[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for spne4:ACF55228.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3df9A.bssp"
#ERROR : Can't open dsspfile "3df9B.bssp"
#ERROR : Can't open dsspfile "3bl6A.bssp"
#ERROR : Can't open dsspfile "3dp9A.bssp"
#ERROR : Can't open dsspfile "3dp9C.bssp"
#ERROR : Can't open dsspfile "3eeiA.bssp"
#ERROR : Can't open dsspfile "3ddoB.bssp"
#ERROR : Can't open dsspfile "3dpsF.bssp"
#ERROR : Can't open dsspfile "3ddoA.bssp"
#ERROR : Can't open dsspfile "2ac7B.bssp"
#ERROR : Can't open dsspfile "2a8yA.bssp"
#ERROR : Can't open dsspfile "3bsfA.bssp"
#ERROR : Can't open dsspfile "2ai2A.bssp"
#ERROR : Can't open dsspfile "3c74F.bssp"
#ERROR : Can't open dsspfile "1cb0A.bssp"
#ERROR : Can't open dsspfile "2ai3A.bssp"
#ERROR : Can't open dsspfile "3ddoE.bssp"
#ERROR : Can't open dsspfile "1a69C.bssp"
#ERROR : Can't open dsspfile "3e9rB.bssp"
#ERROR : Can't open dsspfile "2bsxA.bssp"
#ERROR : Can't open dsspfile "2ac7A.bssp"
#ERROR : Can't open dsspfile "3c74A.bssp"
#ERROR : Can't open dsspfile "3c74E.bssp"
#ERROR : Can't open dsspfile "3bgsA.bssp"
#ERROR : Can't open dsspfile "1a9oA.bssp"
#ERROR : Can't open dsspfile "3e0qA.bssp"
#ERROR : Can't open dsspfile "1a9qA.bssp"
#ERROR : Can't open dsspfile "2a0wA.bssp"
#ERROR : Can't open dsspfile "2a0xA.bssp"
#ERROR : Can't open dsspfile "3ddoF.bssp"
#ERROR : Can't open dsspfile "3ddoC.bssp"
#ERROR : Can't open dsspfile "1b8oA.bssp"
#ERROR : Can't open dsspfile "3djfB.bssp"
#ERROR : Can't open dsspfile "2a0yA.bssp"
#ERROR : Can't open dsspfile "1b8nA.bssp"
#ERROR : Can't open dsspfile "2b94A.bssp"
#ERROR : Can't open dsspfile "3e9zC.bssp"
#ERROR : Can't open dsspfile "1c3xA.bssp"
#ERROR : Can't open dsspfile "3bjeA.bssp"
#ERROR : Can't open dsspfile "3bldA.bssp"

## Summary of PDB Search
:230
    1e-48  40%  3df9A  [c.56.2 (1nc1A)] MTA/SAH NUCLEOSIDASE
    8e-47  40%  3df9B  [c.56.2 (1nc1B)] MTA/SAH NUCLEOSIDASE
    1e-43  41%  3bl6A  [x.x.x] 5'-METHYLTHIOADENOSINE NUCLEOSIDASE/S-
    7e-43  42%  3dp9A  [x.x.x] MTA/SAH NUCLEOSIDASE
    7e-42  42%  3dp9C  [x.x.x] MTA/SAH NUCLEOSIDASE
    1e-41  39%  3eeiA  [x.x.x] 5-METHYLTHIOADENOSINE NUCLEOSIDASE/S-
    7e-36  17%  3ddoB  [x.x.x] URIDINE PHOSPHORYLASE
    1e-35  20%  3dpsF  [x.x.x] URIDINE PHOSPHORYLASE
    2e-35  19%  3ddoA  [x.x.x] URIDINE PHOSPHORYLASE
    2e-33  19%  2ac7B  [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE
    3e-33  14%  2a8yA  [x.x.x] 5'-METHYLTHIOADENOSINE PHOSPHORYLASE (MTAP)
    5e-32  20%  3bsfA  [x.x.x] AT4G34840
    1e-31  11%  2ai2A  [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE
    7e-31  18%  3c74F  [x.x.x] URIDINE PHOSPHORYLASE
    7e-31  15%  1cb0A  [c.56.2] PROTEIN (5'-DEOXY-5'-METHYLTHIOADENOSINE
    2e-30  10%  2ai3A  [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE
    5e-30  17%  3ddoE  [x.x.x] URIDINE PHOSPHORYLASE
    8e-30  20%  1a69C  [c.56.2] PURINE NUCLEOSIDE PHOSPHORYLASE
