[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for spne4:ACF55485.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2bisA.bssp"
#ERROR : Can't open dsspfile "3c4qB.bssp"
#ERROR : Can't open dsspfile "3c48A.bssp"
#ERROR : Can't open dsspfile "2acvA.bssp"
#ERROR : Can't open dsspfile "3c4qA.bssp"
#ERROR : Can't open dsspfile "3d1jA.bssp"
#ERROR : Can't open dsspfile "3c48B.bssp"
#ERROR : Can't open dsspfile "2bgtA.bssp"
#ERROR : Can't open dsspfile "1a8iA.bssp"
#ERROR : Can't open dsspfile "3e3lB.bssp"
#ERROR : Can't open dsspfile "3e3oD.bssp"
#ERROR : Can't open dsspfile "3copA.bssp"
#ERROR : Can't open dsspfile "3e3nC.bssp"
#ERROR : Can't open dsspfile "3e3lD.bssp"
#ERROR : Can't open dsspfile "3dd1B.bssp"
#ERROR : Can't open dsspfile "3cuvA.bssp"
#ERROR : Can't open dsspfile "3beoA.bssp"
#ERROR : Can't open dsspfile "3e3oB.bssp"
#ERROR : Can't open dsspfile "3e3oC.bssp"
#ERROR : Can't open dsspfile "3e3lC.bssp"
#ERROR : Can't open dsspfile "3e3nE.bssp"
#ERROR : Can't open dsspfile "2atiA.bssp"
#ERROR : Can't open dsspfile "3e3lA.bssp"
#ERROR : Can't open dsspfile "2acvB.bssp"
#ERROR : Can't open dsspfile "3e3oA.bssp"
#ERROR : Can't open dsspfile "1e1yA.bssp"
#ERROR : Can't open dsspfile "2bfwA.bssp"
#ERROR : Can't open dsspfile "2bguA.bssp"
#ERROR : Can't open dsspfile "3dzcA.bssp"
#ERROR : Can't open dsspfile "1c3jA.bssp"
#ERROR : Can't open dsspfile "2c4mA.bssp"
#ERROR : Can't open dsspfile "3cehA.bssp"
#ERROR : Can't open dsspfile "1b4dA.bssp"
#ERROR : Can't open dsspfile "3cejA.bssp"
#ERROR : Can't open dsspfile "3ddwB.bssp"
#ERROR : Can't open dsspfile "3ddsA.bssp"
#ERROR : Can't open dsspfile "1c8lA.bssp"
#ERROR : Can't open dsspfile "2c4mB.bssp"
#ERROR : Can't open dsspfile "3bjxB.bssp"
#ERROR : Can't open dsspfile "2c4mC.bssp"
#ERROR : Can't open dsspfile "3cv3A.bssp"
#ERROR : Can't open dsspfile "1e4oA.bssp"
#ERROR : Can't open dsspfile "3ddsB.bssp"
#ERROR : Can't open dsspfile "1bx3A.bssp"
#ERROR : Can't open dsspfile "3bjxD.bssp"
#ERROR : Can't open dsspfile "3cuyA.bssp"
#ERROR : Can't open dsspfile "3d0rA.bssp"
#ERROR : Can't open dsspfile "2c9zA.bssp"
#ERROR : Can't open dsspfile "2c1zA.bssp"
#ERROR : Can't open dsspfile "1ahpA.bssp"
#ERROR : Can't open dsspfile "2ecpA.bssp"
#ERROR : Can't open dsspfile "2c1xA.bssp"
#ERROR : Can't open dsspfile "3d0rB.bssp"
#ERROR : Can't open dsspfile "1bc9A.bssp"

## Summary of PDB Search
:347
    7e-31  18%  2bisA  [x.x.x] GLGA GLYCOGEN SYNTHASE
    2e-27  16%  3c4qB  [x.x.x] PREDICTED GLYCOSYLTRANSFERASES
    3e-25  15%  3c48A  [x.x.x] PREDICTED GLYCOSYLTRANSFERASES
    8e-25  10%  2acvA  [x.x.x] TRITERPENE UDP-GLUCOSYL TRANSFERASE UGT71G1[MASQUE :
    3e-24  15%  3c4qA  [x.x.x] PREDICTED GLYCOSYLTRANSFERASES
    5e-24  12%  3d1jA  [x.x.x] GLYCOGEN SYNTHASE
    6e-24  16%  3c48B  [x.x.x] PREDICTED GLYCOSYLTRANSFERASES
    2e-23  11%  2bgtA  [x.x.x] BETA-GLUCOSYLTRANSFERASE
    3e-23   8%  1a8iA  [x.x.x] GLYCOGEN PHOSPHORYLASE B
