[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for spne4:ACF55303.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3cg7B.bssp"
#ERROR : Can't open dsspfile "2d5rA.bssp"
#ERROR : Can't open dsspfile "2a1rB.bssp"
#ERROR : Can't open dsspfile "3cg7A.bssp"
#ERROR : Can't open dsspfile "3crw1.bssp"
#ERROR : Can't open dsspfile "3cm5A.bssp"
#ERROR : Can't open dsspfile "2a1sA.bssp"
#ERROR : Can't open dsspfile "1clqA.bssp"
#ERROR : Can't open dsspfile "2a1sD.bssp"
#ERROR : Can't open dsspfile "2e6lA.bssp"
#ERROR : Can't open dsspfile "3c94A.bssp"
#ERROR : Can't open dsspfile "3crvA.bssp"
#ERROR : Can't open dsspfile "3c95A.bssp"
#ERROR : Can't open dsspfile "1bdp-.bssp"
#ERROR : Can't open dsspfile "1d9dA.bssp"
#ERROR : Can't open dsspfile "2dtuA.bssp"
#ERROR : Can't open dsspfile "2dtuC.bssp"
#ERROR : Can't open dsspfile "1d8yA.bssp"
#ERROR : Can't open dsspfile "2a1sC.bssp"
#ERROR : Can't open dsspfile "3e0jC.bssp"
#ERROR : Can't open dsspfile "2bhrA.bssp"
#ERROR : Can't open dsspfile "2dtuD.bssp"
#ERROR : Can't open dsspfile "1cu1A.bssp"
#ERROR : Can't open dsspfile "2bmfB.bssp"
#ERROR : Can't open dsspfile "3cymA.bssp"
#ERROR : Can't open dsspfile "2atqA.bssp"
#ERROR : Can't open dsspfile "1e2bA.bssp"
#ERROR : Can't open dsspfile "1d5aA.bssp"
#ERROR : Can't open dsspfile "3bxzB.bssp"
#ERROR : Can't open dsspfile "2ekyB.bssp"
#ERROR : Can't open dsspfile "3dmqA.bssp"
#ERROR : Can't open dsspfile "3buwB.bssp"
#ERROR : Can't open dsspfile "2e18A.bssp"
#ERROR : Can't open dsspfile "2dxcH.bssp"

## Summary of PDB Search
:816
    5e-17  12%  3cg7B  [x.x.x] CELL DEATH-RELATED NUCLEASE 4
    9e-17  17%  2d5rA  [x.x.x] CCR4-NOT TRANSCRIPTION COMPLEX SUBUNIT 7
    3e-15  17%  2a1rB  [x.x.x] POLY(A)-SPECIFIC RIBONUCLEASE PARN
    7e-15  14%  3cg7A  [x.x.x] CELL DEATH-RELATED NUCLEASE 4
    2e-14  20%  3crw1  [x.x.x] XPD/RAD3 RELATED DNA HELICASE
    2e-13  13%  3cm5A  [x.x.x] CELL DEATH-RELATED NUCLEASE 4
    1e-12  19%  2a1sA  [x.x.x] POLY(A)-SPECIFIC RIBONUCLEASE PARN
    2e-12   7%  1clqA  [c.55.3 - e.8.1] PROTEIN (DNA POLYMERASE)
    3e-11  20%  2a1sD  [x.x.x] POLY(A)-SPECIFIC RIBONUCLEASE PARN
    4e-11  16%  2e6lA  [x.x.x] WERNER SYNDROME ATP-DEPENDENT HELICASE HOMOLOG
    6e-11  12%  3c94A  [x.x.x] EXODEOXYRIBONUCLEASE I
    1e-10  17%  3crvA  [x.x.x] XPD/RAD3 RELATED DNA HELICASE
    4e-10  14%  3c95A  [x.x.x] EXODEOXYRIBONUCLEASE I
    6e-10  12%  1bdp-  [x.x.x] DNA POLYMERASE I
    1e-09  12%  1d9dA  [c.55.3 - e.8.1] DNA POLYMERASE I
    8e-09  11%  2dtuA  [x.x.x] DNA POLYMERASE
    8e-09  10%  2dtuC  [x.x.x] DNA POLYMERASE
    2e-08  14%  1d8yA  [c.55.3 - e.8.1] DNA POLYMERASE I
    8e-08  18%  2a1sC  [x.x.x] POLY(A)-SPECIFIC RIBONUCLEASE PARN
    5e-07  11%  3e0jC  [x.x.x] DNA POLYMERASE SUBUNIT DELTA-2
    2e-06  21%  2bhrA  [x.x.x] RNA HELICASE
    2e-06  10%  2dtuD  [x.x.x] DNA POLYMERASE
    3e-06  11%  1cu1A  [c.37.1 - c.37.1 - b.47.1] PROTEIN (PROTEASE/HELICASE NS3)
    4e-06  12%  2bmfB  [x.x.x] RNA HELICASE
    6e-06  15%  3cymA  [x.x.x] UNCHARACTERIZED PROTEIN BAD_0989
    5e-05   7%  2atqA  [x.x.x] DNA POLYMERASE
    9e-05  12%  1e2bA  [x.x.x] ENZYME IIB-CELLOBIOSE
    1e-04  13%  1d5aA  [c.55.3 - e.8.1] PROTEIN (DNA POLYMERASE)
    1e-04  12%  3bxzB  [x.x.x] PREPROTEIN TRANSLOCASE SUBUNIT SECA
    2e-04  12%  2ekyB  [x.x.x] UPF0045 PROTEIN MJ1052
    5e-04  13%  3dmqA  [x.x.x] RNA POLYMERASE-ASSOCIATED PROTEIN RAPA
    5e-04   6%  3buwB  [a.48.1 - a.39.1 - d.93.1 (2cblA)] E3 UBIQUITIN-PROTEIN
    6e-04  18%  2e18A  [x.x.x] NH(3)-DEPENDENT NAD(+) SYNTHETASE
    6e-04   6%  2dxcH  [x.x.x] THIOCYANATE HYDROLASE SUBUNIT BETA
:816

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxNRYVVVDLEATSTGSKAKXXXXXXXXXXXXXXXXHYTTDVNPHEPLDAHIKELTGLTDQRLAQAP
3cg7B           -----DTLLILDFETTSDAANQDYPCEVIQFAIVAYDVPSFNKYVKPVLTLTKNCVDFTGIPQRSIDTAD
2d5rA           ---------------------------------------NFKFNLTEDMYAQDSIELLTKHEEEGIETQY
2a1rB           -------FYVFPKPFNRSSPDVKFVCQSSSIDFLASQGFDFNKVFRNGIPY-LNQEEERQLRQEELNDAV
3cg7A           -----DTLLILDFETTSDAANQDYPCEVIQFAIVAYDVPSFNKYVKPVLTLTKNCVDFTGIPQRSIDTAD
3crw1           ----------------------------------------------------------------------
3cm5A           -----DTLLILDFETTSDAANQDYPCEVIQFAIVAYDVPSFNKYVKPVLTLTKNCVDFTGIPQRSIDTAD
2a1sA           ---------------------------------------------------------------EELNDAV
1clqA           --------------------------------------------AAKLQEQGGDEVPSEIIDKIIYMPFD
2a1sD           ---------------------------------------------------------------EELNDAV
2e6lA           -----------------------------------------WPPPGKRSRV-AVIQLCVSESKCYLFHIS
3c94A           -----STFLFHDYETFGTHPALDRPAQFAAIRTDSEFNVVFYCKPADDYLPQPGAVLITGITPQEARAKG
3crvA           ----------------------------------------------------------------------
3c95A           -----STFLFHDYETFGTHPALDRPAQFAAIRTDSEFNVVFYCKPADDYLPQPGAVLITGITPQEARAKG
