[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for spne4:ACF55326.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1ecsA.bssp"
#ERROR : Can't open dsspfile "1bylA.bssp"
#ERROR : Can't open dsspfile "2a4wA.bssp"
#ERROR : Can't open dsspfile "3b59A.bssp"
#ERROR : Can't open dsspfile "3e5dA.bssp"
#ERROR : Can't open dsspfile "2a4xA.bssp"
#ERROR : Can't open dsspfile "3bt3A.bssp"
#ERROR : Can't open dsspfile "2a4wB.bssp"
#ERROR : Can't open dsspfile "2ei3A.bssp"
#ERROR : Can't open dsspfile "2ei1A.bssp"
#ERROR : Can't open dsspfile "2ehzA.bssp"
#ERROR : Can't open dsspfile "1dhyA.bssp"
#ERROR : Can't open dsspfile "1cjxA.bssp"
#ERROR : Can't open dsspfile "3ct8A.bssp"
#ERROR : Can't open dsspfile "3bqxA.bssp"
#ERROR : Can't open dsspfile "2c21A.bssp"
#ERROR : Can't open dsspfile "3ecjB.bssp"
#ERROR : Can't open dsspfile "2ei0A.bssp"
#ERROR : Can't open dsspfile "3e0rA.bssp"
#ERROR : Can't open dsspfile "2ei2A.bssp"
#ERROR : Can't open dsspfile "3e0rC.bssp"
#ERROR : Can't open dsspfile "1bh5A.bssp"
#ERROR : Can't open dsspfile "1bh5B.bssp"
#ERROR : Can't open dsspfile "3e0rB.bssp"

## Summary of PDB Search
:121
    2e-12  13%  1ecsA  [d.32.1] BLEOMYCIN RESISTANCE PROTEIN
    5e-12  12%  1bylA  [d.32.1] PROTEIN (BLEOMYCIN RESISTANCE PROTEIN)
    1e-11  18%  2a4wA  [x.x.x] MITOMYCIN-BINDING PROTEIN
    2e-11  17%  3b59A  [x.x.x] GLYOXALASE/BLEOMYCIN RESISTANCE
    2e-11  21%  3e5dA  [x.x.x] PUTATIVE GLYOXALASE I
    4e-11  18%  2a4xA  [x.x.x] MITOMYCIN-BINDING PROTEIN
    5e-11   9%  3bt3A  [x.x.x] GLYOXALASE-RELATED ENZYME, ARAC TYPE
    7e-11  18%  2a4wB  [x.x.x] MITOMYCIN-BINDING PROTEIN
    8e-11  12%  2ei3A  [x.x.x] 1,2-DIHYDROXYNAPHTHALENE DIOXYGENASE
    9e-11  13%  2ei1A  [x.x.x] 1,2-DIHYDROXYNAPHTHALENE DIOXYGENASE
    4e-10  12%  2ehzA  [x.x.x] 1,2-DIHYDROXYNAPHTHALENE DIOXYGENASE
    6e-10  16%  1dhyA  [x.x.x] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE
    7e-10  11%  1cjxA  [d.32.1 - d.32.1] 4-HYDROXYPHENYLPYRUVATE DIOXYGENASE
    9e-10  20%  3ct8A  [x.x.x] PUTATIVE GLYOXALASE
    1e-09  17%  3bqxA  [x.x.x] GLYOXALASE-RELATED ENZYME
    1e-09  20%  2c21A  [x.x.x] TRYPANOTHIONE-DEPENDENT GLYOXALASE I
    3e-09  19%  3ecjB  [x.x.x] PROTEIN (HOMOPROTOCATECHUATE 2,3-DIOXYGENASE)
