[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for spne4:ACF55245.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2a6bA.bssp"
#ERROR : Can't open dsspfile "1dveA.bssp"
#ERROR : Can't open dsspfile "2a2oA.bssp"
#ERROR : Can't open dsspfile "2a2oD.bssp"
#ERROR : Can't open dsspfile "2a2mA.bssp"
#ERROR : Can't open dsspfile "3ddeA.bssp"
#ERROR : Can't open dsspfile "3bjdA.bssp"
#ERROR : Can't open dsspfile "3ddeB.bssp"
#ERROR : Can't open dsspfile "3bjdC.bssp"
#ERROR : Can't open dsspfile "3bjdB.bssp"

## Summary of PDB Search
:230
    3e-29  21%  2a6bA  [x.x.x] HYPOTHETICAL PROTEIN SPR0628
    1e-28  11%  1dveA  [a.132.1] HEME OXYGENASE-1
    6e-28  17%  2a2oA  [x.x.x] HYPOTHETICAL PROTEIN BT3146
    6e-28  18%  2a2oD  [x.x.x] HYPOTHETICAL PROTEIN BT3146
    5e-27  20%  2a2mA  [x.x.x] HYPOTHETICAL PROTEIN BT3146
    1e-25  12%  3ddeA  [x.x.x] TENA/THI-4 PROTEIN, DOMAIN OF UNKNOWN FUNCTION
    3e-24  10%  3bjdA  [x.x.x] PUTATIVE 3-OXOACYL-(ACYL-CARRIER-PROTEIN)
    2e-22  12%  3ddeB  [x.x.x] TENA/THI-4 PROTEIN, DOMAIN OF UNKNOWN FUNCTION
    3e-20  12%  3bjdC  [x.x.x] PUTATIVE 3-OXOACYL-(ACYL-CARRIER-PROTEIN)
    1e-05  11%  3bjdB  [x.x.x] PUTATIVE 3-OXOACYL-(ACYL-CARRIER-PROTEIN)
:230

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MEFTDIAMELSKKAWQASFHHPFILQLQEGNLEPAIFRYYLIQDAYYLKAFSEIYHLLADKTSNQEMKRL
2a6bA           -LTVGELLKSSQKDWQAAINHRFVKELFAGTIENKVLKDYLIQDYHFFDAFLSLGACVAHADKLESKLRF
1dveA           QDLSEALKEATKEVHIRAENSEFMRNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQNPVYAPLYFP
2a2oA           DSLFWKLWNGSLDTAVQVLQTDYFKGIAAGTLDPNAYGSLV-QDGYYCFRGRDDYATAATCAQDETLREF
2a2oD           DSLFWKLWNGSLDTAVQVLQTDYFKGIAAGTLDPNAYGSLV-QDGYYCFRGRDDYATAATCAQDETLREF
2a2mA           DSLFWKLWNGSLDTAVQVLQTDYFKGIAAGTLDPNAYGSLV-QDGYYCFRGRDDYATAATCAQDETLREF
3ddeA           IIDLTKLEQKVATWDSILTNSPFIHEVLDGKATKALYAIY-TETYHYTKHNAKNQALVGIGKDLPGKYLS
3bjdA           ALSEEDFQKRLEQEIAAQERHPSQ-YVFSGSASRAQLQVFLRHQWFRTFRLYRDAADLLVNLTDVDEAAA
3ddeB           IIDLTKLEQKVATWDSILTNSPFIHEVLDGKATKALYAIYT-ETYHYTKHNAKNQALVGIGKDLPGKYLS
3bjdC           --------------AQSRERHPSQ-YVFSGSASRAQLQVFLRHQWFRTFRLYRDAADLLVNLTDVDEAAA
3bjdB           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           LKQNAQGLVEGELFIRQQFFKELEISDQEMEQHPIAPTCYHYISHIYRQFAEPNLAIAFASLLPCPWLYH
2a6bA           AKQ-LGFLEADEDGYFQKAFKELKVAENDYLEVTLHPVTKAFQDLYSAVASSDYA--HLLVLVIAEGLYL
1dveA           EELHRRAALEQDM--------AFWYGPHWQEAIPYTPATQHYVKRLHE-VGGTHPELLVAHAYTRYLGDL
2a2oA           FKAKAKSYDEYNETYHQTWHLR------EASGLIPGTDIKDYADYEAY--VAGSLASPYCVVLPCEYLWP
2a2oD           FKAKAKSYDEYNETYHQTWHLR------EASGLIPGTDIKDYADYEAY--VAGSLASPYCVVLPCEYLWP
2a2mA           FKAKAKSYDEYNETYHQTWHLR------EASGLIPGTDIKDYADYEAY--VAGSLASPYCVVLPCEYLWP
3ddeA           FFHHAHEEAGHELALS--DIASIGFDREDVLSSKPLPATETLIAYLYWISATGNPVQRLGYSYWAENVYG
3bjdA           LARGEEDEKGSHPRLLAKLLEAIGLEADF--QAVSTPEEIAYLNNRARAFRHAEVGWGLAVFYITELVVP
3ddeB           FFHHAHEEAGHELALS--DIASIGFDREDVLSSKPLPATETLIAYLYWISATGNPVQRLGYSYWAENVYG
3bjdC           LARYLYGELGEEKGSHPRLLAKLAIGLEADFQAVSTPEEIAYLNNRARAFRHAEVGWGLAVFYITELVVN
3bjdB           --------------------------------AVSTPEEIAYLNNRARAFRHAEVGWGLAVFYITELVHE