1bdp-           -----------------------------------------VVEENYHDA---PIVGIVVNEHGRFFLRP
1d9dA           -----------------------------------------------------YIPVAHDYLDAPDQISR
2dtuA           -----IRVANFDIEVTSPDGFPEPIDAITHYDSIDDRFYVFDLLNSPYGNVEEWEVPSEIIDKIIYMPFD
2dtuC           ------RVANFDIEVTSPDGAKHPIDAITHYDSIDDRFYVFDLLNSPYGNVEEWSIEIAAKLQEQGGDEV
1d8yA           -----------------------------------------------------YIPVAHDYLDAPDQISR
2a1sC           ---------------------------------------------------------------EELNDAV
3e0jC           ----------------------------------------------------------------------
2bhrA           ----------------------------------------------------------------------
2dtuD           ---------------------------------------VFDLLNSPYGNVEEWSIEIAAKLQEQGGDEV
1cu1A           ----------------------------------------------------------------------
2bmfB           ----------------------------------------------------------------------
3cymA           -----------------------------------------RASGFRYGHEDWLVRDGAGIGLLDPQALA
2atqA           ---------------------------------------WSIEIAAKLQEQGGDEVPSEIIDKIIYMPFD
1e2bA           ----------------------------------------------------------------------
1d5aA           -----------------------------------------------------RVITWKNIDLPYVESVS
3bxzB           ----------------------------------------------------------------------
2ekyB           ----------------------------------------------------------------------
3dmqA           ----------------------------------------------------------------------
3buwB           ----------------------------------------------------------------------
2e18A           --------------------------------------------INIKPIVDSFVENLELNLDRK-----
2dxcH           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DFSQVARKIFDLVEDGIFVAHNVQFDANLLAENLFFEGYELRNPRVDTVELAQVFFPELEKYSLPILCRE
3cg7B           TFDVVYEQFQQLEEGKFAFVCDSRQDLWRIAQYQMKLSNIMPAFFRQYINLYKIFTNEMATTNIGKMNEY
2d5rA           FAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKIL--TNSNLPEEELDFFEILRLFFPVIYKGGLQEVAEQ
2a1rB           GFSRVIHAIANS--GKLVIGHNMLLDVMHTVHQF---YCPLPADLSEFKEMTTCVFPRLNNTSLAELEKR
3cg7A           TFDVVYEQFQQWLEGKFAFVCDSRQDWRIAQYQMKLSNIQMPAFFRQYINLYKIFTNEMATTNIGKMNEY
3crw1           ----------------------------------------------------------------------
3cm5A           TFDVVYEQFQQWLITKFAFVCDSRQDWRIAQYQMKLSNIQMPAFFRQYINLYKIFTNESATTNIGKMNEY
2a1sA           GFSRVIHAIAN--SGKLVIGHNMLLDVMHTVHQFYCPLPAVFPRLLDTKLMASTQPFKDIITSLAELEKR
1clqA           NEKELLMEYLNFWQQKILTGWNVEFDIPYVYNRIKNIFGESTAKRLSPHRKTR-VKVIENMYGSREIITL
2a1sD           GFSRVIHAIAN--SGKLVIGHNMLLDVMHTVHQFYCPLPAVFPRLLDTKLMASTQPFKDIITSLAELEKR
2e6lA           SMSVFPQGLKMLLENKKKAGVGIEGDQWKLLRDFDVKL----ESFVELTDVANEKLKCAETWSLNGLVKH
3c94A           AFAARIHSLFTVPKTCILGYNNVRFDDEVTRNIFYRNFYNSRWDLLDVMRACYALRPEGINWPENRLEHL
3crvA           ----------------------------------------------------------------------
3c95A           NEAAFAARIHSLFTTCILGYNNVRFDDEVTRNIFSWQHDNSRWDLLDVMRACYALRPE-GINWPENDDGL
1bdp-           ETALADPQFVAWLGDEKKSMFDSKRAAVALKW----KGIELCGVSFDLLLAAYLLDPAQGVDDVRAAAKM
1d9dA           ERALELLKPLLEDEKALKVGQNLKYDRG----ILANYGIELRGIAFDTMLESYILNSVAGRHDMDSLAER
2dtuA           NEKELLMEYLNFWQQVILTGWNVSFAIPYVYNRIKNIFGESTAKRLS-----PHRKTRVKVGEIITLFGI
2dtuC           PSEIIDKIIYMPFDNVILTGWNVEFAIPYVYNRIKNIFGESAKRLSPHRKTRVKVGEIITLFGISVLDYI
1d8yA           ERALELLKPLLEDEKALKVGQNLKYDRGILA----NYGIELRGIAFDTMLESYILNSVAGRHDMDSLAER
2a1sC           GFSRVIHAIAN--SGKLVIGHNMLLDVMHTVHQFYCPLPADLPRLLDTKLMASTFKDIINNTSLAELEKR
3e0jC           ----------------------------------------------------------------------
2bhrA           ----------------------------------------------------------------------
2dtuD           PSEELLMEYLNFWQQKILTGWNVEFAIPYVYNRIKNIFGESTAKRLPHRKTRVKVGEIIPSYSLDYISEF
1cu1A           ----------------------------------------------------------------------
2bmfB           ----------------------------------------------------------------------
3cymA           AAGADWNDFNRAVGDAVWILHDSLQDLPGFDELGMEPQRLLGLKRFGLAAVTEHFLLTLAKEHSAADWSY
2atqA           NEKELLMEYLNFWQVILTGWNVESFAIPYVYNRIKNIFGESTAKRLSPHRKTRVKVIE-NMYGSREIITL
1e2bA           ----------------------------------------------------------------------
1d5aA           TEKEMIKRFLKVIQEKVLITYNGDFDFAYLSEMLGVKFILGRDGSFDLYPVIRRTIN-LPTYTLETVYEP
3bxzB           ----------------------------------------------------------------------
2ekyB           ----------------------------------------------------------------------
3dmqA           ----------------------------------------------------------------------
3buwB           ----------------------------------------------------------------------
2e18A           ----GLGNIMSRTRMIMLYAHANSLGRIVLGTSNRSEFLTGYFTKWG--DGASDYAPNLYKTEVWEIAKR