    3e-09  17%  2ei0A  [x.x.x] 1,2-DIHYDROXYNAPHTHALENE DIOXYGENASE
    6e-09  17%  3e0rA  [x.x.x] C3-DEGRADING PROTEINASE (CPPA PROTEIN)
    8e-09  16%  2ei2A  [x.x.x] 1,2-DIHYDROXYNAPHTHALENE DIOXYGENASE
    4e-08  17%  3e0rC  [x.x.x] C3-DEGRADING PROTEINASE (CPPA PROTEIN)
    8e-08  21%  1bh5A  [d.32.1] LACTOYLGLUTATHIONE LYASE
    9e-08  18%  1bh5B  [d.32.1] LACTOYLGLUTATHIONE LYASE
    2e-07  17%  3e0rB  [x.x.x] C3-DEGRADING PROTEINASE (CPPA PROTEIN)
:121

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MIDHFEIKVKDLQISEGFYRSFLAPLDYKMTFKTSSLISFLSPNSPHPGGDFWLTQGTQDPVHFAFLAEN
1ecsA           DQATPNLPSRDFDSTAAFYER----LGFGIVFRDAGWMILQRGDLMLEFFAHPGLDPLASWFSCCLLAEF
1bylA           -SAVPVLTARDVAGAVEFWTDRLGSRDFVEDDFAGVVRDDVTLFISAVQDQVVPDNTLAWVWVRGLDELY
2a4wA           -ISLFAVVVEDMAKSLEFYRKLGVEIHTEAVLDGGIRLAWDTVETVRSYDPEWQAPTGGHRFAIAFEFPD
3b59A           -IRYVGYGVKDFDAEKAFYADVW---GLEPVGEDANNAWFKAQGADEHHVVQLRRADENRIDVIALAADS
3e5dA           -IEHVALWTTNLEQKQFYVTYFGATANDLYENKTKGFEDGARLEISRTDVTGKTTGENLGWAHIAISTGT
2a4xA           -ISLFAVVVEDMAKSLEFYRKLGVEIHTEAVLDGGIRLAWDTVETVRSYDPEWQAPTGGHRFAIAFEFPD
3bt3A           -ENGPVYFTKDMDKTVKWFEEILIVARDDEGFGDYGCVFDYPSEVAVAHPFRGFHLFKGEPIKGVAGFMM
2a4wB           -ISLFAVVVEDMAKSLEFYRKLGVAPHTEAVLDGGIRLAWDTVETVRSYDPEWQAPTGGHRFAIAFEFPD
2ei3A           GLGHCIVRQTDVAEAHKFYSLLGVEYRIPLPNGMTAELSFMHCNARDHSIAFGAMPAAKRLNHLMLEYTH
2ei1A           GLGHCIVRQTDVAEAHKFYSLLGFRGDVEYRIPTAELS-FMHCNARDHSIAFGAMPAAKRLNHLMLEYTH
2ehzA           GLGHCIVRQTDVAEAHKFYSLLGVEYRIPLPNGMTAELSFMHCNARDHSIAFGAMPAAKRLNHLMLEYTH
1dhyA           GIGHFVRCVPDTAKAMAFYTEVLGFVLSDIIDIVPAH--FLHCNGRHHTIALAAFPIPKRIHHFMLQANT
1cjxA           DHLTHNVYRGRMVYWANFYEKLFGLTSKAMSAPDGMIRIPLNEESSKGAGQIEEFLMQFNGEGIQHVAFL
3ct8A           -LHHVEINVDHLEESIAFWDWLLGQSWSRGKSYKHGKTYLVFVQTEDRFQTPTFHRKRTGLNHLAFHAAS
3bqxA           -VAVITLGIGDLEASARFYGEGFAPVFRNPEIIFYQNGFVLATWLVQNLQEDVGVAVTSRPGSALAHNVR
2c21A           -MLHTMIRVGDLDRSIKFYTERLKVLRKWDVPEDKYTLVFLGYGPEMELTYNYGVTSYKHDEAYGHIAIG
3ecjB           -CAYAELVVTDLAKSRNFYVDV---LGLHVSYEDENQIYLRSFEEFIHHNLVLTKGPVAALKAMAFRVRT
2ei0A           -LGYMGISVKDPDAWKSFATDM---LGLQVLDEGEKDRFYLRMDYWHHRIVVH-HNGQDDLEYLGWRVAG
3e0rA           -RIIPTLKANNRKLNETFYIETLAFLSLGDQTGLEKLVLEEAPSRTRK------VEGRKKLARLIVKVEN
