[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for spne4:ACF55178.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3c5iA.bssp"
#ERROR : Can't open dsspfile "3dbsA.bssp"
#ERROR : Can't open dsspfile "3dk6A.bssp"
#ERROR : Can't open dsspfile "2bkkA.bssp"
#ERROR : Can't open dsspfile "3csfA.bssp"
#ERROR : Can't open dsspfile "2e2bA.bssp"
#ERROR : Can't open dsspfile "3e87A.bssp"
#ERROR : Can't open dsspfile "3dxpA.bssp"
#ERROR : Can't open dsspfile "2c47C.bssp"
#ERROR : Can't open dsspfile "1cdkA.bssp"
#ERROR : Can't open dsspfile "2advA.bssp"
#ERROR : Can't open dsspfile "3cqzH.bssp"
#ERROR : Can't open dsspfile "3c5yA.bssp"
#ERROR : Can't open dsspfile "3dndA.bssp"
#ERROR : Can't open dsspfile "3ei1A.bssp"
#ERROR : Can't open dsspfile "3c9wA.bssp"
#ERROR : Can't open dsspfile "2bvaA.bssp"
#ERROR : Can't open dsspfile "2bkkC.bssp"
#ERROR : Can't open dsspfile "3blrA.bssp"
#ERROR : Can't open dsspfile "2ckpB.bssp"
#ERROR : Can't open dsspfile "3byvA.bssp"
#ERROR : Can't open dsspfile "1cmkE.bssp"
#ERROR : Can't open dsspfile "3c5yL.bssp"
#ERROR : Can't open dsspfile "2ckoB.bssp"
#ERROR : Can't open dsspfile "3c5yE.bssp"
#ERROR : Can't open dsspfile "3csvA.bssp"
#ERROR : Can't open dsspfile "1apmE.bssp"
#ERROR : Can't open dsspfile "2chwA.bssp"
#ERROR : Can't open dsspfile "3e3pA.bssp"
#ERROR : Can't open dsspfile "3c5yB.bssp"
#ERROR : Can't open dsspfile "3e8cE.bssp"
#ERROR : Can't open dsspfile "3c5yF.bssp"
#ERROR : Can't open dsspfile "1e7uA.bssp"
#ERROR : Can't open dsspfile "3bhhB.bssp"
#ERROR : Can't open dsspfile "2e2bB.bssp"
#ERROR : Can't open dsspfile "2c47A.bssp"
#ERROR : Can't open dsspfile "2bmcF.bssp"
#ERROR : Can't open dsspfile "3cq9D.bssp"
#ERROR : Can't open dsspfile "3cg2A.bssp"
#ERROR : Can't open dsspfile "2dwbA.bssp"
#ERROR : Can't open dsspfile "1e7vA.bssp"
#ERROR : Can't open dsspfile "3bl3A.bssp"
#ERROR : Can't open dsspfile "3cuqA.bssp"
#ERROR : Can't open dsspfile "3e5aA.bssp"
#ERROR : Can't open dsspfile "3bhhC.bssp"
#ERROR : Can't open dsspfile "2eb3A.bssp"
#ERROR : Can't open dsspfile "3e93A.bssp"
#ERROR : Can't open dsspfile "3da6A.bssp"
#ERROR : Can't open dsspfile "3dxnA.bssp"
#ERROR : Can't open dsspfile "3ckwA.bssp"
#ERROR : Can't open dsspfile "3dkfA.bssp"
#ERROR : Can't open dsspfile "3bceA.bssp"
#ERROR : Can't open dsspfile "3a5cA.bssp"
#ERROR : Can't open dsspfile "2b5mA.bssp"
#ERROR : Can't open dsspfile "3comB.bssp"
#ERROR : Can't open dsspfile "3cq9B.bssp"
#ERROR : Can't open dsspfile "2cgxA.bssp"
#ERROR : Can't open dsspfile "2c3jA.bssp"
#ERROR : Can't open dsspfile "2ae4A.bssp"
#ERROR : Can't open dsspfile "1e8xA.bssp"
#ERROR : Can't open dsspfile "1e8wA.bssp"
#ERROR : Can't open dsspfile "3e59C.bssp"
#ERROR : Can't open dsspfile "1a0eA.bssp"
#ERROR : Can't open dsspfile "2ckoA.bssp"
#ERROR : Can't open dsspfile "3dyhA.bssp"
#ERROR : Can't open dsspfile "3dajA.bssp"
#ERROR : Can't open dsspfile "2bfxB.bssp"
#ERROR : Can't open dsspfile "2a1sB.bssp"
#ERROR : Can't open dsspfile "2chxA.bssp"
#ERROR : Can't open dsspfile "3c4yB.bssp"
#ERROR : Can't open dsspfile "2bmcA.bssp"
#ERROR : Can't open dsspfile "2ckqA.bssp"
#ERROR : Can't open dsspfile "3bhhD.bssp"
#ERROR : Can't open dsspfile "3dlxA.bssp"
#ERROR : Can't open dsspfile "1b5eA.bssp"
#ERROR : Can't open dsspfile "3bboU.bssp"
#ERROR : Can't open dsspfile "2brmA.bssp"
#ERROR : Can't open dsspfile "2a19C.bssp"
#ERROR : Can't open dsspfile "3dlxB.bssp"
#ERROR : Can't open dsspfile "3dplC.bssp"
#ERROR : Can't open dsspfile "2a97A.bssp"
#ERROR : Can't open dsspfile "3c0iA.bssp"
#ERROR : Can't open dsspfile "3cs9D.bssp"
#ERROR : Can't open dsspfile "3dk7B.bssp"
#ERROR : Can't open dsspfile "3dlxC.bssp"
#ERROR : Can't open dsspfile "2bcjA.bssp"
#ERROR : Can't open dsspfile "2cunA.bssp"
#ERROR : Can't open dsspfile "3c0gA.bssp"
#ERROR : Can't open dsspfile "3c5yH.bssp"
#ERROR : Can't open dsspfile "248lA.bssp"
#ERROR : Can't open dsspfile "2b8uA.bssp"
#ERROR : Can't open dsspfile "3ck8A.bssp"
#ERROR : Can't open dsspfile "1b5dA.bssp"
#ERROR : Can't open dsspfile "2bmcB.bssp"
#ERROR : Can't open dsspfile "3dkgA.bssp"

## Summary of PDB Search
:543
    2e-23  11%  3c5iA  [x.x.x] CHOLINE KINASE
    3e-23  13%  3dbsA  [x.x.x] PHOSPHATIDYLINOSITOL-4,5-BISPHOSPHATE 3-KINASE
    9e-18  22%  3dk6A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    2e-17  11%  2bkkA  [x.x.x] AMINOGLYCOSIDE 3'-PHOSPHOTRANSFERASE
    2e-16   7%  3csfA  [x.x.x] PHOSPHATIDYLINOSITOL-4,5-BISPHOSPHATE 3-KINASE
    2e-16  22%  2e2bA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    3e-16  31%  3e87A  [x.x.x] RAC-BETA SERINE/THREONINE-PROTEIN KINASE
    1e-15  10%  3dxpA  [x.x.x] PUTATIVE ACYL-COA DEHYDROGENASE
    4e-15  14%  2c47C  [x.x.x] CASEIN KINASE 1 GAMMA 2 ISOFORM
    6e-15  24%  1cdkA  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE
    1e-14  14%  2advA  [x.x.x] GLUTARYL 7- AMINOCEPHALOSPORANIC ACID ACYLASE
    2e-14  11%  3cqzH  [x.x.x] DNA-DIRECTED RNA POLYMERASES I, II, AND III
    8e-14  11%  3c5yA  [x.x.x] RIBOSE/GALACTOSE ISOMERASE
    1e-13  24%  3dndA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT
    1e-13   4%  3ei1A  [x.x.x] DNA DAMAGE-BINDING PROTEIN 1
    1e-13  27%  3c9wA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 1
    2e-13  27%  2bvaA  [x.x.x] P21-ACTIVATED KINASE 4
    2e-13  14%  2bkkC  [x.x.x] AMINOGLYCOSIDE 3'-PHOSPHOTRANSFERASE
    4e-13  22%  3blrA  [x.x.x] CELL DIVISION PROTEIN KINASE 9
    5e-13  14%  2ckpB  [x.x.x] CHOLINE KINASE ALPHA
    5e-13  22%  3byvA  [x.x.x] RHOPTRY KINASE
    6e-13  15%  1cmkE  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT
    7e-13  13%  3c5yL  [x.x.x] RIBOSE/GALACTOSE ISOMERASE
    8e-13  12%  2ckoB  [x.x.x] CHOLINE KINASE ALPHA
    9e-13  11%  3c5yE  [x.x.x] RIBOSE/GALACTOSE ISOMERASE
    9e-13  14%  3csvA  [x.x.x] AMINOGLYCOSIDE PHOSPHOTRANSFERASE
    1e-12  18%  1apmE  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE
    1e-12  13%  2chwA  [x.x.x] PHOSPHATIDYLINOSITOL-4,5-BISPHOSPHATE 3-KINASE
    2e-12  19%  3e3pA  [x.x.x] PROTEIN KINASE, PUTATIVE GLYCOGEN SYNTHASE
    2e-12  11%  3c5yB  [x.x.x] RIBOSE/GALACTOSE ISOMERASE
    3e-12  26%  3e8cE  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT
    4e-12  13%  3c5yF  [x.x.x] RIBOSE/GALACTOSE ISOMERASE
    4e-12  16%  1e7uA  [d.15.1 - b.7.1 - a.118.1 - d.144.1] PHOSPHATIDYLINOSITOL
    4e-12  28%  3bhhB  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    7e-12  20%  2e2bB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    8e-12  27%  2c47A  [x.x.x] CASEIN KINASE 1 GAMMA 2 ISOFORM
    2e-11  16%  2bmcF  [x.x.x] SERINE THREONINE-PROTEIN KINASE 6
    3e-11   9%  3cq9D  [x.x.x] UNCHARACTERIZED PROTEIN LP_1622
    4e-11  21%  3cg2A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    9e-11  27%  2dwbA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    9e-11  15%  1e7vA  [d.15.1 - b.7.1 - a.118.1 - d.144.1] PHOSPHATIDYLINOSITOL
    1e-10  27%  3bl3A  [x.x.x] QUEUINE TRNA-RIBOSYLTRANSFERASE
    1e-10  11%  3cuqA  [x.x.x] VACUOLAR-SORTING PROTEIN SNF8
    2e-10  21%  3e5aA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    3e-10  27%  3bhhC  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    4e-10  25%  2eb3A  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    4e-10  18%  3e93A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    5e-10  31%  3da6A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    6e-10  22%  3dxnA  [x.x.x] CALMODULIN-LIKE DOMAIN PROTEIN KINASE ISOFORM 3
    6e-10  27%  3ckwA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 24
    8e-10  26%  3dkfA  [x.x.x] MET PROTO-ONCOGENE
    2e-09  22%  3bceA  [x.x.x] RECEPTOR TYROSINE-PROTEIN KINASE ERBB-4
    2e-09  11%  3a5cA  [x.x.x] V-TYPE ATP SYNTHASE ALPHA CHAIN
    3e-09   5%  2b5mA  [x.x.x] DAMAGE-SPECIFIC DNA BINDING PROTEIN 1
    7e-09  29%  3comB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 4
    8e-09   9%  3cq9B  [x.x.x] UNCHARACTERIZED PROTEIN LP_1622
    9e-09  23%  2cgxA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    9e-09  23%  2c3jA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    2e-08  14%  2ae4A  [x.x.x] GLUTARYL 7-AMINOCEPHALOSPORANIC ACID ACYLASE
    2e-08  14%  1e8xA  [d.15.1 - b.7.1 - a.118.1 - d.144.1] PHOSPHATIDYLINOSITOL
    2e-08  16%  1e8wA  [d.15.1 - b.7.1 - a.118.1 - d.144.1] PHOSPHATIDYLINOSITOL
    2e-08   5%  3e59C  [x.x.x] PYOVERDINE BIOSYNTHESIS PROTEIN PVCA
    2e-08   8%  1a0eA  [c.1.15] XYLOSE ISOMERASE
    1e-07   9%  2ckoA  [x.x.x] CHOLINE KINASE ALPHA
    2e-07   9%  3dyhA  [x.x.x] FARNESYL PYROPHOSPHATE SYNTHASE
    2e-07  22%  3dajA  [x.x.x] SERINE/THREONINE KINASE 6
    2e-07  32%  2bfxB  [x.x.x] LOC398457 PROTEIN
    3e-07  11%  2a1sB  [x.x.x] POLY(A)-SPECIFIC RIBONUCLEASE PARN
    4e-07  13%  2chxA  [x.x.x] PHOSPHATIDYLINOSITOL-4,5-BISPHOSPHATE 3-KINASE
    4e-07  32%  3c4yB  [x.x.x] RHODOPSIN KINASE
    8e-07  18%  2bmcA  [x.x.x] SERINE THREONINE-PROTEIN KINASE 6
    9e-07   6%  2ckqA  [x.x.x] CHOLINE KINASE ALPHA
    1e-06  28%  3bhhD  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    1e-06  12%  3dlxA  [x.x.x] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE 1
    1e-06   6%  1b5eA  [d.117.1] PROTEIN (DEOXYCYTIDYLATE HYDROXYMETHYLASE)
    2e-06  18%  3bboU  [x.x.x] RIBOSOMAL PROTEIN L22
    3e-06   7%  2brmA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    4e-06   6%  2a19C  [x.x.x] INTERFERON-INDUCED, DOUBLE-STRANDED RNA-
    4e-06  13%  3dlxB  [x.x.x] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE 1
    4e-06  14%  3dplC  [x.x.x] CULLIN-5