2dxcH           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LGIPLKHAHTALSDAQATAELLLFLREKMTQLPKGLLERLLEMADALLYESYLVIEETYRNQSILSSPDL
3cg7B           YDLPTIGAHDAMDDCLNIATILQRMINMGAKVTVNELLTCCASWR---RQPLVYNKEWRSSFMDAGKIFE
2d5rA           LELERIPQHQAGSDSLLTGMAFFKMREMFFEDHIDDAKYCGHL---------------------------
2a1rB           LKETPFQLHEAGYDAYITGLCFISMANYLGSFLS--PPKIHVSARSKLIEPFF-----------------
3cg7A           YDLPTGRAHDAMDDCLNIATILQRMINM---GAKVTVNELLTCCASWRRQPLVYNKEWRSSFMDAGK---
3crw1           ----------------------------------------------------------------------
3cm5A           YDLPTIGAHDAMDDCLNIATILQRMIN---MGAKVTVNELLTCCASWRRQPLVYNKEWRSSFMDAGKIFE
2a1sA           LKETPFNLHEAGYDAYITGLCFISMANYLGS--FLSPPKIHVSARSKLIEPFFNKLFLMR----------
1clqA           FGISVLDYIDLYKKFSFTNQPSYSLDYISEFELNVGKLKYDGPISKLRESNHQRYISYNIIDVYRVLQID
2a1sD           LKETPFNLHEAGYDAYITGLCFISMANYLGSFLS--PPKIHVSARSKLIE--------------------
2e6lA           VPLTEDQKLYAATDAYAGLIIYQKLGNL------------------------------------------
3c94A           TKANGIEHSDAMADVYATIAMAKLVKTRQPRLFDYLFTHRNKLIDVPQMKPLVHVSGMFGAWRGNTSWVA
3crvA           ----------------------------------------------------------------------
3c95A           PSFRLEHLTKANGIEHDAM---------------------------------------------------
1bdp-           KQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILA
1d9dA           WLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDADVTLQLHLKMWP---DLQKHKGPLNVFENIEM
2dtuA           SVLDYIDLYKKFSFTNQPSYSLDYISEFELNVGKLKYSNHQRYISYNIIAVYRVLQIDAKRQFINLSLDM
2dtuC           DLYKKFSFTNQPSYSLDYISEFELNVGKLKYDGPLRESNHQRYISYNIIAVYRVLQIDAKRQFINLSLDM
1d8yA           WLKHKTITFEEIAGKGKNQLTFQIALEEAGRYAAEDADVTLQLHLKMWPD--------------------
2a1sC           LKETPYQLHEAGYDAYITGLCFISMANYLGSFLSPPKIHVSARSKLIEP---------------------
3e0jC           ----------------------------------------------------------------------
2bhrA           ----------------------------------------------------------------------
2dtuD           ELNVGKLKYDGPISKLRESNHQRYISYNIVYRVLQIDAKRQFINLSLDMGYYAKIQIQSVFSPI------
1cu1A           ----------------------------------------------------------------------
2bmfB           ----------------------------------------------------------------------
3cymA           RPLPRDWRNYAALDVELLIE--LETKMRAELKRQGKMEWAQEEFDYALKEGLGPRKEHLIPWM-------
2atqA           FGISVLDYIDLYKKFSFTNQPSYSLDYISEFELNVGKLKYDGPISKLRESNHQRYISYNIIAVYRVLQID
1e2bA           ----------------------------------------------------------------------
1d5aA           VFGQPAVYAEEIAEAWASGEGLERVAMEDAKATYELGKEFFPMEAQLSRLVGQSLWDVSRSSTG------
3bxzB           ----------------------------------------------------------------------
2ekyB           ----------------------------------------------------------------------
3dmqA           ----------------------------------------------------------------------
3buwB           ----------------------------------------------------------------------
2e18A           IGVPVKKKPSALWEGQTDEDELGISYNLLDEILWRMIDLKIEIAKDLGIPLSLV----------------
2dxcH           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           VQVQGLYFKKTAASLELRKLSQDFSKNISLLNLEVREEQESFAKEVGLLLKDEPVSLIQAPTGIGKTYGY
3cg7B           RVLP-LVVTTIRAGDFRLEMYGVCRYCRKVCGTSHQQTPHDLYKNEEDPIHFAKI---------------
2d5rA           ----------------------------------------------------------------------
2a1rB           ----------------------------------------------------------------------
3cg7A           ----------------------------------------------------------------------
3crw1           --------------------------------------------------------ALNAPTGSGKTLFS
3cm5A           RV--------------------------------------------------------------------
2a1sA           ----------------------------------------------------------------------
1clqA           AKRQFINLSLDMGYIQIQSVFSPIKTWDAIIFNSLKEQNK------------------------------
2a1sD           ----------------------------------------------------------------------
2e6lA           ----------------------------------------------------------------------
3c94A           PLAWHPENRNAVIMVDLAGDISPLLELDSDTLRERYTAKTDLNAAVPVKLVHINKCPVLAQANTLEDADR
3crvA           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
1bdp-           EMEFAGVKVDT---KRLEQMGKELREKLGTVEQRIYELGQEFNILFEKLQLPVLYSTSADVLEKLAPYHE
1d9dA           PLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEKKAHEIAGE-----EFNLSSTKQLQTILFEKQG-
2dtuA           GYYAKIQIQSVFSPIKTWDFNSLKEQNKVIPQGRSHPVQPYPGAFV------------------------
2dtuC           GYYAKIQIQSVFSPIKTWDFNSLKEQNKVIPQGRSHPVQPYPGAFVKEPIP-------------------
1d8yA           ----------------------------------------------------------------------
2a1sC           ----------------------------------------------------------------------
3e0jC           --------------------------------------------------------GMFSEQAAQRAHTL