    1e-29  12%  3e9rB  [x.x.x] PURINE-NUCLEOSIDE PHOSPHORYLASE
    1e-29  13%  2bsxA  [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE
    3e-29  19%  2ac7A  [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE
    3e-29  18%  3c74A  [x.x.x] URIDINE PHOSPHORYLASE
    3e-28  19%  3c74E  [x.x.x] URIDINE PHOSPHORYLASE
    2e-27  12%  3bgsA  [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE
    4e-27  12%  1a9oA  [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE
    6e-27  10%  3e0qA  [x.x.x] PURINE-NUCLEOSIDE PHOSPHORYLASE
    8e-27  12%  1a9qA  [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE
    1e-26  12%  2a0wA  [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE
    3e-26  12%  2a0xA  [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE
    4e-26  20%  3ddoF  [x.x.x] URIDINE PHOSPHORYLASE
    9e-26  20%  3ddoC  [x.x.x] URIDINE PHOSPHORYLASE
    4e-25  12%  1b8oA  [c.56.2] PURINE NUCLEOSIDE PHOSPHORYLASE
    5e-25  14%  3djfB  [x.x.x] PURINE-NUCLEOSIDE PHOSPHORYLASE
    7e-25  12%  2a0yA  [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE
    5e-23  15%  1b8nA  [c.56.2] PURINE NUCLEOSIDE PHOSPHORYLASE
    9e-14  13%  2b94A  [x.x.x] PURINE NUCLEOSIDE PHOSPHORYLASE
    5e-09  16%  3e9zC  [x.x.x] PURINE-NUCLEOSIDE PHOSPHORYLASE
    5e-06  12%  1c3xA  [c.56.2] PENTOSYLTRANSFERASE
    5e-05  15%  3bjeA  [x.x.x] NUCLEOSIDE PHOSPHORYLASE, PUTATIVE
    1e-04  28%  3bldA  [x.x.x] QUEUINE TRNA-RIBOSYLTRANSFERASE
:230

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKIGIIAAMPEELAYLVQHLDNAQEQVVLGNTYHTGTIASHEVVLVESGIGKVMSAMSVAILADHFQVDA
3df9A           MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDV
3df9B           MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDV
3bl6A           MMIGIIGAMEEEVTILKNKLTQLSEISVAHVKFYTGILKDREVVITQSGIGKVNAAISTTLLINKFKPDV
3dp9A           -KIGIIGAMQQEVAILKDLIEDVQEVNQAGCTFYSGQIQGVDVVLLQSGIGKVSAALGTALLISQYAPDV
3dp9C           MKIGIIGAMQQEVAILKDLIEDVQEVNQAGCTFYSGQIQGVDVVLLQSGIGKVSAALGTALLISQYAPDV
3eeiA           -TVAVIGAMEQEIELLREMMENVKAVSFGRFSAYEGELAGKRMVLALSGIGKVNAAVATAWIIREFAADC
3ddoB           -QLAIVPGDPERVEKIAALMDKPVKLAHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEELA-QLGIRT
3dpsF           -QLAIVPGDPERVEKIAALMDKPVKLAHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEELA-QLGIRT
3ddoA           -QLAIVPGDPERVEKIAALMDKPVKLAHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEELA-QLGIRT
2ac7B           -ESILLPGDPLRAKYIAETFLEDVTCYVRGMLGFTGTYKGKRVSVQGTGMGVPSISIYVNELIQSYGVKN
2a8yA           -SIGIIGGSGLYPGIFSESKEIKVYTPQPSDFITIGKIGNKSVALPRHGRGHRIPPHKINYRAKELGVRW
3bsfA           STIVFIVAMQKEAQPLINRLRLVEEVNTYKDLNINIVCPGKDSTLGVESVGTVPASLVTYASILAIQPDL
2ai2A           PQVAVIGGLVNKLTQAQTFDYSEIPNFPESGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFRLLGVET
3c74F           -QLAIVPGDPERVEKIAALMDKPVKASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEELA-QLGIRT