    1e-05   6%  2a97A  [x.x.x] BOTULINUM NEUROTOXIN TYPE F
    1e-05  36%  3c0iA  [x.x.x] PERIPHERAL PLASMA MEMBRANE PROTEIN CASK[MASQUE :
    1e-05  26%  3cs9D  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    1e-05  25%  3dk7B  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    2e-05  17%  3dlxC  [x.x.x] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE 1
    3e-05  20%  2bcjA  [x.x.x] G-PROTEIN COUPLED RECEPTOR KINASE 2
    3e-05  11%  2cunA  [x.x.x] PHOSPHOGLYCERATE KINASE
    3e-05  36%  3c0gA  [x.x.x] PERIPHERAL PLASMA MEMBRANE PROTEIN CASK[MASQUE :
    3e-05  10%  3c5yH  [x.x.x] RIBOSE/GALACTOSE ISOMERASE
    3e-05  10%  248lA  [x.x.x] T4 LYSOZYME
    4e-05  13%  2b8uA  [a.26.1 (1iarA)] INTERLEUKIN-4
    7e-05  12%  3ck8A  [x.x.x] SUSD
    7e-05   5%  1b5dA  [d.117.1] PROTEIN (DEOXYCYTIDYLATE HYDROXYMETHYLASE)
    1e-04  19%  2bmcB  [x.x.x] SERINE THREONINE-PROTEIN KINASE 6
    2e-04  27%  3dkgA  [x.x.x] MET PROTO-ONCOGENE
:543

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MGQILLAMRLAHTRGIVHRDLKPQNILLTPDGTAKVTDFGIAVAFAETSLTQTNSMLGSVHYLSPEQARG
3c5iA           MKVYSKSDNLANTIVFCHNDLQENNIINTNCLRLIDFEYSGFNFLATDIANFF-IETSIDYSVSSYPFFE
3dbsA           --VYSCAGYCVATFVLGIGDRHNDNIMITETGNLFHIDFGHERVPFVLTPDFLGKKTSPHFQKFQDICVK
3dk6A           --QISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTTAHA-GAKFPIKWTAPESLAY
2bkkA           LYDFLKTEKPEEELVFSHGDLGDSNIFVKDGKVSGFIDLGRSGRADKWYDIAFCVRSIREDIGEEQYVDL
3csfA           --ATFVLGIGDRHNDNIMITETGNLFHIDFGHLGERVPFVLT-PDFLFVMGTSGKKTSPHFQKFQDICVK
2e2bA           --QISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLTYTA----HAGAKFPIKWTAPESLAY
3e87A           --EIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEGISDGATMK--FCGTPEYLAPEVLED
3dxpA           --QHIPQEDADLTSIVHGDYRLDNLFHPTEPRVLAVLDWELSTLGHPGD-FGYHCSWHIAPGQFRGIAGL
2c47C           EYVHTKSLIYRDVKPENFLVGRPGQHAIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLG
1cdkA           AAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRV-----KGRTWLCGTPEYLAPEIILS
2advA           WGPDYEQTTVWLLTNGVPERAQQWYAQQSPDFRANLDAFAAG----------INAYAQQNPDDISPDVRQ
3cqzH           -----------FDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDAQDSLTVTIASTRSWRPPQAGDR
3c5yA           --ALIIENSQAAKNAVVHEALTTVAE----PLGHKVFNYGYTAEDKASLTYVNGLLAGILGAADFVVTGG
3dndA           ---IVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFA-----KRVKGRTWLCGTPEYLAPEIILS
3ei1A           --GIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNIRLEELHIDVKFLYGCQAPTICFVYQDPQG
3c9wA           LYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPTWYRAPEIMLNSKGYTKSIDIWS
2bvaA           CLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVE----VPRRKLVGTPYWMAPELISR
2bkkC           --DFLKTEKPEEELVFSHGDLGDSNIFVKDGKVSGFIDLGRSGRADKWYDIAFCVRSI-REDIGEEQYVE
3blrA           --MLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLA-RAFSLAPNRYNRVVTLWYRPPELLLGE
2ckpB           -----------SPVVFCHNDCQEGNILLLEQKLMLI-DFEYSS-YNYRGFDIGNHFCEWMYDYSYEKYPF
3byvA           --QVIRLLASLHHYGLVHTYLRPVDIVLDQRGGVFLTGFEHLVRDSVSRGFEPPELEARRATISYHRDRR
1cmkE           --FYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTD-FGFAKRVKGRTWLCGTPEYLAPEIILS
3c5yL           -GKIALIISQAAKNAVVHEALTTVAE----PLGHKVFNYGYTAEDKASLTYVNGLLAGILLNSGAADFVV
2ckoB           -----------SPVVFCHNDCQEGNILLLEGRELMLIDFEYSSYN--YRGFDIGNHFCEWMYDYSYEKYP
3c5yE           QGKIALIIENSAKNAVVHEALTTVAE----PLGHKVFNYGYTAEDKASLTYVNGLLLLNSGAADFVVTGG
3csvA           HRFAQILSAQLEGDVFVHRDFHAQNLLWLPEREGLARDFQDAKHRAYDLVSLLQDARRDVPAQVEAQIDH
1apmE           --FYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKG-RTWLCGTPEYLAPEIILS
2chwA           --VYSCAGYCVATFVLGIGDRHNDNIMITETGNLFHIDFGHERVPFVLTPGTSGKKTSPHFQKFQDICVK
3e3pA           QLIRSIGCLHLPSVNVCHRDIKPHNVLVNEADGTLKLCDFGSAKKLSPSEPNVAYICSRYYRAPELIFGN
3c5yB           --ALIIENSQAAKNAVVHEALTTVAE----PLGHKVFNYGYTAEDKASLTYVNGLLLLNSGAADFVVTGG
3e8cE           --QIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSK----
3c5yF           -GKIALIIENSAKNAVVHEALTTVAE----PLGHKVFNYGYTAEDKASLTYVNGLLAGILLNADFVVTGG
1e7uA           ---YSCAGYCVATFVLGIGDRHNDNIMISETGNLFHIDFGH-------INKERVPFVLTPDFLFVMGTSG
3bhhB           IQQILEAVLHCHQMGVVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGDQQAWFAGTPGYLSPEVLRK
2e2bB           ATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGL------STYTAHAGAKFPIKWTAPESLAY
2c47A           AIQLITRMEYVHTKSLIYRDVKPENFLVGRPGTKRQHAIHIIDFGLHIPYREHKSLTGTARYMSINTHLG
2bmcF           ITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWS-VTLDYLPPEMIEGRMHDEKVDLWSLGV
3cq9D           HLTLPDEKYQLDAAYNAYPISWASNEFSGNTGHFSFDAGVLAV---------------------------
3cg2A           IYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARTRWYRAPEIQTVDIWSVGCIMAELLTG
2dwbA           ---LANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHA-------PSSRTLCGTLDYLPPEIE
1e7vA           RFVYSCAGYCVATFVLGIGDRHNDNIMISETGNLFHIDFGHINKE-------RVPFVLTPDFLFVMGTSG
3bl3A           -------AERIAKLGGLHSFMGWDRPILTDSGGFQVMSLKQS----EEGVTFKSH--GSRHMLSPERSIE
3cuqA           --FAQDVSQDDLIRAIKKLKALGTGFGIIPVGGTYLIQSVPAELNMDH--TVVLQLAEKNGYVTVSWETE
3e5aA           ITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAP----SSRRTLCGTLDYLPPEMIEG
3bhhC           IQQILEAVLHCHQMGVVHRDLKPENLLLASKCKGAAVKLADFGLAIQGDQQAWFGFAGTPGYLSPEVLRK
2eb3A           CVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGRAK-------------LVPIKWMALESILH
3e93A           IYQILRGLKYIHSADIIHRDLKPSNLAVNEDELKILDFGL-------TDDEMTGYVATRWYRAPEIMLNW
3da6A           --QMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFG------------LARTVVTRYYRAPEVILG
3dxnA           MKQVLSGTTYLHKHNIVHRDLKPENLLLESKSDALIKIVDFGLSAHFERLGTAYYIAPEVLRKKYDE---
3ckwA           LREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADF----------------FVGTPFWMAPEVIKQ
3dkfA           --QVAKGMKFLASKKFVHRDLAARNCMLDEKFTVKVADFGLA----------RDMYKLPVKWMALESLQT
3bceA           --QIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNAGK-MPIKWMALECIHY
3a5cA           VAAREASIYVGVTIAEYFRDQGFSVALMADSTS-RWAEALREISS---RLEEMPAEEGYPPYLAARLAAF
2b5mA           ETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNIRLEELHVIDVKFLYGCQAPTICFVYQDPQ
3comB           --STLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGV---AGQLTDMAKRNVIGTPFWMAPEVIQE
3cq9B           PHLTLPDEKQLDAAYNAYPISWASNEFSGNTGHFSFDAGVLAVIQSRDDSADA-----------------
2cgxA           --QLMAGVVYLHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLLNKMTLPYVAPELLKRR
2c3jA           FHQLMAGVVYLHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLKMCGTLPYVAPELLKRR
2ae4A           -----------LLTNGVPERAQQWYAQQSPDFRANLDAFAA---------GINAYAQQNPDDISPDVRQV
1e8xA           RFVYSCAGYCVATFVLGIGDRHNDNIMISETGNLFHIDFGHVPFVLTPDVMGTSGKKTSLHFQKFQDVCV
1e8wA           --VYSCAGYCVATFVLGIGDRHNDNIMISETGNLFHIDFGNK---------ERVPFVLTPDFLFVMGTSG
3e59C           --RRIEQVQLPRIAAFIEAGEPIEFVLPAFPAKSPNPGKVLLNHLCQRIQLFYAPGAKITVCSDGRVFGD
1a0eA           -------------------------------------EIPKVQFEGK----ESTNPLAFKFYDPEEIIDG
2ckoA           -----------SPVVFCHNDCQEGNILLLEGRENSEKQKLMLIDFEYSSYNYIGNHFCEWMYDYSYEANI
3dyhA           ACVCGWMIEFLQAHYLVEDDIMDNSVTRR-GKPCWYRHPDVTVQCAINDGLLLKSWTHMMAMHFFA----
3dajA           --ELANALSYCHSKRVIHRDIKPENLLLGSNGELKIADFGWSTLDYLPPEMIH-----------------
2bfxB           MEELADALHYCHERKVIHRDIKPENLLMGYKGELKIADFGWSVHAPSLRRRMCGTL----DYLPPEMIEG
2a1sB           DQVVEKIEDLLQSEENKNLDLEPCTGFQRKLIYQTLSWKYPKGIHVE---TLETEKKERYIVISKVDEEE
2chxA           ----------------------------------------------------------------------
3c4yB           TAQIVSGLEHLHQRNIIYRDLKPENVLLDDDGNVRISDLGLAVELKAGQTK-TKGYAGTPGFMAPELLLG
2bmcA           ITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWS-VTLDYLPPEMIEGRMHDEKVDLWSLGV
2ckqA           -----------SPVVFCHNDCQEGNILLLEGKLMLIDFEYSSYNYRGFDIGNHFCEWMYDYSYEKYPFFR
3bhhD           IQQILEAVLHCHQMGVVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGDQQFGFAGTPGYLSPEVLRK
3dlxA           --------------------------------TKFYTDPVEAVKDGATVLVGGFGLCGIPENLIDALLKT
1b5eA           KGEINSNYGWAIWSEDNYAQYDMCLAELQNPDSRRGIMIYTRPSMQFDYMSDFMCTNTVQYLIRDKKINA
3bboU           FKLIYSAAANAHNKQFNKANLIISKAEVNKGITLKKVKPR------------------------------
2brmA           --VYLHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLLNKM-CGTLPYVAPELLKRREFH
2a19C           --------------------------------------YALGLILAELLGIISDIFDKKEKTLLQKLLSK
3dlxB           --------------------------------TKFYTDPVEAVKDGATVLVGGFGLCGIPENLIDALLKT
3dplC           ------QIEWLIEHKYIRRDESDINTF-------------------------------------------
2a97A           LQEISYAKPYLGNDHTFSPVTRTTSVNIKLSTNVESSMLLNLLVLGAGPDIFESCCYPVRKLIIVTFSPE
3c0iA           MRQILEALRYCHDNNIIHRDVKPHCVLLANSAPVKLGGFGVAIQLGESGLV-AGGRVGTPHFMAPEVVKR
3cs9D           ATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAY
3dk7B           ATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTTAHAGAK-FPIKWTAPESLAY
3dlxC           --------------------------------TKFYTDPVEAVKDGATVLVGGFGLCGIPENLIDALLKT
2bcjA           -----------HNRFVVYRDLKPANILLDEHGHVRISDLGLACDFSKKKPHASVGTHGYMAP--EVLQKG
2cunA           KGFDLGRKNVEFMKKKGLLDYVKHAEEILDEFYPYIVDFAVDYKGERVEIDLLSENRGLHQYQIMDIGKR
3c0gA           MRQILEALRYCHDNNIIHRDVKPHCVLLANSAPVKLGGFGVAIQLGESGLV-AGGRVGTPHFMAPEVVKR
3c5yH           -----------------AVVHEALTTVAEPLGH-KVFNYGYTAEDKASLTYVN-------GLLAGILLNS
248lA           -----------AKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQ----KRWDEAAVNKSRW
2b8uA           ----------------------------------------------------------------------
3ck8A           ------QAPFGRADKAANWLLRARLYLNAGV-YTGQTDYAKAEEYASKVIGSAYKLCTN--YSELFMADN