2ei2A           -LGYMGISVKDPDAWKSFATDM---LGLQVLDEGEKDRFYLRMDYWHHRIVVHHNGQDDLE-YLGWRVAG
3e0rC           -RIIPTLKANNRKLNETFYIETLAFLSLGDQTGLEKLVLEEAPSRTRK------VEGRKKLARLIVKVEN
1bh5A           LLQETMLRVKDPKKSLDFYTRVLYFLAYEDKNDIPKEKDEKIAWALSRKATLELTHGNSDPRGFGHIGIA
1bh5B           LLQETMLRVKDPKKSLDFYTRVLKDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHIGIA
3e0rB           -RIIPTLKANNRKLNETFYIETLAFLSLGDQTGLEKLVLEEAPSRTRK------VEGRKKLARLIVKVEN


                         .         .         *         .         .         .         .:140
query           KEEVQACYEAGLEAGGRDNGAPGYRSEHPIYYAAFMIDLDGNNIEVVCHKE
1ecsA           YRQCKSVGIQETSSGYPRIHAP--ELQGWGGTMAALVDPDGTLLRLIQNE-
1bylA           AEWSEVVSTNFRDASGPAMTEIG---EQPWGREFALRDPAGNCVHFV----
2a4wA           TASVDKKYAELVDAGYEGHLKPWNAVWG--QRYAIVKDPDGNVVDLFAP--
3b59A           RSDVDALRASVEAAGCKVASEPAVLATPGGGYGFRFFSPDGLLFEVSSD--
3e5dA           KEAVDELTEKLRQDGFAIAGEPR---TGDGYYESVVLDPEGNRIEIT----
2a4xA           TASVDKKYAELVDAGYEGHLKPWNAVWG--QRYAIVKDPDGNVVDLFAP--
3bt3A           IEGIDALHKYVKENGWDQISDIY--TQPWGARECSITTTDGCILRFFES--
2a4wB           TASVDKKYAELVDAGYEGHLKPWNAVWG--QRYAIVKDPDGNVVDLFAP--
2ei3A           MEDLGYTHQQFVKNEIDIALQLG-IHANDKALTFYGATPSGWLIEPGWRGA
2ei1A           MEDLGYTHQQFVKNEIDIALQLG-IHANDKALTFYGATPSGWLIEPGWRGA
2ehzA           MEDLGYTHQQFVKNEIDIALQLG-IHANDKALTFYGATPSGWLIEPGWRGA
1dhyA           IDDVGYAFDRLDAAGRITSLLG--RHTNDQTLSFYADTPSPMIEVEFGWGP
1cjxA           TDDLVKTWDALKKIGMRFMTAPPD--TYYEMLEGRLPDHGEPVDQLQARG-
3ct8A           REKVDELTQKLKERGDPILYEDRPFAGGPNHYAVFCEDPNRIKVEIVA---
3bqxA           AETEVAPLERLVAAGGQLLRPA--DAPPHGGLRGYVADPDGHIWEIAFNPV
2c21A           VEDVKELVADMRKHDVPIDYEDES------GFMAFVVDPDGYYIELLNEKT
3ecjB           PEDVDKAEAYYQELGCRTERRKD-GFVKGIGDALRVEDPLGFPYEFFFE--
2ei0A           KPEFEALGQKLIDAGYKIRICDKVEQERMVLGLMKTEDPGGNPTEIFWGPR
3e0rA           PLEIEGILSKTDSIHRLYKGQNG--------YAFEIFSPEDDLILIHAEDD
2ei2A           KPEFEALGQKLIDAGYKIRICDKVEQERMVLGLMKTEDPGGNPTEIFWGPR
3e0rC           PLEIEGILSKTDSIHRLYKGQNG--------YAFEIFSPEDDLILIHAEDD
1bh5A           VPDVYSACKRFEELGVKFVKKPD---DGKMKGLAFIQDPDGYWIQILNPNK
1bh5B           VPDVYSACKRFEELGVKFVKKPD---DGKMKGLAFIQDPDGYWIQILNPNK
3e0rB           PLEI----EGILSKTDSIHRLY----KGQNGYAFEIFSPEDDLILIHAEDD