - b.71.1] GLYCOSYLTREHALOSE TREHALOHYDROLASE
:738

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1didA           ----------------------------------------------------------------------
1dxiA           ----------------------------------------------------------------------
2bzuA           ----------------------------------------------------------------------
2aaaA           ----------------------------------------------------------------------
3a21A           ----------------------------------------------------------------------
3c0uA           ----------------------------------------------------------------------
1a0cA           ----------------------------------------------------------------------
1bplB           ----------------------------------------------------------------------
2bhuA           ----------------------------------------------------------------------
3cc1B           ----------------------------------------------------------------------
3a5vA           ----------------------------------------------------------------------
3cc1A           ----------------------------------------------------------------------
1ea9C           ----------------------------------------------------------------------
3dhuB           ----------------------------------------------------------------------
1al0G           ----------------------------------------------------------------------
2e8yA           ----------------------------------------------------------------------
3dhuA           ----------------------------------------------------------------------
1ehaA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1didA           ----------------------------------------------------------------------
1dxiA           ----------------------------------------------------------------------
2bzuA           ----------------------------------------------------------------------
2aaaA           ----------------------------------------------------------------------
3a21A           ----------------------------------------------------------------------
3c0uA           ----------------------------------------------------------------------
1a0cA           ----------------------------------------------------------------------
1bplB           ----------------------------------------------------------------------
2bhuA           ----------------------------------------------------------------------
3cc1B           ----------------------------------------------------------------------
3a5vA           ----------------------------------------------------------------------
3cc1A           ----------------------------------------------------------------------
1ea9C           ----------------------------------------------------------------------
3dhuB           ----------------------------------------------------------------------
1al0G           ----------------------------------------------------------------------
2e8yA           ----------------------------------------------------------------------
3dhuA           ----------------------------------------------------------------------
1ehaA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1didA           ----------------------------------------------------------------------
1dxiA           ----------------------------------------------------------------------
2bzuA           ----------------------------------------------------------------------
2aaaA           ----------------------------------------------------------------------
3a21A           ----------------------------------------------------------------------
3c0uA           ----------------------------------------------------------------------
1a0cA           ----------------------------------------------------------------------
1bplB           ----------------------------------------------------------------------
2bhuA           ----------------------------------------------------------------------
3cc1B           ----------------------------------------------------------------------
3a5vA           ----------------------------------------------------------------------
3cc1A           ----------------------------------------------------------------------
1ea9C           ----------------------------------------------------------------------
3dhuB           ----------------------------------------------------------------------
