[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for spne4:ACF55041.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1d9vA.bssp"
#ERROR : Can't open dsspfile "1d9yA.bssp"
#ERROR : Can't open dsspfile "3d4gE.bssp"
#ERROR : Can't open dsspfile "3ehsA.bssp"
#ERROR : Can't open dsspfile "3d4cA.bssp"
#ERROR : Can't open dsspfile "3c4mB.bssp"
#ERROR : Can't open dsspfile "3c4mA.bssp"
#ERROR : Can't open dsspfile "3c9hA.bssp"
#ERROR : Can't open dsspfile "3c9hB.bssp"
#ERROR : Can't open dsspfile "3ef7A.bssp"
#ERROR : Can't open dsspfile "3cg3A.bssp"
#ERROR : Can't open dsspfile "3d4gA.bssp"
#ERROR : Can't open dsspfile "3ehtA.bssp"
#ERROR : Can't open dsspfile "3dm0A.bssp"
#ERROR : Can't open dsspfile "1a99A.bssp"
#ERROR : Can't open dsspfile "3d4gD.bssp"
#ERROR : Can't open dsspfile "3ehuA.bssp"
#ERROR : Can't open dsspfile "1amfA.bssp"
#ERROR : Can't open dsspfile "1a7lB.bssp"
#ERROR : Can't open dsspfile "3a3cA.bssp"
#ERROR : Can't open dsspfile "1anfA.bssp"
#ERROR : Can't open dsspfile "3cfxA.bssp"
#ERROR : Can't open dsspfile "3cg1A.bssp"
#ERROR : Can't open dsspfile "1atgA.bssp"
#ERROR : Can't open dsspfile "1a7lA.bssp"
#ERROR : Can't open dsspfile "1a54A.bssp"
#ERROR : Can't open dsspfile "1a40A.bssp"
#ERROR : Can't open dsspfile "3csbA.bssp"
#ERROR : Can't open dsspfile "1ce2A.bssp"
#ERROR : Can't open dsspfile "3csgA.bssp"
#ERROR : Can't open dsspfile "1bkaA.bssp"
#ERROR : Can't open dsspfile "2b3bA.bssp"
#ERROR : Can't open dsspfile "1dotA.bssp"
#ERROR : Can't open dsspfile "3cvgC.bssp"
#ERROR : Can't open dsspfile "3cfzA.bssp"
#ERROR : Can't open dsspfile "1aivA.bssp"
#ERROR : Can't open dsspfile "2bjjX.bssp"
#ERROR : Can't open dsspfile "1biyA.bssp"
#ERROR : Can't open dsspfile "2de3A.bssp"

## Summary of PDB Search
:202
    1e-16  19%  1d9vA  [c.94.1] PROTEIN (IRON-UTILIZATION PERIPLASMIC PROTEIN)
    7e-16  18%  1d9yA  [c.94.1] PROTEIN (PERIPLASMIC IRON-BINDING PROTEIN)
    7e-15  16%  3d4gE  [x.x.x] MALTOSE-BINDING PERIPLASMIC PROTEIN, LINKER, ZONA
    1e-14  17%  3ehsA  [x.x.x] FUSION PROTEIN OF CRFR1 EXTRACELLULAR DOMAIN AND
    2e-14  16%  3d4cA  [x.x.x] MALTOSE-BINDING PERIPLASMIC PROTEIN, LINKER, ZONA
    5e-13  15%  3c4mB  [x.x.x] FUSION PROTEIN OF MALTOSE-BINDING PERIPLASMIC
    7e-13  16%  3c4mA  [x.x.x] FUSION PROTEIN OF MALTOSE-BINDING PERIPLASMIC
    1e-12  13%  3c9hA  [x.x.x] ABC TRANSPORTER, SUBSTRATE BINDING PROTEIN
    2e-12  18%  3c9hB  [x.x.x] ABC TRANSPORTER, SUBSTRATE BINDING PROTEIN
    3e-12  16%  3ef7A  [x.x.x] MALTOSE-BINDING PERIPLASMIC PROTEIN, LINKER, ZONA
    4e-12  10%  3cg3A  [x.x.x] UPF0100 PROTEIN PH0151
    4e-12  16%  3d4gA  [x.x.x] MALTOSE-BINDING PERIPLASMIC PROTEIN, LINKER, ZONA
    7e-12  18%  3ehtA  [x.x.x] FUSION PROTEIN OF CRFR1 EXTRACELLULAR DOMAIN AND
    2e-11  17%  3dm0A  [x.x.x] MALTOSE-BINDING PERIPLASMIC PROTEIN FUSED WITH
    3e-11  18%  1a99A  [c.94.1] PUTRESCINE-BINDING PROTEIN
    4e-11  15%  3d4gD  [x.x.x] MALTOSE-BINDING PERIPLASMIC PROTEIN, LINKER, ZONA
    5e-11  17%  3ehuA  [x.x.x] FUSION PROTEIN OF CRFR1 EXTRACELLULAR DOMAIN AND