2bhrA           --------------------------------------------------------IMDLHPGAGKTKRY
2dtuD           ----------------------------------------------------------------------
1cu1A           ---------------------------------------------------------LHAPTGSGKSTKV
2bmfB           -----------------------------------------------IFRKKRLT-IMDLHPGAGKTKRY
3cymA           ----------------------------------------------------------------------
2atqA           AKRQFINLSLDMGYYAKIQIQSVFSPIKTWDAIIFNS---------------------------------
1e2bA           --------------------------------------------------------QNADVVLLGPQIAY
1d5aA           ----------------------------------------------------------------------
3bxzB           ---------------------------------------------LGGMVLNERC-IAEMRTGEGKTLTA
2ekyB           -------------------------------------------------MRKVVAEVSIIPLGKGASVSK
3dmqA           -QIDRDRFALRYRARKYSSEQFRPYSGLRGQRTSLIPHQLNIAHDV--GRRHAPRVLLADEVGLGKTIEA
3buwB           ---------------------------------------------------------------VEKCWKL
2e18A           ----------------------------------------------------------------------
2dxcH           -----------------------------------------------------------NTFATCECLAW


                         .         *         .         .         .         .         +:350
query           LLPALSQSKERQIVLSVPTKILQNQIMEEEGKRLKEVFHTDIHSLKGPQNYLKLDAFYHSLQENDENRLF
3cg7B           ----------------------------------------------------------------------
2d5rA           ----------------------------------------------------------------------
2a1rB           ----------------------------------------------------------------------
3cg7A           ----------------------------------------------------------------------
3crw1           LLVSLEV--KPKVLFVVRTHNEFYPIYRDLTKIRE-----------------------------------
3cm5A           ----------------------------------------------------------------------
2a1sA           ----------------------------------------------------------------------
1clqA           ----------------------------------------------------------------------
2a1sD           ----------------------------------------------------------------------
2e6lA           ----------------------------------------------------------------------
3c94A           LGINRQHCLDNLKILRENPQVREKVVAIFASDNVADRAAMKIVLETEPRNLPAL--DITFVDKRIEKLLF
3crvA           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
1bdp-           IVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALSSTEPNLQNIPIRLEEGRKIRQSESDWLI
1d9dA           IKPLKKTPSTSEEVLALDYPLPKVILEYRGLAKLKSTYTDKLPLMINPKTGRV---HTSYHQAVTATGRL
2dtuA           ----------------------------------------------------------------------
2dtuC           ----------------------------------------------------------------------
1d8yA           ----------------------------------------------------------------------
2a1sC           ----------------------------------------------------------------------
3e0jC           LSPPSANNATFARVPVATYTNSSQPFRLIYATRLIQMRPFLENRAQQHWGSGVGVKKLCELQPEEKCCVG
2bhrA           LPAIVREKRGLRTLILAPTRVVAAEMEEA-----------------------------------------
2dtuD           ----------------------------------------------------------------------
1cu1A           PAAYA--AQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGG
2bmfB           LPAIVREAIKRRTLILAPTRVVAAEMEEALRGLPI-----RYQTGREIVDLMCHATFTMRLLSPIRVPNY
3cymA           ----------------------------------------------------------------------
2atqA           ----------------------------------------------------------------------
1e2bA           MLPEIQRLLPNKPVEVIDSLLYGKVDGLG-----------------------------------------
1d5aA           ----------------------------------------------------------------------
3bxzB           TLPAYLNLTGKGVHVVTVNDYLAQRDAENNRPLFEFLGLTKREAYAAEYGFDYLRDNMAFSPEERVQRKL
2ekyB           YVKKAFKKYDLKVETN-AMGTVLEGDLDEILKAFKEAH--------------------------------
3dmqA           GILHQQSGAAERVLIIVPETLQHQWLVELRRFNLRFALFDDERYAEAQHDAYNPFDTEQLVICSLD-FAR
3buwB           MDKVVRLCQNPKLALKNSPPYILDLLPDTY-QHLRTILSRYEGKMETLGENEYFRVFMENLMKKTKQTIS
2e18A           ----------------------------------------------------------------------
2dxcH           RGVTAEERRRKQNCDVGQTVYLGMPYYGRWLLTAAR----------------------------------


                         .         .         .         .         *         .         .:420
query           RRFKMQVLVWLTETETGDLDEIGQLYRYQHFLADLRHDGNLSSHSLFVTEDFWKRSQERAETCKLLVTNH
3cg7B           ----------------------------------------------------------------------
2d5rA           ----------------------------------------------------------------------
2a1rB           ----------------------------------------------------------------------
3cg7A           ----------------------------------------------------------------------
3crw1           ----------------------------------------------------------------------