1al0G           ----------------------------------------------------------------------
2e8yA           ----------------------------------------------------------------------
3dhuA           ----------------------------------------------------------------------
1ehaA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxSSPQQNPFFMLSRRETTEHSGEVYGFNFIYSGNFQNMIEVDHFDTARVTVGINPVE
1didA           --------------------------------------TGADPFGVATRKNLDPVEAVHKLAELGAYGIT
1dxiA           ---------------------------------------------------------------VTFHDDD
2bzuA           ----------------------------------------------------------------------
2aaaA           ----------------------------------------------------------------------
3a21A           ----------------------------------------------------------------------
3c0uA           ----------------------------------------------------------------------
1a0cA           ----------------------------------------------------------------------
1bplB           ----------------------------------------------------------------------
2bhuA           --------------QHDPRTRLGATPLPGGAGWTSTARTVAVRVNGTEHVM-TSLGGGIYELELPVGPGA
3cc1B           ----------------------------------------------------------------------
3a5vA           ----------------------------------------------------------------------
3cc1A           ----------------------------------------------------------------------
1ea9C           ----------------------------------------------------------------------
3dhuB           ----------------------------------------------------------------------
1al0G           ----------------------------------------------------------------------
2e8yA           ----------------------------------------------------------------------
3dhuA           ----------------------------------------------------------------------
1ehaA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           FRFLLNPAESFVTPEAIVIYSDQGMNQMSQQLSDFYRHHLVNPNFSQASRPIILNSWETFYFDLGTEKIL
1didA           FHD--NDLIPFDATEAEREKILGDFNQALKDTGLKVPMVTTNLFSHPVFKDGGFTSNDRSIRRFALAKVL
1dxiA           LIFGSSDTERESHIKRFR----QALDATGMTVPMATTNLFTHPVF----KDGGFTANDRDVRRYALRKTI
2bzuA           ----------------------------------------------------------------------
2aaaA           ----------------------------------IYFLLTDRFGRTDNSTTATCNTGNEIYCGGSWQGII
3a21A           -------------------------------------------------APMGWASWNSFAAKIDYSVIK
3c0uA           ----------------------------------------------------------------------
1a0cA           -----------------------------------TKVLWGTANSNPRFVHGASTSCNADVFAYSAAQVK
1bplB           ----------------------------------------------------------------------
2bhuA           RYLFVLDGVPTPDPYAR--FLPDGVHGEAEVVDFGFDWTDADWHGIKLADCVFYEVHVGTFTPEGTRAAA
3cc1B           --------------------------------------------------PPGWNSWDCYGASVTEEEVL
3a5vA           -------------------------------------------------PQMGWNTWNKYGCNVDEQLIL
3cc1A           -------------------------------------------------TPPGWNSWDCYGASVTEEEVL
1ea9C           -------------------------------------------------------DPTPSCFFGGDQGVI
3dhuB           --------------------------------------------------------------------VT
1al0G           --------------------------------------------------------LQTPKATSSTLYFD
2e8yA           ----------------------------------------------------------------------
3dhuA           ----------------------------------------------------------------------
1ehaA           ----------------------------------------------------------TFTPEGTFEGVI


                         .         .         .         .         *         .         .:420
query           DLAKAAKDLGIELFVLDDGWFGHRKDDKSSLGDWVTDRSRLPEGIGFLADEIHKIGLQFGLWFEPEMISI
1didA           HNIDLAAEMGAETFVM---WGGREGSEYDGSKDLAAALDRMREGVDTAAGYIKDKGYNLRIALEPKPNEP
1dxiA           GNIDLAAELGAKTYVA---WGGREGAESGGAKDVRDALDRMKEAFDLLGEYVTAQGYDLRFAIEPKPNEP
2bzuA           --------------PTPNCSIYETQDANLFLCGAHVLGTITIKGLKGALREMHDNALSLKLPFDNQGNLL
2aaaA           DHLDYIEGMGFTAIWISPITEQLPQDTADGEAYHVNSNFGTADNLKSLSDALHARGMYLMVDVVPDHMGY
3a21A           KQVDAFVAAGLPAINIDEGWWQGTRDSA---GNITVDTAEWPGGMSAITAYIHSKGLKAGIYTDAGK---
3c0uA           -------------VNVADLDRNQ-------FLDASLTLARHPSE---TQERLRLLAW--LKYADERLQDD
1a0cA           KALEITKELGGENYVFWGGREGYETLLN---TDMEFELDNFARFLHMAVDYAKEIGFEGQFLIEPKPKEP