    2e-10  15%  1amfA  [x.x.x] MOLYBDATE TRANSPORT PROTEIN MODA
    9e-10  14%  1a7lB  [c.94.1] MALE-B363
    2e-09  16%  3a3cA  [x.x.x] MALTOSE-BINDING PERIPLASMIC PROTEIN, LINKER,
    5e-09  16%  1anfA  [c.94.1 (1ez9A)] MALTODEXTRIN-BINDING PROTEIN
    7e-09  12%  3cfxA  [x.x.x] UPF0100 PROTEIN MA_0280
    1e-08  17%  3cg1A  [x.x.x] UPF0100 PROTEIN PF0080
    2e-07  13%  1atgA  [x.x.x] PERIPLASMIC MOLYBDATE-BINDING PROTEIN
    3e-07  16%  1a7lA  [c.94.1] MALE-B363
    3e-07   9%  1a54A  [c.94.1] PHOSPHATE-BINDING PROTEIN
    4e-07  10%  1a40A  [x.x.x] PHOSPHATE-BINDING PERIPLASMIC PROTEIN PRECURSOR
    5e-07  21%  3csbA  [x.x.x] MALTOSE-BINDING PROTEIN MONOBODY YSX1 FUSION
    5e-06  15%  1ce2A  [c.94.1 - c.94.1] PROTEIN (LACTOFERRIN)
    7e-06  22%  3csgA  [x.x.x] MALTOSE-BINDING PROTEIN MONOBODY YS1 FUSION
    8e-06  11%  1bkaA  [x.x.x] LACTOFERRIN
    1e-05  13%  2b3bA  [x.x.x] GLUCOSE-BINDING PROTEIN
    5e-05  12%  1dotA  [x.x.x] DUCK OVOTRANSFERRIN
    5e-05   9%  3cvgC  [x.x.x] PUTATIVE METAL BINDING PROTEIN
    6e-05  14%  3cfzA  [x.x.x] UPF0100 PROTEIN MJ1186
    7e-05  14%  1aivA  [c.94.1 - c.94.1 (1ryxA)] OVOTRANSFERRIN
    8e-05  11%  2bjjX  [x.x.x] LACTOTRANSFERRIN
    6e-04  15%  1biyA  [x.x.x] LACTOFERRIN
    0.001  13%  2de3A  [x.x.x] DIBENZOTHIOPHENE DESULFURIZATION ENZYME B
:202

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxLVVYSPNSEGLIGATIPAFEEKYGIKIELIQAGTGELFKKL
1d9vA           -----------------------------ITVYNGQHKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQL
1d9yA           -----------------------------ITVYNGQHKEAAQAVADAFTRATGIKVKLNCAKGDQLAGQI
3d4gE           -----------------------------IWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEKFPQV
3ehsA           -----------------------------LVIWIDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEKFPQV
3d4cA           --------------------------------NGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEKFPQV
3c4mB           -----------------------------LVIWIDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEKFPQV
3c4mA           -----------------------------IWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEKFPQV
3c9hA           -----------------------------LVVYSSLDEPLATPMIEGFQKANDIAVHYEDMLTGEIYDRI
3c9hB           -----------------------------LVVYSSLDEPLATPMIEGFQKANDIAVHYEDMLTGEIYDRI
3ef7A           -----------------------------IWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEKFPQV
3cg3A           --------------------------------LSIPLSQVEEKFTKYAQEKLGVKVTFQDEASGSVKAVR
3d4gA           -----------------------------IWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEKFPQV
3ehtA           -----------------------------IWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEKFPQV
3dm0A           -----------------------------LVIWINGDKGYLAEVGKKFEKDTGIKVTVEHPDKLEKFPQV
1a99A           -----------------------------LHIYNWSDY-IAPDTVANFEKETGIKVVYDVFDSNELEGKL
3d4gD           --------------------------------NGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEKFPQV
3ehuA           -----------------------------LVIWIDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEKFPQV
1amfA           -----------------------------ITVFAASLTNAMQDIATQFKKEKGVDVVSSFASSSTLARQI
1a7lB           --------------------------------NGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEKFPQV
3a3cA           -----------------------------IWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEKFPQV
1anfA           --------------------------------NGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEKFPQV
3cfxA           ------------------------------VFHAGSLSVPFEELEAEFEAQHGVDVQREAAGSAQSVRKI
3cg1A           -----------------------------LIVFHAGSQEVEKEFSEYAERNLGIKVSFQDEASGSVMAVR
1atgA           -----------------------------LKVVTATNLGTLEQLAGQFAKQTGHAVVISSGSSGPVYAQI
1a7lA           --------------------------------NGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEKFPQV
1a54A           -----------------------------LTGAGATFAPVYAKWADTYQKETGNKVNYQGIGSSGGVKQI
1a40A           -----------------------------LTGAGATFAPVYAKWADTYQKETGNKVNYQGIGSSGGVKQI
3csbA           -----------------------------LVIWGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEKFPQV
1ce2A           ----------------------------------------------QWSQQSGQIVTCATASTTDCIALV
3csgA           -----------------------------LVIWIDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEKFPQV
1bkaA           ----------------------------------------------QWSGLSEGSVTCSSASTTDCIALV
2b3bA           --------------------------------WAGDEGPALEALIRLYKQKYGVEVINATVTGGNARAVL
1dotA           ----------------------------------------------RWSVVSNGEVECTILDDNDCIVKI
3cvgC           ----------------------------------------------------------------------
3cfzA           ------------------------------IFHAGSLSVPFEEYEKMFEKEHNVDVEREPAGSVACVRKI
1aivA           ----------------------------------------------RWSVVSNGDVECTVVDETDCIIKI
2bjjX           ----------------------------------------------QWSGLSEGSVTCSSASTTDCIALV
1biyA           ----------------------------------------------QWSQQSGQIVTCATASTTDDCIAL
2de3A           ------------------------------YSNSPVPNALLTASESGFLDAAGIELDVLSGQQGVHFTYD


                         .         .         *         .         .         .         .:140
query           ESEKEVPVADVIFGGSYTQYATHGELFENYISKENDNVIKEYQNTTGFSTPYTLDGSVLIVHPDLTKGMN
1d9vA           KEEGDKTPADVFYTEQTATFADLSELLAPISEQTIQQTAQKGVAPKKDWIALSGRSRVVVYDHTLSEKDM
1d9yA           KEEGSRSPADVFYSEQIPALATLSALLEPLPASTINETRGKGVAAKKDWVALSGRSRVVVYDTRLSEKDL
3d4gE           AATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLAVRYNGKLIAYPIAVEALSLIYNKDLLPNPP
3ehsA           AATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLAVRYNGKLIAYPIAVEALSLIYNKDLLPNPP
3d4cA           AATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPRYNGKLIAYPIAVEALSLIYNKDLLPNPP
3c4mB           AATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPRYNGKLIAYPIAVEALSLIYNKDLLP-NP
3c4mA           AATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLAVRYNGKLIAYPIAVEALSLIYNKDLLPNPP
3c9hA           VKETDAGKTADFASAMDLQVKLSNDGYAQRSDLAMSARWPAWANWRNTAYALTFEPAVFVYHKPSFTTEK