1cb0A           VKIGIIGGTGLDDPEILEGRTEKYVDTPFGDALILGKIKNVDCVLARHGRQHTIMPSKVNYALKEEGCTH
2ai3A           PQVAVIGGLVNKLTQAQTFDYSEIPNFPESGRLVFGILNGRACVMMQGYEGYPFWKVTFPVRFRLLGVET
3ddoE           AQLAIVPGDPERVEKIAALMDKPVKLAHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEELA-QLGIRT
1a69C           -DVVLMPGDPLRAKYIAETFLEDAREVVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKK
3e9rB           -EIGIICGSGDGVKDKITIPYTKIPNFPQSGNLIFGTLSGRKVVVMQEGYSNDTVALPIRVMK-LLGVKI
2bsxA           -PVVLVVGDPGRVDKIKVVCDSYVDLAYNREKSVECHYKGQKFLCVSHGVGSAGCAVCFEELC-QNGAKV
2ac7A           -ESILLPGDPLRAKYIAETFLEDVTCYVRGMLGFTGTYKGKRVSVQGTGMGVPSISIYVNELIQSYGVKN
3c74A           -QLAIVPGDPERVEKIAALMDKPVKASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEELA-QLGIRT
3c74E           -QLAIVPGDPERVEKIAALMDKPVKLAHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEELA-QLGIRT
3bgsA           ---GLTDKLTQAQIFDYSEIPNFPRSTVPGGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVVFHLLGVDT
1a9oA           ---GLVNKLTQAQTFDYSEIPNFPESTVPGGRLVFGILNGRACVMMQGRFHMYEKVTFPVRVFRLLGVET
3e0qA           ---KLADGVKDKITIPYTKIPNFPQTSH-SGNLIFGTLSGRKVVVMQGRFYSNDTVALPIRVMKLLGVKI
1a9qA           ---GLVNKLTQAQTFDYSEIPNFPESTVPGGRLVFGILNGRACVMMQGRFHMYEGYPFWKVVFRLLGVET
2a0wA           ---GLTDKLTQAQIFDYSEIPNFPRSTVPGGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVVFHLLGVDT
2a0xA           ---GLTDKLTQAQIFDYSEIPNFPRSTVPGGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVVFHLLGVDT
3ddoF           -QLAIVPGDPERVEKIAALMDKPVKLAHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEELA-QLGIRT
3ddoC           -QLAIVPGDPERVEKIAALMDKPVKLAHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEELA-QLGIRT
1b8oA           ---GLVNKLTQAQTFDYSEIPNFPESTVPGGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFRLLGVET
3djfB           PEIGIIDGVKDKITIPYTKIPNFPQTSVVGGNLIFGTLSGRKVVVMYEGYSNDTVALPIRVM-KLLGVKI
2a0yA           ---GLTDKLTQAQIFDYSEIPNFPRSTVPGGRLVFGFLNGRACVMMQGRFHMYEKVTFPVRVFHLLGVDT
1b8nA           ---GLVNKLTQAQTFDYSEIPNFPESTVPGGRLVFGILNGRACVMMQGRFHMYEKVTFPVRVFRLLGVET
2b94A           -PVVLVVGDPGRVDKVKMLCDSYVDLA--EYKSVECTYKGQKFLCVSHGVGSAGCAICFEELM-NNGAKV
3e9zC           -EIGIIDGVKDKITIPYTKIPNFPQTSVVGHSLIFGTLSGRKVVVMQGGYSNDTVALPIRVMK-LLGVKI
1c3xA           -------------------------------SIRVERADGSVRHALVLGSRTVRAVVHGVRTAAATGAET
3bjeA           ----------------------------------------------------------------------
3bldA           -----------------ETVRATGADIILGNTYHLMLRPGAERIAKLGGLHSFMGWDR-PILTDGFQVMS


                         .         .         *         .         .         .         .:140
query           LINTGSAGAVAEGIAVGDVVIADKLAYHDVDVTAFGYAYGQMAQQPLYFESDKTFVAQIQESLSQLDQNW
3df9A           IINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAEACIAELNLNA
3df9B           IINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLPGCPAGFKADDKLIAAAEACIAELNLNA
3bl6A           IINTGSAGALDESLNVGDVLISDDVKYHDADATAFGYEYGQIPQMPVAFQSSKPLIEKVSQVVQQQQLTA