1bplB           ----------------------------------------------------------------------
2bhuA           EKLPYLKELGVTAIQVMPLAAF------DGQRGWGYDGAAFPEDLMALVDAAHRLGLGVFLDVVYNHFGP
3cc1B           GNAEYLKKYGWEYIVVDIQWYEPTANNPFAYGRLLPATNRFPAGFKPLSDAIHDLGLKFGIHIRGIPRQA
3a5vA           DAAKAIASSGLKDLGYNYVIIDDCWQKNESSKTLLADPTKFPRGIKPLVDDIHNLGLKAGIYSSAGTLTC
3cc1A           GNAEYLKKYGWEYIVVDIQWYEPTANSSDEYGRLLPATNRFPSAKNGLSDAIHDLGLKFGIHIRG---IP
1ea9C           DHLDHLSKLGVNAVYF-TPLFKATTNHKYDTEDYIDPQFGDKDTLKKLVDLCHERGIRVLLDAVFNHSGR
3dhuB           ADLQRIKDLGTDILWLGEVNRKGTLGSPYAIKDYINPEYGTLADFKALTDRAHELGMKVMLDIVYNHTSP
1al0G           SLTVAGNGGFLHCIQMDTSVNAAN-------QVVSVGADIAFDADPKFFACLVRFESSSVPTTLPTAYDV
2e8yA           -------------------NPLHFFAPEGSYASNPHDPQTRKTELKQMINTLHQHGLRVILDVVFNHVYK
3dhuA           ------KDLGTDILWLGEVNRKGTLGSPYAIKDYINPEYGTLADFKALTDRAHELGMKVMLDIVYNHTSP
1ehaA           RKLDYLKDLGITAIEIMPIAFPGKRDWGYDGVYLVQNSYGGPEGFRKLVDEAHKKGLGVILDVVYNHVGP


                         .         .         +         .         .         .         .:490
query           DSDLYKNHADWTIHLLDREKSVGRNQYVLDLTRQEVVDYLFDSISKIIIKTNLDYIKWDMNRHITDIYSI
1didA           RGDIFLPTVGHGLAFIEQLEHGDIVGLNPETGHEQMAGLNFTHG--------IAQALWAEKLFHIDLNGQ
1dxiA           RGDILLPTVGHALAFIERLERPELYGVNPEVGHEQMAGLFPHGIAQALWAGKLFHIDLNGQSGIK-----
2bzuA           NCALESSVASNALTFMPNSTVYPRNKTA------------------------------------------
2aaaA           AGNGNDVDYSVFDPFDSSSNLTMVEDCWEDTTETAVRTIWYDWVADLVSNYSVDGLRIDSVLEVQPDFFP
3a21A           ----DGCGYYY-------------PTGRPAAPGSGSEGHYDQDM-LQFSTWGFDFVKVDWCGGDAE----
3c0uA           EPEAWLRNDHLGIDLWIKACTQAAEVALFTYNSRAAQIWWQQNQSKCVQFANLSVWYLDDE---------
1a0cA           TKHQYDFDVANVLAFLRKYDLDKYFKVNIEANHATLAFHDFQHELRYARI-NGVLGSIDANTGDMLLG--
1bplB           -------------------------YADIDYDHPDVAAEIKRWGTWYANELQLDGFRLDAVKHIKFSFLR
2bhuA           SGNYLSSYAPSYFTDRFSSA----WGMGLDYAEPHMRRYVTGNARMWLRDYHFDGLRLDATPYMTDDSET
3cc1B           VYENSPVLGSTKTAREINSICPWNTDYGVDPTKEGAQSYYNSLFELYAQWGV-DFVKVDDIAAS------
3a5vA           GGHIASLGYED--------------------------IDAKTWAKWGIDYLKYDNCYNQGQSGTPKLSYD
3cc1A           RQAVYENSPVLGSTKTAREIAHTNTDYGVDPTKEGAQSYYNSLF-ELYAQWGVDFVKVDDIAASRLYDTH
1ea9C           TFPPFVDVLKNGEKSKYKDWFHIRLMPKLNTEHPDVKEYLLKAAEYWIRETGIDGWRLDVANEVSHQFWR
3dhuB           DSVLATEHPEWFYHDLTNKVGDWSDVKDLDYGHHELWQYQIDTLLYWS--QFVDGYRCDVAPLVPLDFWL
1al0G           YPLNGRHDGGYYTVKDCVT----IDVLPRTPGNNVYVGFMVSNFTATKCRGLVSLNQV------------
2e8yA           RENSPFEKTVPGYFFRHDECGKPSNGNDIASERRMARKFIADCVVYWLEEYNVDGFRFDLLGILDIDTVL
3dhuA           DSVLATEHPEWFYHDADGQLTNKVGVKDLDYGHHELWQYQIDTLLYWSQFVDCDVAPLVPLDFWLEARK-
1ehaA           EGNYMVKLGPYFSQ--KYKTPWGLTFNFDDAESDEVRKFILENVEYWIKEYNVDGFRLDAVHAIIDTSPK


                         *         .         .         .         .         +         .:560
query           ELDSEQQMEFGHRYILGLYQLLDRLITKFPSVLFESCSSGGGRFDLGLMYYAPQAWTSDDTDPIERLKIQ
1didA           RGIKY-----DQDLVFGHGDLTSAFFTVD---LLENGFPNGGPKYTGPRHFDYKPSRTDGYDGVWDSAKA
1dxiA           YDQDLRFGAGDLRAAFWLVDLLET----------------------------------------------
2bzuA           ----------------------------------------------------------------------
2aaaA           GYNKASGVYCVGEIDNG-----------NPASDCPYQKVLDGVLNYPIYWQLLYAFESSSGSISNLYNMI
3a21A           ------GLDAATTYKSISDAVGRAAATTGRPLTLSICNWGYQNPWNWAAGQAPLWRTSTDIIYYGNQPSM
3c0uA           ----------------------------------------------------------------------
1a0cA           -WDTDQFPTDIRMTTLAMYEVIKMGGFDKGGLNFDAK-----VRRASFEPEDLFLGHIAGMDAFAKG---
1bplB           DWVNHVR-----EKTGKEMFTVAEYWQNDLGALENYLNKTNFNHSVFDVPLHYQFHAASTQGGGYDMRKL
2bhuA           HILTELAQEIHELG--------------------------------------------------------
3cc1B           ----------------------------------------------------------------------
3a5vA           RYKAMGNA---------LNKTGRPMLYSLCNWGEDGPWNFASTIS-NSWRISGDVYDNFNRPDPACPCTT
3cc1A           LEEIKIQ---RAIQACGRPVLSLSPGPAPIKYAHHFKTNANWRITDDFWDDWSLLYQFERCEVWEKHIGT
1ea9C           EFRRVVKQANPDAYILGE--------VWHESSIWLEGDQFDAVMNYPFTNAVLDFFIHQIADAEKFSFML
3dhuB           EARKQVNAKYPETLWLASGFIEELRSQGYTGLSDSELYQAFDMTYDYDVFGDFKDYWQGRSTVERYVDLL
1al0G           ----------------------------------------------------------------------
2e8yA           YMKEKATKAKPGILLFG-----------------------------------------------------
3dhuA           QVNAKYPETLWLAESAGSGFIEELRSQGYTGLSDSELYQAFDMTYDYDVFGDFKDYWQGRSTVERYVDLL