    1e-22   9%  3e3lB  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    2e-22   9%  3e3oD  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    3e-22  13%  3copA  [x.x.x] GLYCOGEN SYNTHASE
    1e-21   9%  3e3nC  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    1e-21  11%  3e3lD  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    1e-21  11%  3dd1B  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    2e-21  10%  3cuvA  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    4e-21   8%  3beoA  [x.x.x] UDP-N-ACETYLGLUCOSAMINE 2-EPIMERASE
    4e-21   9%  3e3oB  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    7e-21   9%  3e3oC  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    1e-20   9%  3e3lC  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    3e-20   9%  3e3nE  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    4e-20  12%  2atiA  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    5e-20   9%  3e3lA  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    5e-20  11%  2acvB  [x.x.x] TRITERPENE UDP-GLUCOSYL TRANSFERASE UGT71G1[MASQUE :
    8e-20   9%  3e3oA  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    1e-19   8%  1e1yA  [c.87.1] GLYCOGEN PHOSPHORYLASE
    1e-19  20%  2bfwA  [x.x.x] GLGA GLYCOGEN SYNTHASE
    2e-19  11%  2bguA  [x.x.x] BETA-GLUCOSYLTRANSFERASE
    4e-19  11%  3dzcA  [x.x.x] UDP-N-ACETYLGLUCOSAMINE 2-EPIMERASE
    7e-19   9%  1c3jA  [c.87.1] BETA-GLUCOSYLTRANSFERASE
    1e-18  10%  2c4mA  [x.x.x] GLYCOGEN PHOSPHORYLASE
    2e-18  10%  3cehA  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    4e-18  10%  1b4dA  [c.87.1] PROTEIN (GLYCOGEN PHOSPHORYLASE B)
    1e-16   9%  3cejA  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    2e-16   8%  3ddwB  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    8e-16   9%  3ddsA  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    1e-15  11%  1c8lA  [c.87.1] PROTEIN (GLYCOGEN PHOSPHORYLASE)
    2e-15   9%  2c4mB  [x.x.x] GLYCOGEN PHOSPHORYLASE
    4e-14  12%  3bjxB  [x.x.x] HALOCARBOXYLIC ACID DEHALOGENASE DEHI
    6e-14  10%  2c4mC  [x.x.x] GLYCOGEN PHOSPHORYLASE
    6e-14  13%  3cv3A  [x.x.x] GLUCURONOSYLTRANSFERASE GUMK
    1e-13   9%  1e4oA  [c.87.1] MALTODEXTRIN PHOSPHORYLASE
    6e-13  10%  3ddsB  [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
    2e-12  10%  1bx3A  [c.87.1] PROTEIN (GLYCOGEN PHOSPHORYLASE B)
    3e-12   9%  3bjxD  [x.x.x] HALOCARBOXYLIC ACID DEHALOGENASE DEHI
    7e-12  13%  3cuyA  [x.x.x] GLUCURONOSYLTRANSFERASE GUMK
    2e-11   8%  3d0rA  [x.x.x] PROTEIN CALG3
    5e-11  12%  2c9zA  [x.x.x] UDP GLUCOSE\:FLAVONOID 3-O-GLUCOSYLTRANSFERASE
    1e-10  12%  2c1zA  [x.x.x] UDP-GLUCOSE FLAVONOID 3-O GLYCOSYLTRANSFERASE
    1e-10  13%  1ahpA  [c.87.1] E.COLI MALTODEXTRIN PHOSPHORYLASE
    1e-10  13%  2ecpA  [c.87.1] MALTODEXTRIN PHOSPHORYLASE
    7e-10   9%  2c1xA  [x.x.x] UDP-GLUCOSE FLAVONOID 3-O GLYCOSYLTRANSFERASE
    1e-08   9%  3d0rB  [x.x.x] PROTEIN CALG3
    2e-05  13%  1bc9A  [x.x.x] CYTOHESIN-1