3c9hB           VKETDKTADFAFSSAMDLQVKLSNDGYAQRSDLAMSARWPAWANWRNTAYALTFEPAVFVYHKPSFTTEK
3ef7A           AATGDGPDIIFWAHDRFGGYAQSGLLAETPDKAFQDKLYPFRYNGKLIAYPIAVEALSLIYNKDLLPNPP
3cg3A           KVTDLKKRADIVAVADYTLIPQLMIYTDFYVLFATNEIVIAFLKNPDKWYEILSRPDVSFGFSDNQDPCG
3d4gA           AATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKFQDKLYPFRYNGKLIAYPIAVEALSLIYNKDLLPNPP
3ehtA           AATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFPETWDAVRNGKLIAYPIAVEALSLIYNKDLLP-NP
3dm0A           AATGDGPDIIFWAHDRFGGYAQSGLLAEITPAAAFQDKLAVRYNGKLIAYPIAVEALSLIYNKDLLPNPP
1a99A           MAGSTGFDLVVPSASFLERQLTAGVFQPLDKSKLPEKLVAKHDPDNKFAMPYMWATTGIGYNVDKVKNAP
3d4gD           AATGDGPDIIFWAHDRFGGYAQSGLLAEPDKAFQDKLYPFTWDAVRLIAYPIAVEALSLIYNKDLLPNPP
3ehuA           AATGDGPDIIFWAHDRFGGYAQSGLLAETPDKAFQDKLYPFRYNGKLIAYPIAVEALSLIYNKDLLP-NP
1amfA           EAGA---PADLFISADQKWM---------------DYAVDKKAIDTATRQTLLGNSLVVVAPKSVQKDFT
1a7lB           AATGDGPDIIFWAHDRFGGYAQSGLLITPDKAFQDKLYPFTWDAVRLIAYPIAVEALSLIYNKDLLPNPP
3a3cA           AATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKFQDKLYPFTWDAKLIAYPIAVEALSLIYNKDLLPNPP
1anfA           AATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPRYNGKLIAYPIAVEALSLIYNKDLLPNPP
3cfxA           TELGKKADVLASADYALIPSLMVPEYADWYAAFARNQMILAYTNESKYGDEINTDNWYEILRRPDVRYDD
3cg1A           KVTDLGRKADVIGVADYTLI---------------PQLLIPNY--TDFYVLFATNEIVIAFTDKSRYVEE
1atgA           VNGAP---YNVFFSADEKSP---------------EKLDNQGFALPGSRFTYAIGKLVLWSAKP---GLV
1a7lA           AATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPRYNGKLIAYPIAVEALSLIYNKDLLPNPP
1a54A           IANT---VDFGASDAPLSDEKLAQELFQFPTVIGGVVLAVNIPGLKSGELVLDGKTLGDIYLGKIKKWDD
1a40A           IANTVDFG--ASDAPLSDEKLAQEGLFQFPTVIGGVVLAVNIPGLKSGELVLDGKTLGDIYLGKIKKWDD
3csbA           AATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPRYNGKLIAYPIAVEALSLIYNKDL-----
1ce2A           LK-GEADALSLDGGYIYTAGKCGLVPVLAENRKS-----SKHSSLDCVLRPTEGYLAVAVVK----KANE
3csgA           AATGDGPDIIFWAHDRFGGYAQSGLLAEITPDK-------------------------------------
1bkaA           LKGE----ADAMSLDGGYVYTAGKCGLVPVLAENYKSQQSSDPDPNCVDRPVEGYLAVAVVR----RSDT
2b3bA           LGGDPPDTFQVHAGMELIGTWVVANRMEDLSALFRQEGWLQAYKGGIWSVPVNIHRSNVMWYLPAKLKGW
1dotA           TKGE----ADAISLDGGFVYTAGVCGLVPVVGESYEDETQCSKDEEQPAYYFA----VAVVKKSSAITWN
3cvgC           ------------------------------------------HGISESPSYYAFRDHFLIGPPSNPAK--
3cfzA           IDLGKKA--DILASADYSLIPQMMM-----------------PKYADWYVMFARNEIVLAYTDKSKYKDS
1aivA           MKGE----ADAVALDGGLVYTAGVCMAERY--DDESQCSKTDERPASYF-------AVAVARKDSNVNWN
2bjjX           LKGE----ADAMSLDGGYVYTAGKCGLVPVLAENYKSQQSSDPDPNCVDRPVEGYLAVAVVR----RSDT
1biyA           VLKGEADA--LSLDGGYIYTAGKCGLVPVLAENRKSS---KHSSLDCVLRPTEGYLAVAVVK----KANE
2de3A           QPAY----TRFGGEIPPLLSEGL----------------RAPGRTRLLGITPLLGRQGFFVR----DDSP


                         +         .         .         .         .         *         .:210
query           IEGYSDLLKPELKGKIATADPANSSSAFAQLTNMLQAQGGYKDDKAWSYVKDLFTLIDGIVK
1d9vA           EKSVLDYATPKWKGKI--GYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKENGKLYAK---
