[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for spne4:ACF55442.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3bmbA.bssp"

## Summary of PDB Search
:160
    1e-28  24%  3bmbA  [x.x.x] REGULATOR OF NUCLEOSIDE DIPHOSPHATE KINASE
:160

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxRPEVVERIKIARSYGDLSENSEYEAAKDEQAFVEGQISSLETK
3bmbA           ---------------------------RPTIIINDLDAERIDILLEQPAYAGLPIADA--------LNAE


                         .         .         *         .         .         .         .:140
query           IRYAEIVNSDAVAQDEVAIGKTVTIQEIGEDEEEVYIIVGSAGADAFAGKVSNESPIGQALIGKKTGDTA
3bmbA           LDRAQMCSPEEMPHDVVTMNSRVKFRNLSDGEVRVRTLVYPAKMTDSNTQLSVMAPVGAALLGLRVGDSI


                         +         .         .         .         .         *         .:210
query           TIETPVGSYDVKILKVExxx
3bmbA           HWELPGGVAHLEVLELE---