1b5dA           -----------IWSEDNYAQYDMCLAELGQNDSRRGIMIYTRPSMQFDYMSDFMCTNTVQYLIRDKVVNM
2bmcB           --ELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVTLDYLPPEMIEGRMHDEKVWSLGVLCY
3dkgA           GLQVAKGMKFLASKKFVHRDLAARNCMLDEKFTVKVADFGLARLP--------------VKWMALESLQT


                         .         .         *         .         .         .         .:140
query           SKATVQSDIYAMGIIFYEMLTGHIPYDGDSAVTIALQHFQKPLPSVIAENPSVPQALENVIIKATAKKLT
3c5iA           IDKKKYISYENRKLFITAYLSNYLPTPKLIDEILEAVEVQALGAHL--LWGFWSIIRGYQTKFDFFLYAE
3dbsA           AYLALRHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGK----NEEDAKKYFLDQIEVCRDKGWT
3dk6A           NKFSIKSDVWAFGVLLWEIATYGMSPYPGIDPSQVYELLEKDYRMERPEGCP------------------
2bkkA           LGIKPDWEKIKYYILLDELF--------------------------------------------------
3csfA           AYLALRHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKN----EEDAKKYFLDQIEVCRDKGWT
2e2bA           NKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCP------------------
3e87A           NDYGRAVDWWGLGVVMYEMMCGRLPFYNQD----------------------------------------
3dxpA           DHAALGIPDEASYRKLYEQRTGRPITGDWNFYLAFSFRIAGILQGIVVDGTASSAQALDAGKRARPAEGW
2c47C           KEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTYQKIGDTKRATPIEVLCENFPEEMATYLRY-------
1cdkA           KGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQI----YEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLT
2advA           VLPVSGADVVAHAHRLMNFLYVASPGRT------------------------------------------
3cqzH           SKFEEVSKVYSFGGLLMRLEENAYLLIR------------------------------------------
3c5yA           TGGSLAANAPGVFCGLVIDPTDAFLFGQ------------------------------------------
3dndA           KGYNKAVDWWALGVLIYEMAAGYPPFFA----DQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLT
3ei1A           RHVKTYEVSLREKEFNKGPWKQENVEA-------------------------------------------
3c9wA           VGCILAEMLSNRPIFPGKH---------------------------------------------------
2bvaA           LPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKSLKGFLDRLLVRDPAQRATAAELLK------------
2bkkC           LFIKPDWEKIKYYILLDELF--------------------------------------------------
3blrA           RDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHLISQLCGSITPEVWPNVDNYELYEKLELVK---VKDR
2ckpB           FRAIRKYPTKKQQLHFISSYLPAFQFENLSTEEK-SIIKEEMLLEVNALASHFLWGLWAQARFDAYFHQK
3byvA           TLMTFSFDAWALGLVIYWIWCADLPIGGSE----------------------------------------
1cmkE           KGYNKAVDWWALGVLIYEMAAGYPPFFADQ----------------------------------------
3c5yL           TGGSLAANAPGVFCGLVIDPTDAFLFGQI-----------------------------------------
2ckoB           FANIRKYPTKKQQLHFISSYLFQNDFENLSTEEKSIIKEEMLLEVNRFALASHFLWGLWSIVQAKISSIE
3c5yE           TGGSLAANAPGVFCGLVIDPTDAFLFGQINDGNAISKGFGWAAELNLQDVYRKLFDGERGLGYPRERAEI
3csvA           YIQATGVDESHFRSAYAVIAVQRNRILGIFARLSQRFGKRHYIEFVPRVWAHFERGLAHPALASAAEEI-
1apmE           KGYNKAVDWWALGVLIYEMAAGYPPFFADQ----------------------------------------
2chwA           AYLALRHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTV----GKNEEDAKKYFLDQIEVCRDKGWT
3e3pA           QHYTTAVDIWSVGCIFAEMMLGEPIFRGDN----------------------------------------
3c5yB           TGGSLAANAPGVFCGLVIDPTDAFLFGQIN----------------------------------------
3e8cE           -GYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVR--------------------------
3c5yF           TGGSLAANAPGVFCGLVIDPTDAFLFGQIN----------------------------------------
1e7uA           KKTSLHQKFQDVCVKAYLALRHH----TNLLIILFSMMLMTGMPQ-------------------------
3bhhB           EAYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLINQMLTINPA
2e2bB           NKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYR--MERPEGCPEKVYELMRACWQWNPS
2c47A           KEQSRRDDLEALGHMFMYFLRGSLPWQG------------------------------------------
2bmcF           LCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISRLLKHNPSQRPMLREVLEHPWITANS
3cq9D           ----------------------------------------------------------------------
3cg2A           RTLFPGTDIDQLKLILRLVGTPGAELLKKISSEYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSD
2dwbA           GRHDEKVDLWSLGVLCYEFLVGKPPFEAN-----------------------------------------
1e7vA           KKTLHFQKFQDVCVKAYLALRHH----TNLLIILFSMMLMTGMPQ-------------------------
3bl3A           IQHLLGSDIV------------------------------------------------------------
3cuqA           RARQVLEHLLKEGLAWLDLQAPGEAHYWL------PALFTDLYQEITAE---------------------
3e5aA           RMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISRLLKHNPSQRPM
3bhhC           EAYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLINQMLTINPA
2eb3A           RIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTI-----------------
3e93A           MHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPK
3da6A           MGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGT--------------------------
3dxnA           -----KCDVWSCGVILYILLCGYPPFGGQTDQEILKRVEKGKFSFDPPDWTQVSDEAKQLVKLMLTYEPS
3ckwA           SAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPP--------------------------
3dkfA           QKFTTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRR--------------------------
3bceA           RKFTHQSDVWSYGVTIWELMTF--GGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYMVMVKCWMIDAD
3a5cA           YEAGKVITLGGEEGAVTIVGAVSPPGGDMSEPVTQSTLRIVGAF--------------------------
2b5mA           GRHVKTYEVSLREKEFNKGPWKQENV--------------------------------------------
3comB           IGYNCVADIWSLGITAIEMAEGKPPYADIH----------------------------------------
3cq9B           ----------------------------------------------------------------------
2cgxA           EFHAEPVDVWSCGIVLTAMLAGELPWDQPSD-SCQEYSDWKEKKTYLNPWKKIDSAPLALLHKILVENPS
2c3jA           EFHAEPVDVWSCGIVLTAMLAGELPWDQPSD-SCQEYSDWKEKKTYLNPWKKIDSAPLALLHKILVENPS
2ae4A           LPVS-GADVVAHAHRLMNFLYVASPGR-------------------------------------------
1e8xA           KAYLALRHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGK---SEEDAKKYFLDQIEVCRDKGWT
1e8wA           KTSLHFQKFQDVCVKAYLALRHHTNLLII-----------------------------------------
3e59C           LVRIGDAHISAYQDALRLMIEEIGAT--------------------------------------------
1a0eA           KPLKDHVAFWHTFVNEGRDPFGDPTADRPWNRYTDPMDKAFARVDALFEFCEKLNIEYFCFHD-------
2ckoA           RKYPTKKHFISSYLPAFQNDFENLSTEEKSIIKEEMLLEVNRFALASHFLWGLWSIVQAKISSIEFGYMD
3dyhA           DRPFLQDLLCRFNRVDYTTAVGQLYD--------------------------------------------
3dajA           ---DEKVDLWSLGVLCYEFLVGMPPFEAHTYQETYRRISRVEFT----FPDFVTEGARDLISRLLKHNAS
2bfxB           KTHDEKVDLWCAGVLCYEFLVGMPPFDSPS----------------------------------------
2a1sB           RKRREQNDAVGFSRVIHAIANSGKLV--------------------------------------------
2chxA           -------HTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKN----EEDAKKYFLDQIEVCRDKGWT
3c4yB           EEYDFSVDYFALGVTLYEMIAARGPFRA------------------------------------------
2bmcA           LCYEFLVGKPPFEANTYQETYKRISRVPDFVTEGARDLISRLLKHNPSQRPMLREVLE------------
2ckqA           ANIRKYPTKKQQLHFISSYLPAFQNDFENLSTEEKSIIKEELEVNRFALASHFLWGLWSIVQAKISSIEF
3bhhD           EAYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLINQMLTINPA
3dlxA           GVKGLTAVNFGLGLLLRSKQIKRMVSSYVGENAEFERQYLSGELEVELTPQG------------------
1b5eA           VVNMFRNDYAWQKYVLDKLVSDLNAGD-------------------------------------------
3bboU           ----------------------------------------------------------------------
2brmA           AEPVDVWSCGIVLTAMLAGELPWDQPSDSCQEYSDWKEKKTYLN--------------------------
2a19C           KPEDRPNSEILRTLTVW-----------------------------------------------------
3dlxB           GVKGLTADNFGLGLLLRSKQIKRMVSSYVGENAEFERQYLSGELEVELTPQG------------------
3dplC           ----------------------------------------------------------------------
2a97A           YEYTFNESFIADPAISLAHELIHALHGLYGARGVTYEETIPIRLEEFLTFGGQD----------------
3c0iA           ----------------------------------------------------------------------
3cs9D           NKFSIKSDVWAFGVLLWEIATYGMSPY-------------------------------------------
3dk7B           NKFSIKSDVWAFGVLLWEIATYGMSPYP------------------------------------------
3dlxC           VSNNAGVDNFGLGLLLRSKQIKRMVS--------------------------------------------
2bcjA           VAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKD-KHEIDRMTLTMAVELPDSFSPELRSLLEGLLQRDVN
2cunA           TAEKYREILMKARIIVANGPMG------------------------------------------------
3c0gA           ----------------------------------------------------------------------
3c5yH           GAVVTGGTGGSLAANAPGVFCGLV----------------------------------------------
248lA           YNQTPNRKRVITTFR-------------------------------------------------------
2b8uA           -----KCDITLQEIIKTLNSLEQKTLCTELTVTDIFAASKNETFCRAATVLRQFYSHHEKDTRCLGATAQ
3ck8A           DENENAMQEIILPI--------------------------------------------------------
1b5dA           RSNDVRNDYAWQKYVLDKLVSDLNAGDST-----------------------------------------
2bmcB           EFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISRLL---KHNPSQRPMLREVLEHPWITANS
3dkgA           QKFTTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRR--------------------------


                         +         .         .         .         .         *         .:210
query           NRYRSVSEMYVDLSSSLSYNRRNESKLIFDETSKADTKTLPKVSQSTLTSIPKVQAQTExxxxxxxxxxx
3c5iA           QRLKMYDDQ-------------------------------------------------------------
3dbsA           VQF-------------------------------------------------------------------