:347

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxRINMLSSSEKVAGQGVSGAYRELVRLLHRAAKDQLIVTENLPIEADVTHFHTIDFPYYLSTFQK
2bisA           -------------------------DGLIRKAVTFGRASVLLLNDLLREEPDVVHFHDWHTVFAGALIKK
3c4qB           ---------------------------------------------------DLIHSHYWLSGQVGWLLRD
3c48A           ---------------------------------------------------TYDLIHSHYWLSGQVGWLL
2acvA           ------------------------------------------------------QIEEVFDDSDRDHQLL
3c4qA           ---------------------------------------------------TYDLIHSHYWLSGQVGWLL
3d1jA           ---------------------------------------------------PWSFFNIHGLEFNGQISFL
3c48B           ---------------------------------------------------DLIHSHYWLSGQVGWLLRD
2bgtA           ------KIAIINMGNNVIKTVPSSETIYLFKVISEMGLNVDIISLKNGVSFDEVDVNDYDRLIVVNSKPN
1a8iA           ---------------------------------------------------SLVEEGAVKRINMAHLCIA
3e3lB           ------------------------------------------------INMAHLCIAGSHAVNGVARIHS
3e3oD           ---------------------------------------------------SLVEEGAVKRINMAHLCIA
3copA           ----------------------------------------------------VFTVHNLAYQGMFYAHHM
3e3nC           ---------------------------------------------------CIAGSHAVNGVARIHSEIL
3e3lD           ------------------------------------------------INMAHLCIAGSHAVNGVARIHS
3dd1B           ----------------------------------------------------IVGSHAVNGVAKIHSDIV
3cuvA           ----------------------------------------------------------------------
3beoA           --------------------IMKDRQTLIDITTRGLEGLDKVMKEAKP---DIVLVHGDTTTTFIASLAA
3e3oB           ------------------------------------------------------CIAGSHAVNGVARIHS
3e3oC           -------------------------VAAAFPGDVDRLRRMSLVEEGAV---KRINMAHLCIAGSHAVNGV
3e3lC           ------------------------------------------------INMAHLCIAGSHAVNGVARIHS
3e3nE           ----------------------------------------------------------------------
2atiA           ---------------------------------------------------CIVGSHAVNGVAKIHSDIV
3e3lA           ------------------------------------------------INMAHLCIAGSHAVNGVARIHS
2acvB           ------------------------------------------------------QIEEVFDDSDRDHQLL
3e3oA           ---------------------------------------------------AHLCIAGSHAVNGVARIHS
1e1yA           ------------------------------------------------INMAHLCIAGSHAVNGVARIHS
2bfwA           ----------------------------------------------------------------------
2bguA           ---------------------------------------------------DIISLKNGVYTKSFDEVDV
3dzcA           ---------------------------------------------------DVVLVHGDTATTFAASLAA
1c3jA           ---------------------------------------------------DIISLKNGVYTKSFDEVDV
2c4mA           ----------------------------------------------------------------------
3cehA           ------------------------------------------------------HAVNGVAKIHSDIVKT
1b4dA           -----------------------------------------IAGSHAVNGVARIHSEILKKTIFKDFYEL