3cm5A           ----------------------------------------------------------------------
2a1sA           ----------------------------------------------------------------------
1clqA           ----------------------------------------------------------------------
2a1sD           ----------------------------------------------------------------------
2e6lA           ----------------------------------------------------------------------
3c94A           NYRARNFPGTLDYAEQQRRQVFTPEFLQGYADEL---------------QMLVQQYADDKEKVALLKALW
3crvA           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
1bdp-           FQIELRVLAHIAEDD-------------------------------------------------------
1d9dA           SSTDPNLQNIPVRNEEG-----------------------------------------------------
2dtuA           ----------------------------------------------------------------------
2dtuC           ----------------------------------------------------------------------
1d8yA           ----------------------------------------------------------------------
2a1sC           ----------------------------------------------------------------------
3e0jC           TLFKAMSKYIHPDDELVLEDELQRILKGTIDVSKLVTG--------------------------------
2bhrA           ----------------------------------------------------------------------
2dtuD           ----------------------------------------------------------------------
1cu1A           AYDIIICDE---CHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPF
2bmfB           NLIIMDEAHFTDPASIAARGYISTRVEMGEAAGIFMTATPPGSRDPFPQSNAPIMDEEREIPERSWNSGH
3cymA           ----------------------------------------------------------------------
2atqA           ----------------------------------------------------------------------
1e2bA           ----------------------------------------------------------------------
1d5aA           ----------------------------------------------------------------------
3bxzB           HYALVDEVDSILIDEARTPLIILASITFQNYFRLYEKLAGMTGTADTEAFEFSSLDTVVVPTNRPMIRKD
2ekyB           ----------------------------------------------------------------------
3dmqA           RSKQRLEHLCEAEWDLLVVDEAHHLVWSED----------------------------------------
3buwB           LFKEGKERMY------------------------------------------------------------
2e18A           ----------------------------------------------------------------------
2dxcH           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           AYLVTRLEDNPEFVSDRLLIIDEVQKILLALENLLQExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cg7B           ----------------------------------------------------------------------
2d5rA           ----------------------------------------------------------------------
2a1rB           ----------------------------------------------------------------------
3cg7A           ----------------------------------------------------------------------
3crw1           ----------------------------------------------------------------------
3cm5A           ----------------------------------------------------------------------
2a1sA           ----------------------------------------------------------------------
1clqA           ----------------------------------------------------------------------
2a1sD           ----------------------------------------------------------------------
2e6lA           ----------------------------------------------------------------------
3c94A           QY--------------------------------------------------------------------
3crvA           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
1bdp-           ----------------------------------------------------------------------
1d9dA           ----------------------------------------------------------------------
2dtuA           ----------------------------------------------------------------------
2dtuC           ----------------------------------------------------------------------
1d8yA           ----------------------------------------------------------------------
2a1sC           ----------------------------------------------------------------------
3e0jC           ----------------------------------------------------------------------
2bhrA           ----------------------------------------------------------------------
2dtuD           ----------------------------------------------------------------------
1cu1A           YGKAIPIEAIRG---GRHLIFCHSKKKCDELAAKLSG---------------------------------
2bmfB           EWVTDFKGKTVWFVPSI-KAGNDIAACL------------------------------------------
3cymA           ----------------------------------------------------------------------
2atqA           ----------------------------------------------------------------------
1e2bA           ----------------------------------------------------------------------