3dk6A           ----------------------------------------------------------------------
2bkkA           ----------------------------------------------------------------------
3csfA           VQ--------------------------------------------------------------------
2e2bA           ----------------------------------------------------------------------
3e87A           ----------------------------------------------------------------------
3dxpA           EYAKKAKQ--------------------------------------------------------------
2c47C           ----------------------------------------------------------------------
1cdkA           KRFGNLKDGVNDIDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKE-----------
2advA           ----------------------------------------------------------------------
3cqzH           ----------------------------------------------------------------------
3c5yA           ----------------------------------------------------------------------
3dndA           KRFGNLKDGVNDIKNHKWFATTDWIAIY---QRKVEAPFIPKFKGPGDTS--------------------
3ei1A           ----------------------------------------------------------------------
3c9wA           ----------------------------------------------------------------------
2bvaA           ----------------------------------------------------------------------
2bkkC           ----------------------------------------------------------------------
3blrA           LKAYVRDPYALDLIDKL-----------------------------------------------------
2ckpB           RK--------------------------------------------------------------------
3byvA           ----------------------------------------------------------------------
1cmkE           ----------------------------------------------------------------------
3c5yL           ----------------------------------------------------------------------
2ckoB           FGYMDYAQ--------------------------------------------------------------
3c5yE           RKNRGILRELKDA---------------------------------------------------------
3csvA           ----------------------------------------------------------------------
1apmE           ----------------------------------------------------------------------
2chwA           VQF-------------------------------------------------------------------
3e3pA           ----------------------------------------------------------------------
3c5yB           ----------------------------------------------------------------------
3e8cE           ----------------------------------------------------------------------
3c5yF           ----------------------------------------------------------------------
1e7uA           ----------------------------------------------------------------------
3bhhB           KR--------------------------------------------------------------------
2e2bB           DRP-SFAEIHQAFETMF-----------------------------------------------------
2c47A           ----------------------------------------------------------------------
2bmcF           SK--------------------------------------------------------------------
3cq9D           ----------------------------------------------------------------------
3cg2A           KR--------------------------------------------------------------------
2dwbA           ----------------------------------------------------------------------
1e7vA           ----------------------------------------------------------------------
3bl3A           ----------------------------------------------------------------------
3cuqA           ----------------------------------------------------------------------
3e5aA           ----------------------------------------------------------------------
3bhhC           KRI-------------------------------------------------------------------
2eb3A           ----------------------------------------------------------------------
3e93A           MNF-------------------------------------------------------------------
3da6A           ----------------------------------------------------------------------
3dxnA           KR--------------------------------------------------------------------
3ckwA           ----------------------------------------------------------------------
3dkfA           ----------------------------------------------------------------------
3bceA           SR--------------------------------------------------------------------
3a5cA           ----------------------------------------------------------------------
2b5mA           ----------------------------------------------------------------------
3comB           ----------------------------------------------------------------------
3cq9B           ----------------------------------------------------------------------
2cgxA           AR--------------------------------------------------------------------
2c3jA           ARI-------------------------------------------------------------------
2ae4A           ----------------------------------------------------------------------
1e8xA           VQF-------------------------------------------------------------------
1e8wA           ----------------------------------------------------------------------
3e59C           ----------------------------------------------------------------------
1a0eA           ----------------------------------------------------------------------
2ckoA           YAQARFDAYF------------------------------------------------------------
3dyhA           ----------------------------------------------------------------------
3dajA           QR--------------------------------------------------------------------
2bfxB           ----------------------------------------------------------------------
2a1sB           ----------------------------------------------------------------------
2chxA           VQF-------------------------------------------------------------------
3c4yB           ----------------------------------------------------------------------
2bmcA           ----------------------------------------------------------------------
2ckqA           GYMDYAQARF------------------------------------------------------------
3bhhD           KR--------------------------------------------------------------------
3dlxA           ----------------------------------------------------------------------
1b5eA           ----------------------------------------------------------------------
3bboU           ----------------------------------------------------------------------
2brmA           ----------------------------------------------------------------------
2a19C           ----------------------------------------------------------------------
3dlxB           ----------------------------------------------------------------------
3dplC           ----------------------------------------------------------------------
2a97A           ----------------------------------------------------------------------
3c0iA           ----------------------------------------------------------------------
3cs9D           ----------------------------------------------------------------------
3dk7B           ----------------------------------------------------------------------
3dlxC           ----------------------------------------------------------------------
2bcjA           RRLGCLGRGAQEVKESPFFRSLDWQMV-------------------------------------------
2cunA           ----------------------------------------------------------------------
3c0gA           ----------------------------------------------------------------------
3c5yH           ----------------------------------------------------------------------
248lA           ----------------------------------------------------------------------
2b8uA           QFH-RHKQLIRFLLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS--------------------
3ck8A           ----------------------------------------------------------------------
1b5dA           ----------------------------------------------------------------------
2bmcB           SK--------------------------------------------------------------------
3dkgA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3c5iA           ----------------------------------------------------------------------
3dbsA           ----------------------------------------------------------------------
3dk6A           ----------------------------------------------------------------------
2bkkA           ----------------------------------------------------------------------
3csfA           ----------------------------------------------------------------------
2e2bA           ----------------------------------------------------------------------
3e87A           ----------------------------------------------------------------------
3dxpA           ----------------------------------------------------------------------
2c47C           ----------------------------------------------------------------------
1cdkA           ----------------------------------------------------------------------
2advA           ----------------------------------------------------------------------
3cqzH           ----------------------------------------------------------------------
3c5yA           ----------------------------------------------------------------------
3dndA           ----------------------------------------------------------------------
3ei1A           ----------------------------------------------------------------------
3c9wA           ----------------------------------------------------------------------
2bvaA           ----------------------------------------------------------------------