3cejA           ------------------------------------------------------GSHAVNGVAKIHSDIV
3ddwB           ----------------------------------------------------------------------
3ddsA           ----------------------------------------------------------------------
1c8lA           ------------------------------------------------------IHSEILKKTIFKDFYE
2c4mB           ------------------------------------------------------AYSINGVAALHTEIIK
3bjxB           ----------------------------------------------------------------------
2c4mC           ----------------------------------------------------------------------
3cv3A           -------------------------EDAMFRWYAAHPPKQLLDWMR---ESDVIVFESGIAVAFIELAKR
1e4oA           ----------------------------------------------------------------------
3ddsB           ----------------------------------------------------------------------
1bx3A           ----------------------------------------------------------------------
3bjxD           ----------------------------------------------------------------------
3cuyA           -------------------------------------------------ESDVIVFESGIAVAFIELAKR
3d0rA           ----------------------------------------------------------------------
2c9zA           ----------------------------------------------------------------------
2c1zA           ----------------------------------------------------------------------
1ahpA           ----------------------------------------------------------------------
2ecpA           ----------------------------------------------------------------------
2c1xA           ----------------------------WLPFWTAGPNSLSTHVYIDEIREKIGVSG---IQGREDELLN
3d0rB           ----------------------------------------------------------------------
1bc9A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           KRSGRKIGYVHFLPATLEGSLKIPFFLKGIVKRYVFSFYNRMEHLVVVNPMFIEDLVAAGIPREKVTYIP
2bisA           YFKIPAVFTIHRLPAFYFHEAGLSELAPYPDIDPEHTGGYIADIVTTVSRGYLIDEWGFRNFEGKITYVF
3c4qB           LWRIPLIHTAHTLAAVSDTPESEAR------RICEQQLVDNADVLAVNTQEEMQDLMHHYADPDRISVVS
3c48A           RDL-WRIPLIHTAHTLAAVKNSYDTPESEARRICEQQLVDNADVLAVNTQEEMQDLMHHDADPDRISVVS
2acvA           NIPGISNVLPDACFNKDGGYIAYYKLAERFRDTKGIIVNTFSDLEQSSIDALYDHDEKIPIYAVGPLLDL
3c4qA           RDLWRIPLIHTAHTLAAVDTPESEAR-----RICEQQLVDNADVLAVNTQEEMQDLMHHYADPDRISVVS
3d1jA           KAGLYYADHITAV--SPTYAREITEPQFAYGMEGLLQQRHREGRLSGVLNGVDEKIWSPEDLLLASRYTR
3c48B           LWRIPLIHTAHTLAAV-------KTPESEARRICEQQLVDNADVLAVNTQEEMQDLMHHDADPDRISVVS
2bgtA           LA----ILSAQKFMAKYKSKIYYLFTDIRLPFSQEEELLIKSPIKVISQGINLDIAKAAVIEFEYFPIEQ
1a8iA           GSHAVNGSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLL
3e3lB           EILKKTIFKDFYEL--------EPHKFQNKTNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLL
3e3oD           GS--HAVNGVARIHSEILKKTIFKDFFQNKTNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLL
3copA           NDIQLPWSFNIHGLEFNGQISFLKAGLYYADHITAVSPTYAREITEPQFAYGMEGLLQQRHREGRLSGVL