3dp9A           VINTGSAGGFDASLNVGDVVISSEVRHHDADVTAFGYEIGQMAGQPAAFKADEKLMTVAEQALAQLPNTA
3dp9C           VINTGSAGGFDASLNVGDVVISSEVRHHDADVTAFGYEIGQMAGQPAAFKADEKLMTVAEQALAQLPTHA
3eeiA           VINTGSAGGLGKGLKVGDVVIGTETAHHDVDVTAFGYAWGQVPQLPARFASDGILIEAAKRAARTFEAAV
3ddoB           FLRIGTTGAIQPHINVGDVLVTTASVRL--DGASLHFAPMEFPAVA-----DFACTTALVEAAKSIGATT
3dpsF           FLRIGTTGAIQPHINVGDVLVTTASVRL--DGASLHFAPMEFPAVA-----DFACTTALVEAAKSIGATT
3ddoA           FLRIGTTGAIQPHINVGDVLVTTASVRL--DGASLHFAPMEFPAVA-----DFACTTALVEAAKSIGATT
2ac7B           LIRVGTCGAIQKDVKVRDVIIAMTACTDS------NMNRLTFPGFDFAPAANFDLLKKAYDAGTEKGLHV
2a8yA           VISVSAVGSLRMDYKLGDFVIPDQFIDMTKNREYSFFDGPVVAHVSMADPFCNSLRKLAIETAKELNIKT
3bsfA           IINAGTAGGFAKGACISDVYVVSTVAFHDRRIPVPVLDIYGVGMRNT-----------FPTPNLIKELNL
2ai2A           LVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSGENPLRGPNEERFGVRFPADRDMRQKAHSTWKQMGEQR
3c74F           FLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPMEFP-------AVADFACTTALVEAAKSIGATT
1cb0A           VIVTTACGSLREEIQPGDIVIIDQFIDRTTMRPQSFYDGSHSCARGVCHIPCPKTREVLIETAKKLGLRC
2ai3A           LVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSGENPLRGPNERFPAMSDAYDRDMRQKAHSTWKQMGEQR
3ddoE           FLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPMEFPAVADF-------ACTTALVEAAKSIGATT
1a69C           IIRVGSCGAVLPHVKLRDVVIGMGACTDS------KVNRIRFKDHDFAAIADFDMVRNAVDAAKALGIDA
3e9rB           LMVSNAAGGLNRSLKLGDFVILKDHIYLPGLGLNNILVGPNQEAFGTRFPADRDLRKLAVQVAEENGFGN
2bsxA           IIRAGSCGSLPDLIKRGDICICNAAVREDRVSHLLIH-------GDFPAVGDFDVYDTLNKCAQELNVPV
2ac7A           LIRVGTCGAIQKDVKVRDVIIAMTACTDS------NMNRLTFPGFDFAPAANFDLLKKAYDAGTEKGLHV
3c74A           FLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPMEFP-------AVADFACTTALVEAAKSIGATT
3c74E           FLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPMEFPAVADFACTTAL-------VEAAKSIGATT
3bgsA           LVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDRFPAMSDAYDRTMRQRALSTWKQMGEQR
1a9oA           LVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSGENPLRGPGVRFPAMSDAYDRDMRQKAHSTWKQEQREL
3e0qA           LMVSNAAGGLNRSLKLGDFVILKDHIYLPGLGLNNILVGPNQEFPALSNAYDRDLRKLAVQVAEENGFGN
1a9qA           LVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSGENPLRGPNERFPAMSDAYDRDMRQKAHSTWKQMGEQR
2a0wA           LVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQR
2a0xA           LVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDRFPAMSDAYDRTMRQRALSTWKQMGEQL
3ddoF           FLRIGTTGAIQPHINVGDVLVTT--ASVRLDGASLHFAPMEFPAVA-----DFACTTALVEAAKSIGATT
3ddoC           FLRIGTTGAIQPHINVGDVLVTT--ASVRLDGASLHFAPMEFPAVA-----DFACTTALVEAAKSIGATT
1b8oA           LVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSGENPLRGPNERFPAMSDAYDRDMRQKAHSTWKQMGEQR
3djfB           LMVSNAAGGLNRSLKLGDFVILKDHIYLPGLGLNNILVGPNTRFPALSNAYDRDLRKLAVQVAEENGFGN
2a0yA           LVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPADRTMRQRALSTWKQMGEQL
1b8nA           LVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSGENPLRGPNEERFGVRFPADRDMRQKAHSTWKQMGEQR
2b94A           IIRAGSCGSLQPQMKRGDICICNAAVREDRVSHLMIYSDFPAVADFEVY-------DTLNKVAQELEVPV
3e9zC           LMVSNAAGGLNRSLKLGDFVILKDHILVGPNQEAFGTRFPALSN-----AYDRDLRKLAVQVAEENGFGV
1c3xA           LILTNGCGGLNQEWGAGTPVLLSDHINLTARSPLEGPTFVDLTDVY----------SPRLRELAHRVDPT
3bjeA           ----------------------------------------------------------------------
3bldA           QSEEG-----------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           HFGLIATGDSFVAGNDKIEAIKSHFPEVLAVEMEGXXXXXXXXXLNLPVLVIRAMSDNANHEANIFFDEF
3df9A           VRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEF
3df9B           VRGLIVSGDAFINGSVGLAKIRHNFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEF
3bl6A           KVGLIVSGDSFIGSVEQRQKIKKAFPNAMAVEMEATAIAQTCYQFNVPFVVVRAVSDLANGEAEMSFEAF
3dp9A           VRGLICTGDAFVCTAERQQFIRQHFPSVVAVEMEASAIAQTCHQFKVPFVVVRAISDVADKESPLSFEEF
3dp9C           VRGLICTGDAFVCTAERQQFIRQHFPSVVAVEMEASAIAQTCHQFKVPFVVVRAISDVADKESPLSFEEF
3eeiA           EQGLIVSGDRFVHSSEGVAEIRKHFPEVKAVEMEAAAIAQTCHQLETPFVIIRAVSDSADEKADISFDEF
3ddoB           HVGVTASSDTFYPGQERYDTYSGRVVRVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPTESHA
3dpsF           HVGVTASSDTFYPGQSMEEWQAM---GVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQEKQTESHA-
3ddoA           HVGVTASSDTFYPGQERYDTYSGRVVRVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQKQTSHAVKI
2ac7B           RVGNVLTADVFYRESMDMVKKLGDYG-VLAVEMETTALYTLAAKYGVNALSVLTVSDHIFQTTFNEMIEI
2a8yA           HESGTYICIEGPRFSTRAERTWREVYKADIIGMTLVPEVNLACEAQMCYATIAMVTDYDVFAEIPVTAEE
3bsfA           KVGRLSTGDSMDMSPHDEESITAND--ATVKDMEGAAVAYVADIFKVPTILIKGVTDIVDGNRPT-SEEF
2ai2A           QEGTYVMLGGPNFETVAECRLLRNL-GADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESQVLEA
3c74F           HVGVTASSDTFYPGQERYDTYSGRVVRVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPNAETM
1cb0A           HSKGTMVTIEGPRFSSRAESFMFRTWGADVINMTTVPEVVLAKEAGICYASIAMATDYDCWAVSDRVLKT
2ai3A           QEGTYVMLGGPNFETVAECRLLRNL-GADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYKANHEEV
3ddoE           HVGVTASSDTFYPGQERYDTYSGRVVRVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQKQT-ESHA
1a69C           RVGNLFSADLFYSPDGEMFDVMEKYG-ILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTTAATTFNDM
3e9rB           HQGVYVMNGGPCYETPAECTMLLNM-GCDVVGMSTIPEVVIARHCGIQVFAVSLVTNISVLDVEEEVLAT
2bsxA           FNGISVSSDMYYPNKIIPSRLEDYKANAAVVEMELATLMVIGTLRKVKTGGILIVDGCPFKWDELQLENM
2ac7A           RVGNVLTADVFYRESMDMVKKLGDYG-VLAVEMETTALYTLAAKYGVNALSVLTVSDHIQTTFNEMIEIA
3c74A           HVGVTASSDTFYPGQERYDTYSGRVVRVMNYEMESATLLTMCASQGLRAGMVAGVIVNRT-QQEIPESHA
3c74E           HVGVTASSDTFYPGQERYDTYSGRVMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRQQEIPSHAVKI
3bgsA           QEGTYVMVAGPSFETVAECRVLQKL-GADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYEANHEEV
1a9oA           QEGTYVMLGGPNFETVAECRLLRNLG-ADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMQGKANHEEV
3e0qA           HQGVYVMNGGPCYETPAECTMLLNM-GCDVVGMSTIPEVVIARHCGIQVFAVSLVTNISVLDVESDVLAT
1a9qA           QEGTYVMLGGPNFETVAECRLLRNL-GADAVGMSTVPEVIVARHCGLRVFGFSLITNKVESQGKANHEEV
2a0wA           QEGTYVMVAGPSFETVAECRVLQKLG-ADAVGMSTVPEVIVARHCGLRVFGFSLITNKVESLEKANGEEV
2a0xA           QEGTYVMVAGPSFETVAECRVLQKLG-ADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMLEKANFEEV
3ddoF           HVGVTASSDTFYPGQERYDTYSGRVVRVMNYEMESATLLTMCASQGLRAGMVAGVIVN------------
3ddoC           HVGVTASSDTFYPGQERYDTYSGRVVRVMNYEMESATLLTMCASQGLRAGMV------------------
1b8oA           QEGTYVMLGGPNFETVAECRLLRNL-GADAVGMSTVPEVIVARHCGLRVFGFSLITNKVESQGKANHEEV
3djfB           LVHYVMNGGPCYETPAECTMLLNMG--CDVVGMSTIPEVVIARHCGIQVFAVSLVTNISVDVESAQRAEL
2a0yA           QEGTYVMVAGPSFETVAECRVLQKLG-ADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYEANDEEV
1b8nA           QEGTYVMLGGPNFETVAECRLLRNL-GADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYEANHEEV
2b94A           FNGISLSSDLYYPHKIIPTRLEDYSKAVAVVEMEVATLMVMGTLRKVKTGGIFIVDGCPLKWNLVPLENM
3e9zC           HQGVYVGGPCYETPAE-CTMLLNM--GCDVVGMSTIPEVVIARHCGIQVFAVSLVTNDVESDLKPNHEE-
1c3xA           LPEGVYAQFPGPHYETPAEVRMAGILGADLVGMSTTLEAIAARHCGLEVLGVSLVTNLAAGISPTPLSAE
3bjeA           ---------------SLKFNLSNGVEVVTNIEMETSAICYLSDMLGYQAGAACVVVSKRVGEKKMFLGDQ
3bldA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           IIEAGRRSAQVLLTFLKALD
3df9A           LAVAAKQSSLMVESLVQKL-
3df9B           LAVAAKQSSLMVESLVQKL-
3bl6A           LEKAAVSSSQTVEALVSQL-
3dp9A           LPLAAKSSSAMVLKMVELL-
3dp9C           LPLAAKSSSAMVLKMVELL-
3eeiA           LKTAAANSAKMVAEIVKSL-
3ddoB           VKIVVEAARRLL--------
3dpsF           -VKIVVEAARRLL-------
3ddoA           VVEAARR-------------
2ac7B           ALDA----------------
2a8yA           VTRVMAENTEKAKKLLYAL-
3bsfA           LENLAAVTAKLDESLTKVID
2ai2A           GKQAAQKLEQFVSLLMASI-
3c74F           ESHAVKIVVEAARRLL----
1cb0A           LKENANKAKSLLLTTIPQI-
2ai3A           LEAGKQAAQKLEQFVSLLMA
3ddoE           VKIVVEAARRLL--------
1a69C           IKIALESVLLGD--------
3e9rB           GAQRAELMQSWFEKIIEKL-
2bsxA           IKIALGACAKLATKYA----
2ac7A           LDAA----------------
3c74A           VKIVVEAARRLL--------
3c74E           VVEAARR-------------
3bgsA           LKQAAQKLEQFVSILMASI-
1a9oA           LKQAAQKLEQFVSLLMASI-
3e0qA           GAQRAELMQSWFEKIIEKL-
1a9qA           LKQAAQKLEQFVSLLMASI-
2a0wA           LKQAAQKLEQFVSILMASIP
2a0xA           GKQAAQKLEQFVSILMASIP
3ddoF           --------------------
3ddoC           --------------------
1b8oA           LKQAAQKLEQFVSLLMASI-
3djfB           MQSWFEKIIEKLP-------
2a0yA           LKQAAQKLEQFVSILMASIP
1b8nA           -LEAGKQAAQKLEQFVSLL-
2b94A           IKISLETCARLAKKY-----
3e9zC           VLATGAQRAELMQSWFEKI-
1c3xA           VIEAGQAAGPRISALLADI-
3bjeA           LDAAMKRCIKIILEAL----
3bldA           --------------------