2bkkC           ----------------------------------------------------------------------
3blrA           ----------------------------------------------------------------------
2ckpB           ----------------------------------------------------------------------
3byvA           ----------------------------------------------------------------------
1cmkE           ----------------------------------------------------------------------
3c5yL           ----------------------------------------------------------------------
2ckoB           ----------------------------------------------------------------------
3c5yE           ----------------------------------------------------------------------
3csvA           ----------------------------------------------------------------------
1apmE           ----------------------------------------------------------------------
2chwA           ----------------------------------------------------------------------
3e3pA           ----------------------------------------------------------------------
3c5yB           ----------------------------------------------------------------------
3e8cE           ----------------------------------------------------------------------
3c5yF           ----------------------------------------------------------------------
1e7uA           ----------------------------------------------------------------------
3bhhB           ----------------------------------------------------------------------
2e2bB           ----------------------------------------------------------------------
2c47A           ----------------------------------------------------------------------
2bmcF           ----------------------------------------------------------------------
3cq9D           ----------------------------------------------------------------------
3cg2A           ----------------------------------------------------------------------
2dwbA           ----------------------------------------------------------------------
1e7vA           ----------------------------------------------------------------------
3bl3A           ----------------------------------------------------------------------
3cuqA           ----------------------------------------------------------------------
3e5aA           ----------------------------------------------------------------------
3bhhC           ----------------------------------------------------------------------
2eb3A           ----------------------------------------------------------------------
3e93A           ----------------------------------------------------------------------
3da6A           ----------------------------------------------------------------------
3dxnA           ----------------------------------------------------------------------
3ckwA           ----------------------------------------------------------------------
3dkfA           ----------------------------------------------------------------------
3bceA           ----------------------------------------------------------------------
3a5cA           ----------------------------------------------------------------------
2b5mA           ----------------------------------------------------------------------
3comB           ----------------------------------------------------------------------
3cq9B           ----------------------------------------------------------------------
2cgxA           ----------------------------------------------------------------------
2c3jA           ----------------------------------------------------------------------
2ae4A           ----------------------------------------------------------------------
1e8xA           ----------------------------------------------------------------------
1e8wA           ----------------------------------------------------------------------
3e59C           ----------------------------------------------------------------------
1a0eA           ----------------------------------------------------------------------
2ckoA           ----------------------------------------------------------------------
3dyhA           ----------------------------------------------------------------------
3dajA           ----------------------------------------------------------------------
2bfxB           ----------------------------------------------------------------------
2a1sB           ----------------------------------------------------------------------
2chxA           ----------------------------------------------------------------------
3c4yB           ----------------------------------------------------------------------
2bmcA           ----------------------------------------------------------------------
2ckqA           ----------------------------------------------------------------------
3bhhD           ----------------------------------------------------------------------
3dlxA           ----------------------------------------------------------------------
1b5eA           ----------------------------------------------------------------------
3bboU           ----------------------------------------------------------------------
2brmA           ----------------------------------------------------------------------
2a19C           ----------------------------------------------------------------------
3dlxB           ----------------------------------------------------------------------
3dplC           ----------------------------------------------------------------------
2a97A           ----------------------------------------------------------------------
3c0iA           ----------------------------------------------------------------------
3cs9D           ----------------------------------------------------------------------
3dk7B           ----------------------------------------------------------------------
3dlxC           ----------------------------------------------------------------------
2bcjA           ----------------------------------------------------------------------
2cunA           ----------------------------------------------------------------------
3c0gA           ----------------------------------------------------------------------
3c5yH           ----------------------------------------------------------------------
248lA           ----------------------------------------------------------------------
2b8uA           ----------------------------------------------------------------------
3ck8A           ----------------------------------------------------------------------
1b5dA           ----------------------------------------------------------------------
2bmcB           ----------------------------------------------------------------------
3dkgA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3c5iA           ----------------------------------------------------------------------
3dbsA           ----------------------------------------------------------------------
3dk6A           ----------------------------------------------------------------------
2bkkA           ----------------------------------------------------------------------
3csfA           ----------------------------------------------------------------------
2e2bA           ----------------------------------------------------------------------
3e87A           ----------------------------------------------------------------------
3dxpA           ----------------------------------------------------------------------
2c47C           ----------------------------------------------------------------------
1cdkA           ----------------------------------------------------------------------
2advA           ----------------------------------------------------------------------
3cqzH           ----------------------------------------------------------------------
3c5yA           ----------------------------------------------------------------------
3dndA           ----------------------------------------------------------------------
3ei1A           ----------------------------------------------------------------------
3c9wA           ----------------------------------------------------------------------
2bvaA           ----------------------------------------------------------------------
2bkkC           ----------------------------------------------------------------------
3blrA           ----------------------------------------------------------------------
2ckpB           ----------------------------------------------------------------------
3byvA           ----------------------------------------------------------------------
1cmkE           ----------------------------------------------------------------------
3c5yL           ----------------------------------------------------------------------
2ckoB           ----------------------------------------------------------------------
3c5yE           ----------------------------------------------------------------------
3csvA           ----------------------------------------------------------------------
1apmE           ----------------------------------------------------------------------
2chwA           ----------------------------------------------------------------------
3e3pA           ----------------------------------------------------------------------
3c5yB           ----------------------------------------------------------------------
3e8cE           ----------------------------------------------------------------------
3c5yF           ----------------------------------------------------------------------