3e3nC           KKTIFKYELEPHKFQNKTNGITPRRWLVLCNPGL-AEIIAERIGEEYISDLDQLRKLLSYVDDEAFIRDV
3e3lD           EILKKTIDFYELEPHKFQNKTNGITPRRWLVLCNPG-LAEIIAERIGEEYISDLDQLRKLLSYVDDEAFI
3dd1B           KTKVFKDFSELEPDKFQNKTNGITPRLLLCNPGLAELIAEKIGEDYVKDLSQLTKLHSFLGDDVFLRELA
3cuvA           -----------------------PHKFQNKTNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLL
3beoA           FYNQIPVGHVEA------GLRTWDKYSPYPEEMNRQLTGVMADLHFSPTAKSATNLQKENKDESRIFITG
3e3oB           EILKKTIFFYELEPHKFQNKTNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLSYVDDEAFIRD
3e3oC           ARIHSEILKKTIFKDFYE---LEPHKFQNKTNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLL
3e3lC           EILKKTFKDFYEL---------EPHKFQNKTNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLL
3e3nE           -----------------------PHKFQNKTNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLL
2atiA           KTKVFKDFSELEPDKFQNKTNGITPWLLLCNPGLAELIAEKIGEDYVKDLSQLTKLHSFLGDDVFLRELA
3e3lA           EILKKTKDFYELEPHKFQNKTNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYVDDEAFIR
2acvB           NIPGISQVPSNVLPDACFNKDGGYIAYYKLAERFRDTKGIIVDLEQSSIDALYDHDEKIPIYAVGPLLDL
3e3oA           EILKKTKDFYELEPHKFQNKTNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYVDDEAFIR
1e1yA           EILKKTFKDFYELEPHKFQNKTNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYVDDEAFI
2bfwA           ----------------------------------------------------------------------
2bguA           NDYDRLIVVNSNLAILSAQKFMAKYKSKIYYDIRLPFSQSEEELLIKSPIKVISQGINLDIAKAAHKKVD
3dzcA           YYQQIPV--GHVEAGLRTGNIYSPWPEEGNRKLT----AALTQYHFAPTDTSRANLLQENYNAENIFVTG
1c3jA           NDYDRLIVVNSN------LAILSAQKFMAKYKSKIYYLFTDIRLPFSQSAYLYTEEELLI--KSPIKVIS
2c4mA           -------------------------------NPGLSDLLTRLSGSDDWVTDLDELKKLRSYADDKSVLEE
3cehA           KVFKDFSELEPDKFQNKTNGITPRRWLLLCNPGLAELIAEKIGEDYVKDLSQLTKLHSFLGDDVFLRELA
1b4dA           EPHKFQNKTNGITP---------RRWLVLCNPGLAEIIAERIGEEYISDLDQLRKL--LSYVDDEAFIRD
3cejA           KTKVFKDFSELEPDKFQNKTNGITPRRWLLLCNPGLAELIAEKIGEDYVKDLSQLTKLHSFLGDDVFLRE
3ddwB           --------FSELEPDKFQNKTNGITPRRWLLLCNPGLAELIAEKIGEDYVKDLSQLTKLHSFLGDDVFLR
3ddsA           -----------------------PDKFQNKTNGITPRRWLLLCNPGLAELIAEKIGEDYVKDLSQLTKLH
1c8lA           LEPHKFQNKTNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYVDDEAFIRDVAKVKQENKL
2c4mB           AETLADWYALWPEKFNNKTNGVTPRRWLRMINPGLSDLLTRLSGSDDWVTDLDELKKLRSYADDKSVLEE
3bjxB           ----------------------------------------------------------------------
2c4mC           -------------------------------NPGLSDLLTRLSGSDDWVTDLDELKKLRSYADDKSVLEE
3cv3A           VNPAAKLVYRAS-------AGLSTINVASYIEREFDRVAPTLDVIALVSPAMAAEV----VSRDNVFHVG
1e4oA           -----------------------PNKFHNVTNGITPRRWIKQCNPALAALLDKSLQKEWANDLDQLINLE
3ddsB           ------------------------RWLLLCNPGLAELIAEKIGEDYVKDLSQLTKLHSFLGDDVFLRELA
1bx3A           ----HAVNGVARIHSEILKKTIFKDFFQNKTNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLL
3bjxD           --------------------------------------------------------------HHHSSGLV