                         +         .         .         .         .         *         .:210
query           DIGKSLNLKPSPNPLYQQWIETYITDELEQQIREEGALVNQLYRESDETDKQKMLDAFHISVHMEAKFWE
2a6bA           DWGSKDLALPEVYI-HSEWINLHRGPFFAEWVQFLVDELNRV--GKNREDLTELQQRWNQAVALELAFFD
1dveA           SGGQVLKKIAQALPSSGEGLAFFTFPSIDNPTKFKQLYRARMNTEMTPEVKHRVTEEAKTAFLLNIELFE
2a2oA           WIANFLDGYTPTNSLYRFWIEWNGGTPNGAYQGNLEQYRDKIDED-------KAVEIF-NTANYELKVFT
2a2oD           WIANFLDGYTPTNSLYRFWIEWNGGTPNGAYQGNLEQYRDKI-------DEDKAVEIF-NTANYELKVFT
2a2mA           WIANFLDGYTPTNSLYRFWIEWNGGT-------PNGAYQGNLEQYRDKIDEDKAVEIF-NTANYELKVFT
3ddeA           YIDPVLKIQSTLDLTPQSKFFIAHSKIDAKHAEEVNELHEVCKTQEDVDSVVAVENSLVLTARILDDVWK
3bjdA           GNHEKLLLQAGLSEDQAEYYKVHISLVPKREWQLIARRIPDV--QFQNAFLTSLSQHFRVERAYYDAIWE
3ddeB           YIDPVLAIQSTLDLTPQSKFFIAHSKIDAKHAEEVNELHEVCKTQEDVDSVVAVENSLVLTARILD-DVW
3bjdC           HLYRALLQAGLSEDQAEYYKVHISLV--PPRAKREWQLIARRIPDVQ--FQNAFLTSLSQHFRVERAYYD
3bjdB           KLYRALLQAGLSEDQAEYYKVHISLVPPR--AKREWQLIARRIP--DVQFQNAFLTSLSQHFRVERAYYD


                         .         .         .         +         .         .         .:280
query           MAYQHQTWKSDxxxxxxxxx
2a6bA           IGY-----------------
1dveA           ELQALLT-------------
2a2oA           SST-----------------
2a2oD           SST-----------------
2a2mA           SST-----------------
3ddeA           EYQLFQS-------------
3bjdA           E-------------------
3ddeB           KEYQLFQSGAS---------
3bjdC           AIWEEQS-------------
3bjdB           AIWEEQS-------------