1d9yA           EKSVLNYATPKWKNRIGYVPTSGAF-----LEQIVAIVKLKGEAAALKWLKGLK--------
3d4gE           KEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVD-------
3ehsA           KEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVD-NAGAKA
3d4cA           KEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVD-------
3c4mB           PKTWEEIPALDKELKAKGKSALQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVD-------
3c4mA           KEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVD-------
3c9hA           PATRAEFVDYLERHAKEVHGRIATYDIERGVGFLFMSRDQEQFGDIWSVIKAM---------
3c9hB           FVDYLERHAKEVHGRIATYDIERSGVGFLFMSRDQEQFGDIWSVIKA---------------
3ef7A           KEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVD-------
3cg3A           YRSVMVMKLAELYYGRPIFKELVEKTTNIYSNGTRIYAPKEIIIKDK---------------
3d4gA           KEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVD-------
3ehtA           PKTWEEIPALELKAKGKSALMFNLQEPYFTWPLIAADGGAFKYENGKYDIKDVGVDNAGAKA
3dm0A           KEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVD-------
1a99A           VDSWDLILKPENLEKLKSCGVSFLDAPEEVFATVLNYLGKDPNSTKAD--------------
3d4gD           KEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVD-------
3ehuA           PKTWEEIPALDLKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDN----
1amfA           IDSKTNWTSLLNGGRLAVGDPEHVPAGIY-AKEALQKLG--AWDTLSPKLA-----------
1a7lB           KEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVD-------
3a3cA           KEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVD-------
1anfA           KEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVD-------
3cfxA           PAGYRSQMVTQLAESYYNDDMYDDLMLANTGMTLTTEENGTALIHVPASEEISP--------
3cg1A           MKSYEILAREDV--RFGFSDPNQDPCGYRSLMVIKLADLYYGKEIFKELIE-----------
1atgA           DNQGKVLAGNGWRHIAIS--NPQIAPYGLAGTQVLTHLGLLDKLTAQ---------------
1a7lA           KEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVD-------
1a54A           EAIAKLNPGLKLPSQNIAVVRRADGSGTSFVFTSYLAKVNEEWKNNVGTGST----------
1a40A           EAIAKLNPGLKLSQNIAVVRRADGSGTSFVFTSYLAKVNEEWKNNVGTGST-----------
3csbA           --------------------------------------------------------------
1ce2A           GLTWNSL-----KGKKSCHTAVDRTAGWNIPMGLIANQTGSCAF------------------
3csgA           --------------------------------------------------------------
1bkaA           SLTWNS-----VKGKKSCHTAVDRTAGWNIPMGLLFNQTGSCKFDEY---------------
2b3bA           GKFLATCQTLKQKGLEAPLALGENWTQQHLWESVALAVLGPDDWNNLWNGKLKFT-------
1dotA           ----------NLQGKKSCHTAVGRTAGWNIPMGLIHNKTGSCDF------------------
3cvgC           LSGDSDIADFSKHDAAEAGNTKPPVRFLSRYDKSAIKEAELWLSIGQVPWATA---------
3cfzA           TNWYKILQRPDVKIGF--SNPNDDPCGYRTQMVLQLAELYYKDPTIY---------------
1aivA           ----------NLKGKKSCHTAVGRTAGWVIPMGLIHNRTGTCNFD-----------------
2bjjX           SLTWNS-----VKGKKSCHTAVDRTAGWNIPMGLLFNQTGSCKFDEY---------------
1biyA           GLTWNSL-----KGKKSCHTAVDRTAGWNIPMGLIANQTGSCAFDEF---------------
2de3A           ITAAAD-----LAGR-RIGVSASAIRILRGQLGDYLELDPWRQTLVALGSWEARALLHT---