3cuyA           VNPAAKLVYRAS-------AGLSTINVASYIEREFDRVAPTLDVIALVSPAMAAEVV----SRDNVFHVG
3d0rA           -------------------------------------------------------------FPPSLLLEA
2c9zA           --------------------------------HRMGQVLPKATAVFINSFEELDDSLTNDLKSKLKTYLN
2c1zA           --------------------------------HRMGQVLPKATAVFINSFEELDDSLTNDLKSKLKTYLN
1ahpA           --------------------------TNGITPRRWIKQCNPALAALLDKSLQKEWANDLDQLINLVKLAD
2ecpA           --------------------------TNGITPRRWIKQCNPALAALLDKSLQKEWANDLDQLINLVKLAD
2c1xA           FIPGMSKVRFRDLQEGIVFGNLNSLFSR--MLHRMGQVLPKATAVFINSFEELDDSLTNDLKSKLKTYLN
3d0rB           -------------------------------------LTDLMDKHQVSLPEPVATIESFPPSLLLEAEPE
1bc9A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           NFVNKEKWHPLPQEEVVRLRTDLGLSDNQFIVVGAGQVQKRKGIDDFIRLAEELPQITFIWAGGFSFGGM
2bisA           NGIDCSFWNESRDERKKSLLSKFGMDEGVTFMFIGRFDRGQKGVDVLLKAIEILSSKKEFQEMRFIIIGK
3c4qB           PGADVELYSPGNDRATERSRRELGIPLHTKVVAFVGRLQPFKGPQVLIKAVAALFDRDPDRNLRVIICGG
3c48A           PGADVELYSPGTERSRRELGIP----LHTKVVAFVGRLQPFKGPQVLIKAVAALFDRDPDRNLRVIICGG
2acvA           KGQPNPKLDQAQHDLILKWL--DEQPDKSVVFLCFGSMGVSFGPSQIREIALGLKHVRFLWSNS----AE
3c4qA           PGADVELYSPGNDRATERSRRELGIPLHTKVVAFVGRLQPFKGPQVLIKAVAALFDRDPDR--NLRVIIC
3d1jA           DTLEDKAENKRQLQI----AMGLKVDDKVPLFAVVSRLTSQKGLDLVLELLEQGGQLALLGAGD------
3c48B           PGADVELYSPGNDRATERSRRELGIPLHTKVVAFVGRLQPFKGPQVLIKAVAALFDRDPDRNLRV-IICG
2bgtA           YKIHMNDFQLSKPTK------------KTLDVIYGGSFRSGQRESKMVEFLFDTG-LNIEFFGN------
1a8iA           SYVDDEAFIRDVAKAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLPNKFVVPRTVMIGGKAAPGYH
3e3lB           SYVDDEAFIRDVAKVKLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLPNKFVVPRTVMIGGKAAPGYH
3e3oD           SYVDDEAFIRDVAKVKQEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKKEPNKMIGGKA
3copA           NGVDEKIWSPETDLLLAQIAMGLKVDDKVPLFAVVSRLTSQKGLDLVLELLEQGGQLALLGAGDPVL---
3e3nC           AKVKQENKLKFAAY--LEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLPNKFVVPRTVMIGGKMIIKLI
3e3lD           RDVAKVKQENKLKFAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCTLYNRIKKEPNKFVVPRTVGKA
3dd1B           KVKQENKLKFSQFLET---EYKVKINPSSMFDVQVKRIHEYKRQLLNCLHVITMVPRTVIIGGGYHMAKM
3cuvA           SYVDDEAFIRDVAKAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLVPRTVMIGGKAAIKLI
3beoA           NTAIDALKTTVKETY-SHPVLEKLGNNRLVLMTAHRRENLGEPMRNMFRLVDKHEDVQVVYPVH------
3e3oB           VAKVKQENKLKFAAYL-EREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLVPRTVMIGGKKMIIKL
3e3oC           SYVDDEAFIRDVAKAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLVPRTVMIGGKAAPGYH
3e3lC           SYVDDEAFIRDVAKVKLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLPNKFVVPRTVMIGGKAAPGYH
3e3nE           SYVDDEAFIRDVAKAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLPNKFVVPRTVMIGGKAAPGMI
2atiA           KVKQENKLKFSQFLE---TEYKVKINPSSMFDVQVKRIHEYKRQLLNCLHVITMVPRTVIIGGKAA----