1e7uA           ----------------------------------------------------------------------
3bhhB           ----------------------------------------------------------------------
2e2bB           ----------------------------------------------------------------------
2c47A           ----------------------------------------------------------------------
2bmcF           ----------------------------------------------------------------------
3cq9D           ----------------------------------------------------------------------
3cg2A           ----------------------------------------------------------------------
2dwbA           ----------------------------------------------------------------------
1e7vA           ----------------------------------------------------------------------
3bl3A           ----------------------------------------------------------------------
3cuqA           ----------------------------------------------------------------------
3e5aA           ----------------------------------------------------------------------
3bhhC           ----------------------------------------------------------------------
2eb3A           ----------------------------------------------------------------------
3e93A           ----------------------------------------------------------------------
3da6A           ----------------------------------------------------------------------
3dxnA           ----------------------------------------------------------------------
3ckwA           ----------------------------------------------------------------------
3dkfA           ----------------------------------------------------------------------
3bceA           ----------------------------------------------------------------------
3a5cA           ----------------------------------------------------------------------
2b5mA           ----------------------------------------------------------------------
3comB           ----------------------------------------------------------------------
3cq9B           ----------------------------------------------------------------------
2cgxA           ----------------------------------------------------------------------
2c3jA           ----------------------------------------------------------------------
2ae4A           ----------------------------------------------------------------------
1e8xA           ----------------------------------------------------------------------
1e8wA           ----------------------------------------------------------------------
3e59C           ----------------------------------------------------------------------
1a0eA           ----------------------------------------------------------------------
2ckoA           ----------------------------------------------------------------------
3dyhA           ----------------------------------------------------------------------
3dajA           ----------------------------------------------------------------------
2bfxB           ----------------------------------------------------------------------
2a1sB           ----------------------------------------------------------------------
2chxA           ----------------------------------------------------------------------
3c4yB           ----------------------------------------------------------------------
2bmcA           ----------------------------------------------------------------------
2ckqA           ----------------------------------------------------------------------
3bhhD           ----------------------------------------------------------------------
3dlxA           ----------------------------------------------------------------------
1b5eA           ----------------------------------------------------------------------
3bboU           ----------------------------------------------------------------------
2brmA           ----------------------------------------------------------------------
2a19C           ----------------------------------------------------------------------
3dlxB           ----------------------------------------------------------------------
3dplC           ----------------------------------------------------------------------
2a97A           ----------------------------------------------------------------------
3c0iA           ----------------------------------------------------------------------
3cs9D           ----------------------------------------------------------------------
3dk7B           ----------------------------------------------------------------------
3dlxC           ----------------------------------------------------------------------
2bcjA           ----------------------------------------------------------------------
2cunA           ----------------------------------------------------------------------
3c0gA           ----------------------------------------------------------------------
3c5yH           ----------------------------------------------------------------------
248lA           ----------------------------------------------------------------------
2b8uA           ----------------------------------------------------------------------
3ck8A           ----------------------------------------------------------------------
1b5dA           ----------------------------------------------------------------------
2bmcB           ----------------------------------------------------------------------
3dkgA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3c5iA           ----------------------------------------------------------------------
3dbsA           ----------------------------------------------------------------------
3dk6A           ----------------------------------------------------------------------
2bkkA           ----------------------------------------------------------------------
3csfA           ----------------------------------------------------------------------
2e2bA           ----------------------------------------------------------------------
3e87A           ----------------------------------------------------------------------
3dxpA           ----------------------------------------------------------------------
2c47C           ----------------------------------------------------------------------
1cdkA           ----------------------------------------------------------------------
2advA           ----------------------------------------------------------------------
3cqzH           ----------------------------------------------------------------------
3c5yA           ----------------------------------------------------------------------
3dndA           ----------------------------------------------------------------------
3ei1A           ----------------------------------------------------------------------
3c9wA           ----------------------------------------------------------------------
2bvaA           ----------------------------------------------------------------------
2bkkC           ----------------------------------------------------------------------
3blrA           ----------------------------------------------------------------------
2ckpB           ----------------------------------------------------------------------
3byvA           ----------------------------------------------------------------------
1cmkE           ----------------------------------------------------------------------
3c5yL           ----------------------------------------------------------------------
2ckoB           ----------------------------------------------------------------------
3c5yE           ----------------------------------------------------------------------
3csvA           ----------------------------------------------------------------------
1apmE           ----------------------------------------------------------------------
2chwA           ----------------------------------------------------------------------
3e3pA           ----------------------------------------------------------------------
3c5yB           ----------------------------------------------------------------------
3e8cE           ----------------------------------------------------------------------
3c5yF           ----------------------------------------------------------------------
1e7uA           ----------------------------------------------------------------------
3bhhB           ----------------------------------------------------------------------
2e2bB           ----------------------------------------------------------------------
2c47A           ----------------------------------------------------------------------
2bmcF           ----------------------------------------------------------------------
3cq9D           ----------------------------------------------------------------------
3cg2A           ----------------------------------------------------------------------
2dwbA           ----------------------------------------------------------------------
1e7vA           ----------------------------------------------------------------------
3bl3A           ----------------------------------------------------------------------
3cuqA           ----------------------------------------------------------------------
3e5aA           ----------------------------------------------------------------------
3bhhC           ----------------------------------------------------------------------
2eb3A           ----------------------------------------------------------------------
3e93A           ----------------------------------------------------------------------