1d5aA           ----------------------------------------------------------------------
3bxzB           LPDLVYMTEAEKIQAIIEDIKERTAKG-------------------------------------------
2ekyB           ----------------------------------------------------------------------
3dmqA           ----------------------------------------------------------------------
3buwB           ----------------------------------------------------------------------
2e18A           ----------------------------------------------------------------------
2dxcH           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cg7B           ----------------------------------------------------------------------
2d5rA           ----------------------------------------------------------------------
2a1rB           ----------------------------------------------------------------------
3cg7A           ----------------------------------------------------------------------
3crw1           ----------------------------------------------------------------------
3cm5A           ----------------------------------------------------------------------
2a1sA           ----------------------------------------------------------------------
1clqA           ----------------------------------------------------------------------
2a1sD           ----------------------------------------------------------------------
2e6lA           ----------------------------------------------------------------------
3c94A           ----------------------------------------------------------------------
3crvA           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
1bdp-           ----------------------------------------------------------------------
1d9dA           ----------------------------------------------------------------------
2dtuA           ----------------------------------------------------------------------
2dtuC           ----------------------------------------------------------------------
1d8yA           ----------------------------------------------------------------------
2a1sC           ----------------------------------------------------------------------
3e0jC           ----------------------------------------------------------------------
2bhrA           ----------------------------------------------------------------------
2dtuD           ----------------------------------------------------------------------
1cu1A           ----------------------------------------------------------------------
2bmfB           ----------------------------------------------------------------------
3cymA           ----------------------------------------------------------------------
2atqA           ----------------------------------------------------------------------
1e2bA           ----------------------------------------------------------------------
1d5aA           ----------------------------------------------------------------------
3bxzB           ----------------------------------------------------------------------
2ekyB           ----------------------------------------------------------------------
3dmqA           ----------------------------------------------------------------------
3buwB           ----------------------------------------------------------------------
2e18A           ----------------------------------------------------------------------
2dxcH           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cg7B           ----------------------------------------------------------------------
2d5rA           ----------------------------------------------------------------------
2a1rB           ----------------------------------------------------------------------
3cg7A           ----------------------------------------------------------------------
3crw1           ----------------------------------------------------------------------
3cm5A           ----------------------------------------------------------------------
2a1sA           ----------------------------------------------------------------------
1clqA           ----------------------------------------------------------------------
2a1sD           ----------------------------------------------------------------------
2e6lA           ----------------------------------------------------------------------
3c94A           ----------------------------------------------------------------------
3crvA           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
1bdp-           ----------------------------------------------------------------------
1d9dA           ----------------------------------------------------------------------
2dtuA           ----------------------------------------------------------------------
2dtuC           ----------------------------------------------------------------------
1d8yA           ----------------------------------------------------------------------