1ehaA           HILEEIADVVHKYN--------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           HGTSYGYSPSMMTAHVSISPNEQSGRQTSLDTRTNVAYFSSFGYELDVTRLSVEEKEQVREQIQFYKKYR
1didA           NMSMYLLLKERALAFRADPEVQEAMKTSGVFELGETTLNAGESA---------ADLMNDSASFAGFDAEA
1dxiA           ----------------------------------------------------------------------
2bzuA           ----------------------------------------------------------------------
2aaaA           KSVASDCSDPTLLGNFIENHDNPRFAGEEQHYAGGKVPYNREATWLSGYDTSAELYTWIATTNAIRKLAI
3a21A           TSLLSNFDQTLHPTAQHTGYYNDPDMLMVGMDGFTAAQN-------------------------------
3c0uA           ----------------------------------------------------------------------
1a0cA           ----------------------------------------------------------------------
1bplB           LNSTVVSKHPLKAVTFVDNHDTQPGQ--------------------------------------------
2bhuA           ----------------------------------------------------------------------
3cc1B           ----------------------------------------------------------------------
3a5vA           YDCVLAGFRCSVMNIINKAVAVSQKARSGGWNDLDMLEVGNGG---------------------------
3cc1A           WPDCGLPLGHIGIRSVDGPGGDRWTRFTKDEQLTNLWAICHSPL--------------------------
1ea9C           GKQLAGYPRQASEVMF------------------------------------------------------
3dhuB           QRQDATFPGN------------------------------------------------------------
1al0G           ----------------------------------------------------------------------
2e8yA           ----------------------------------------------------------------------
3dhuA           QRQDATFPGN------------------------------------------------------------
1ehaA           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           SLFQYGDFYRINSPFSCDSASWQVVSKDKCQSILLYAQLNSKLNPGYTxxxxxxxxxxxxxxxxxxxxxx
1didA           AAERNFAFIRLNQLA-------------------------------------------------------
1dxiA           ----------------------------------------------------------------------
2bzuA           ----------------------------------------------------------------------
2aaaA           A-ADSAYITYANDAFYTDSNTIAMAKGTSGSQVITVLSNKGSSGSSYT----------------------
3a21A           ----------------------------------------------------------------------
3c0uA           ----------------------------------------------------------------------
1a0cA           ----------------------------------------------------------------------
1bplB           ----------------------------------------------------------------------
2bhuA           ----------------------------------------------------------------------
3cc1B           ----------------------------------------------------------------------
3a5vA           ----------------------------------------------------------------------
3cc1A           ----------------------------------------------------------------------
1ea9C           ----------------------------------------------------------------------
3dhuB           ----------------------------------------------------------------------
1al0G           ----------------------------------------------------------------------
2e8yA           ----------------------------------------------------------------------
3dhuA           ----------------------------------------------------------------------
1ehaA           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1didA           --------------------------------------
1dxiA           --------------------------------------
2bzuA           --------------------------------------
2aaaA           --------------------------------------
3a21A           --------------------------------------
3c0uA           --------------------------------------
1a0cA           --------------------------------------
1bplB           --------------------------------------
2bhuA           --------------------------------------
3cc1B           --------------------------------------
3a5vA           --------------------------------------
3cc1A           --------------------------------------
1ea9C           --------------------------------------
3dhuB           --------------------------------------
1al0G           --------------------------------------
2e8yA           --------------------------------------
3dhuA           --------------------------------------
1ehaA           --------------------------------------