3da6A           ----------------------------------------------------------------------
3dxnA           ----------------------------------------------------------------------
3ckwA           ----------------------------------------------------------------------
3dkfA           ----------------------------------------------------------------------
3bceA           ----------------------------------------------------------------------
3a5cA           ----------------------------------------------------------------------
2b5mA           ----------------------------------------------------------------------
3comB           ----------------------------------------------------------------------
3cq9B           ----------------------------------------------------------------------
2cgxA           ----------------------------------------------------------------------
2c3jA           ----------------------------------------------------------------------
2ae4A           ----------------------------------------------------------------------
1e8xA           ----------------------------------------------------------------------
1e8wA           ----------------------------------------------------------------------
3e59C           ----------------------------------------------------------------------
1a0eA           ----------------------------------------------------------------------
2ckoA           ----------------------------------------------------------------------
3dyhA           ----------------------------------------------------------------------
3dajA           ----------------------------------------------------------------------
2bfxB           ----------------------------------------------------------------------
2a1sB           ----------------------------------------------------------------------
2chxA           ----------------------------------------------------------------------
3c4yB           ----------------------------------------------------------------------
2bmcA           ----------------------------------------------------------------------
2ckqA           ----------------------------------------------------------------------
3bhhD           ----------------------------------------------------------------------
3dlxA           ----------------------------------------------------------------------
1b5eA           ----------------------------------------------------------------------
3bboU           ----------------------------------------------------------------------
2brmA           ----------------------------------------------------------------------
2a19C           ----------------------------------------------------------------------
3dlxB           ----------------------------------------------------------------------
3dplC           ----------------------------------------------------------------------
2a97A           ----------------------------------------------------------------------
3c0iA           ----------------------------------------------------------------------
3cs9D           ----------------------------------------------------------------------
3dk7B           ----------------------------------------------------------------------
3dlxC           ----------------------------------------------------------------------
2bcjA           ----------------------------------------------------------------------
2cunA           ----------------------------------------------------------------------
3c0gA           ----------------------------------------------------------------------
3c5yH           ----------------------------------------------------------------------
248lA           ----------------------------------------------------------------------
2b8uA           ----------------------------------------------------------------------
3ck8A           ----------------------------------------------------------------------
1b5dA           ----------------------------------------------------------------------
2bmcB           ----------------------------------------------------------------------
3dkgA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3c5iA           ----------------------------------------------------------------------
3dbsA           ----------------------------------------------------------------------
3dk6A           ----------------------------------------------------------------------
2bkkA           ----------------------------------------------------------------------
3csfA           ----------------------------------------------------------------------
2e2bA           ----------------------------------------------------------------------
3e87A           ----------------------------------------------------------------------
3dxpA           ----------------------------------------------------------------------
2c47C           ----------------------------------------------------------------------
1cdkA           ----------------------------------------------------------------------
2advA           ----------------------------------------------------------------------
3cqzH           ----------------------------------------------------------------------
3c5yA           ----------------------------------------------------------------------
3dndA           ----------------------------------------------------------------------
3ei1A           ----------------------------------------------------------------------
3c9wA           ----------------------------------------------------------------------
2bvaA           ----------------------------------------------------------------------
2bkkC           ----------------------------------------------------------------------
3blrA           ----------------------------------------------------------------------
2ckpB           ----------------------------------------------------------------------
3byvA           ----------------------------------------------------------------------
1cmkE           ----------------------------------------------------------------------
3c5yL           ----------------------------------------------------------------------
2ckoB           ----------------------------------------------------------------------
3c5yE           ----------------------------------------------------------------------
3csvA           ----------------------------------------------------------------------
1apmE           ----------------------------------------------------------------------
2chwA           ----------------------------------------------------------------------
3e3pA           ----------------------------------------------------------------------
3c5yB           ----------------------------------------------------------------------
3e8cE           ----------------------------------------------------------------------
3c5yF           ----------------------------------------------------------------------
1e7uA           ----------------------------------------------------------------------
3bhhB           ----------------------------------------------------------------------
2e2bB           ----------------------------------------------------------------------
2c47A           ----------------------------------------------------------------------
2bmcF           ----------------------------------------------------------------------
3cq9D           ----------------------------------------------------------------------
3cg2A           ----------------------------------------------------------------------
2dwbA           ----------------------------------------------------------------------
1e7vA           ----------------------------------------------------------------------
3bl3A           ----------------------------------------------------------------------
3cuqA           ----------------------------------------------------------------------
3e5aA           ----------------------------------------------------------------------
3bhhC           ----------------------------------------------------------------------
2eb3A           ----------------------------------------------------------------------
3e93A           ----------------------------------------------------------------------
3da6A           ----------------------------------------------------------------------
3dxnA           ----------------------------------------------------------------------
3ckwA           ----------------------------------------------------------------------
3dkfA           ----------------------------------------------------------------------
3bceA           ----------------------------------------------------------------------
3a5cA           ----------------------------------------------------------------------
2b5mA           ----------------------------------------------------------------------
3comB           ----------------------------------------------------------------------
3cq9B           ----------------------------------------------------------------------
2cgxA           ----------------------------------------------------------------------
2c3jA           ----------------------------------------------------------------------
2ae4A           ----------------------------------------------------------------------
1e8xA           ----------------------------------------------------------------------
1e8wA           ----------------------------------------------------------------------
3e59C           ----------------------------------------------------------------------