2a1sC           ----------------------------------------------------------------------
3e0jC           ----------------------------------------------------------------------
2bhrA           ----------------------------------------------------------------------
2dtuD           ----------------------------------------------------------------------
1cu1A           ----------------------------------------------------------------------
2bmfB           ----------------------------------------------------------------------
3cymA           ----------------------------------------------------------------------
2atqA           ----------------------------------------------------------------------
1e2bA           ----------------------------------------------------------------------
1d5aA           ----------------------------------------------------------------------
3bxzB           ----------------------------------------------------------------------
2ekyB           ----------------------------------------------------------------------
3dmqA           ----------------------------------------------------------------------
3buwB           ----------------------------------------------------------------------
2e18A           ----------------------------------------------------------------------
2dxcH           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxVAALLVEIQAFQQPILVLFTAKDMLLAVSDLLTVSHLAQYKNGDVHQLKKRFEKGEQQILLGAASFWE
3cg7B           ----------------------------------------------------------------------
2d5rA           ----------------------------------------------------------------------
2a1rB           ----------------------------------------------------------------------
3cg7A           ----------------------------------------------------------------------
3crw1           --ADYLLKIYFQAKANVLVVFPSYEIMDRVMSRISLPKYVESEDSSVEDLYSAISANNKVLSVGKGKLAE
3cm5A           ----------------------------------------------------------------------
2a1sA           ----------------------------------------------------------------------
1clqA           ----------------------------------------------------------------------
2a1sD           ----------------------------------------------------------------------
2e6lA           ----------------------------------------------------------------------
3c94A           ----------------------------------------------------------------------
3crvA           ---------------------------------------------------ISANNKVLIGSVGKGKLAE
3c95A           ----------------------------------------------------------------------
1bdp-           ----------------------------------------------------------------------
1d9dA           ----------------------------------------------------------------------
2dtuA           ----------------------------------------------------------------------
2dtuC           ----------------------------------------------------------------------
1d8yA           ----------------------------------------------------------------------
2a1sC           ----------------------------------------------------------------------
3e0jC           ----------------------------------------------------------------------
2bhrA           ----------------------------------------------------------------------
2dtuD           ----------------------------------------------------------------------
1cu1A           ----------------------------------------------------------------------
2bmfB           ----------------------------------------------------------------------
3cymA           ----------------------------------------------------------------------
2atqA           ----------------------------------------------------------------------
1e2bA           ----------------------------------------------------------------------
1d5aA           ----------------------------------------------------------------------
3bxzB           ----------------------------------------------------------------------
2ekyB           ----------------------------------------------------------------------
3dmqA           ----------------------------------------------------------------------
3buwB           ----------------------------------------------------------------------
2e18A           ----------------------------------------------------------------------
2dxcH           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           GVDFSSHPFVIQVVPRLPFQNPQEPLTKKINQELNQEGKNAFYDYQLPMAIIRLKQALGRSMRREYQRSL
3cg7B           ----------------------------------------------------------------------
2d5rA           ----------------------------------------------------------------------
2a1rB           ----------------------------------------------------------------------
3cg7A           ----------------------------------------------------------------------
3crw1           GIELRNNDRSLVVIVGIPYPPPDDYLKILAQRVSLKMNRENEEFLFKIPALVTIKQAIGRAIRDVNDKCN
3cm5A           ----------------------------------------------------------------------
2a1sA           ----------------------------------------------------------------------
1clqA           ----------------------------------------------------------------------
2a1sD           ----------------------------------------------------------------------
2e6lA           ----------------------------------------------------------------------
3c94A           ----------------------------------------------------------------------
3crvA           GIELRNNDRSLVVIVGIPYPPPDDYLKILAQRVSLKMNRENEEFLFKIPALVTIKQAIGRAIRDVNDKCN
3c95A           ----------------------------------------------------------------------
1bdp-           ----------------------------------------------------------------------
1d9dA           ----------------------------------------------------------------------
2dtuA           ----------------------------------------------------------------------
2dtuC           ----------------------------------------------------------------------
1d8yA           ----------------------------------------------------------------------
2a1sC           ----------------------------------------------------------------------
3e0jC           ----------------------------------------------------------------------
2bhrA           ----------------------------------------------------------------------
2dtuD           ----------------------------------------------------------------------
1cu1A           ----------------------------------------------------------------------
2bmfB           ----------------------------------------------------------------------
3cymA           ----------------------------------------------------------------------
2atqA           ----------------------------------------------------------------------
1e2bA           ----------------------------------------------------------------------
1d5aA           ----------------------------------------------------------------------
3bxzB           ----------------------------------------------------------------------
2ekyB           ----------------------------------------------------------------------
3dmqA           ----------------------------------------------------------------------
3buwB           ----------------------------------------------------------------------
2e18A           ----------------------------------------------------------------------
2dxcH           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           TLILDRRIVGKRYGKQIxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cg7B           ----------------------------------------------
2d5rA           ----------------------------------------------
2a1rB           ----------------------------------------------
3cg7A           ----------------------------------------------
3crw1           VWLLDKRFESLYWKKNL-----------------------------
3cm5A           ----------------------------------------------
2a1sA           ----------------------------------------------
1clqA           ----------------------------------------------
2a1sD           ----------------------------------------------
2e6lA           ----------------------------------------------
3c94A           ----------------------------------------------
3crvA           VWLLDKRFESLYWKKNL-----------------------------
3c95A           ----------------------------------------------
1bdp-           ----------------------------------------------
1d9dA           ----------------------------------------------
2dtuA           ----------------------------------------------
2dtuC           ----------------------------------------------
1d8yA           ----------------------------------------------
2a1sC           ----------------------------------------------
3e0jC           ----------------------------------------------
2bhrA           ----------------------------------------------
2dtuD           ----------------------------------------------
1cu1A           ----------------------------------------------
2bmfB           ----------------------------------------------
3cymA           ----------------------------------------------
2atqA           ----------------------------------------------
1e2bA           ----------------------------------------------
1d5aA           ----------------------------------------------
3bxzB           ----------------------------------------------
2ekyB           ----------------------------------------------
3dmqA           ----------------------------------------------
3buwB           ----------------------------------------------
2e18A           ----------------------------------------------
2dxcH           ----------------------------------------------