1a0eA           ----------------------------------------------------------------------
2ckoA           ----------------------------------------------------------------------
3dyhA           ----------------------------------------------------------------------
3dajA           ----------------------------------------------------------------------
2bfxB           ----------------------------------------------------------------------
2a1sB           ----------------------------------------------------------------------
2chxA           ----------------------------------------------------------------------
3c4yB           ----------------------------------------------------------------------
2bmcA           ----------------------------------------------------------------------
2ckqA           ----------------------------------------------------------------------
3bhhD           ----------------------------------------------------------------------
3dlxA           ----------------------------------------------------------------------
1b5eA           ----------------------------------------------------------------------
3bboU           ----------------------------------------------------------------------
2brmA           ----------------------------------------------------------------------
2a19C           ----------------------------------------------------------------------
3dlxB           ----------------------------------------------------------------------
3dplC           ----------------------------------------------------------------------
2a97A           ----------------------------------------------------------------------
3c0iA           ----------------------------------------------------------------------
3cs9D           ----------------------------------------------------------------------
3dk7B           ----------------------------------------------------------------------
3dlxC           ----------------------------------------------------------------------
2bcjA           ----------------------------------------------------------------------
2cunA           ----------------------------------------------------------------------
3c0gA           ----------------------------------------------------------------------
3c5yH           ----------------------------------------------------------------------
248lA           ----------------------------------------------------------------------
2b8uA           ----------------------------------------------------------------------
3ck8A           ----------------------------------------------------------------------
1b5dA           ----------------------------------------------------------------------
2bmcB           ----------------------------------------------------------------------
3dkgA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3c5iA           -----------------------------------------------------
3dbsA           -----------------------------------------------------
3dk6A           -----------------------------------------------------
2bkkA           -----------------------------------------------------
3csfA           -----------------------------------------------------
2e2bA           -----------------------------------------------------
3e87A           -----------------------------------------------------
3dxpA           -----------------------------------------------------
2c47C           -----------------------------------------------------
1cdkA           -----------------------------------------------------
2advA           -----------------------------------------------------
3cqzH           -----------------------------------------------------
3c5yA           -----------------------------------------------------
3dndA           -----------------------------------------------------
3ei1A           -----------------------------------------------------
3c9wA           -----------------------------------------------------
2bvaA           -----------------------------------------------------
2bkkC           -----------------------------------------------------
3blrA           -----------------------------------------------------
2ckpB           -----------------------------------------------------
3byvA           -----------------------------------------------------
1cmkE           -----------------------------------------------------
3c5yL           -----------------------------------------------------
2ckoB           -----------------------------------------------------
3c5yE           -----------------------------------------------------
3csvA           -----------------------------------------------------
1apmE           -----------------------------------------------------
2chwA           -----------------------------------------------------
3e3pA           -----------------------------------------------------
3c5yB           -----------------------------------------------------
3e8cE           -----------------------------------------------------
3c5yF           -----------------------------------------------------
1e7uA           -----------------------------------------------------
3bhhB           -----------------------------------------------------
2e2bB           -----------------------------------------------------
2c47A           -----------------------------------------------------
2bmcF           -----------------------------------------------------
3cq9D           -----------------------------------------------------
3cg2A           -----------------------------------------------------
2dwbA           -----------------------------------------------------
1e7vA           -----------------------------------------------------
3bl3A           -----------------------------------------------------
3cuqA           -----------------------------------------------------
3e5aA           -----------------------------------------------------
3bhhC           -----------------------------------------------------
2eb3A           -----------------------------------------------------
3e93A           -----------------------------------------------------
3da6A           -----------------------------------------------------
3dxnA           -----------------------------------------------------
3ckwA           -----------------------------------------------------
3dkfA           -----------------------------------------------------
3bceA           -----------------------------------------------------
3a5cA           -----------------------------------------------------
2b5mA           -----------------------------------------------------
3comB           -----------------------------------------------------
3cq9B           -----------------------------------------------------
2cgxA           -----------------------------------------------------
2c3jA           -----------------------------------------------------
2ae4A           -----------------------------------------------------
1e8xA           -----------------------------------------------------
1e8wA           -----------------------------------------------------
3e59C           -----------------------------------------------------
1a0eA           -----------------------------------------------------
2ckoA           -----------------------------------------------------
3dyhA           -----------------------------------------------------
3dajA           -----------------------------------------------------
2bfxB           -----------------------------------------------------
2a1sB           -----------------------------------------------------
2chxA           -----------------------------------------------------
3c4yB           -----------------------------------------------------
2bmcA           -----------------------------------------------------
2ckqA           -----------------------------------------------------
3bhhD           -----------------------------------------------------
3dlxA           -----------------------------------------------------
1b5eA           -----------------------------------------------------
3bboU           -----------------------------------------------------
2brmA           -----------------------------------------------------
2a19C           -----------------------------------------------------
3dlxB           -----------------------------------------------------
3dplC           -----------------------------------------------------
2a97A           -----------------------------------------------------
3c0iA           -----------------------------------------------------
3cs9D           -----------------------------------------------------
3dk7B           -----------------------------------------------------
3dlxC           -----------------------------------------------------
2bcjA           -----------------------------------------------------
2cunA           -----------------------------------------------------
3c0gA           -----------------------------------------------------
3c5yH           -----------------------------------------------------
248lA           -----------------------------------------------------
2b8uA           -----------------------------------------------------
3ck8A           -----------------------------------------------------
1b5dA           -----------------------------------------------------
2bmcB           -----------------------------------------------------
3dkgA           -----------------------------------------------------