3e3lA           DVAKVKQENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLPNKFVVPRTVMIGGKAAPGYH
2acvB           KGQPNPKLDQAQHDLILKWLDEQP--DKSVVFLCFGSMGVSFGPSQIREIALGLKHVRFLWSN----SAE
3e3oA           DVAKVKQENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLPNKFVVPRTVMIGGKAAPGYH
1e1yA           RDVAKVKQENKLKAAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLPNKFVVPRTVMIGGKAAPGMI
2bfwA           --IDCSFWNESYLTGSRSLLSKFGMDEGVTFMFIGRFDRGQKGVDVLLKAIEILSSKKEFQEMRFIIIGK
2bguA           NVIEFEYFPIEQYKIHMNDFQLSKPTKKTLDVIYGGSFRSGQRESKMVEFLFDTGLNIEFFGNA------
3dzcA           NTVIDALLAVREKITLESQFPMLDASKKLILVTGHRRESFGGGFERICQALITTAEQHPECQI------L
1c3jA           QGINLDIAKAAHKKVDNVIEFESKPTKKTLDVIYGGSFRSGQRESKMVEFLFDTGLNIEFFGNA------
2c4mA           LRAIKAANKQDFAEWI-LERQGIEIDPESIFDVQIKRLHEYKRQLMNALYVLDLPARTVIFG-----AKA
3cehA           KVKQENKLKFSQFLE---TEYKVKINPSSMFDVQVKRIHEYKRQLLNCLHVITMVPRTVIIGGKAAPGYH
1b4dA           VAKVKQENKLKFAAYL-EREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLVPRTVMIGGKAAPGIT
3cejA           LAKVKQENKLKFSQFL-ETEYKVKINPSSMFDVQVKRIHEYKRQLLNCLPKKLFVPRTVIIGGKAAPGYH
3ddwB           ELAKVKQENKLKFSQFLETEYKVKINPSSMFDVQVKRIHEYKRQLLNCLHVITMVPRTVIIGGKAAIIKL
3ddsA           SFLGDDVFLRELAKVKLETEYKVKINPSSMFDVQVKRIHEYKRQLLNCLPKKLFVPRTVIIGGKMIIKLI
1c8lA           KFAAYLEREY-----------KVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLVPRTVMIGGKAAPGYH
2c4mB           LRAIKAANKQDFAEWI-LERQGIEIDPESIFDVQIKRLHEYKRQLMNALYVLDLPARTVIFGAKAAPGYV
3bjxB           ---NPAYFPQLSQLDVESTYEDIRLTLRVPWVAFGCRVLATFPGYLPLAWRRSAEALITRYAEQA--ADE
2c4mC           LRAIKAANKQDFAEWI-LERQGIEIDPESIFDVQIKRLHEYKRQLMNALYVLDLPARTVIFGAK-----A
3cv3A           HGVDHNLDQLGDPSPYAEGIHAVAVGSMLFD------------PEFFVVASKAFPQVTFH----------
1e4oA           KFADDAKFRDQYREIKQKVRTGIEINPQAIFDIQIKRLHEYKRQHLNLLHIADRVPRVFLFGAGYYLAKN
3ddsB           KVKQENKLKFSQFLET---EYKVKINPSSMFDVQVKRIHEYKRQLLNCLHVITMYNRTVIIGGKIIKLIT
1bx3A           SYVDDEAFIRDVAKAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKKEPNKMIGGKA
3bjxD           PRGSHTNPAYFPQSGEESTYEDIRLTLRVPWVAFGCRVLATFPGYLAWRRSAEALITRYAEQA----ADE
3cuyA           HGVDHNLDQLGDPSPYAEGIHAVA----------------VGSMLFDPVASKAFPQVTFHV---------
3d0rA           EPEGWFMRWVPYGGGAVLGDRLPPVPARPEVAITMGTIELQAFGIGAVEAAGEVDA-DFVLALG---DLD
2c9zA           IGPFNLITGCLQWLKERK--------PTSVVYISFGTVTTPPPAE-VVALSEALPFIWSLRDK-------
2c1zA           IGPFNLITGCLQWLKERK--------PTSVVYISFGTVTTPPPAE-VVALSEALPFIWSLRDK-------
1ahpA           DAKFRDLYRVIKQAEFVKVRTGIDINPQAIFDIQIKRLHEYKRQHLILALYKEIRERVFLF-GAKAAPGY
2ecpA           DAKFRDLYRVIKQAEFVKVRTGIDINPQAIFDIQIKRLHEYKRQHLILALYKEIRERVFLF-GAKAAPGY
2c1xA           IGPFNLITGCLQWL--------KERKPTSVVYISFGTVTTPPPAE-VVALSEALRVPFIWSLRD------
3d0rB           GWFMRWVPYGGGAVLGDRLPPV---PARPEVAITMGTIELQAFGIGAVEPIIAAAGADFVLALG------
1bc9A           -----------------------------------KNMQRNKQVAMGRKKFNMDPKKGIQFLIENDLLKN


                         .         .         .         +         .         .         .:280
query           TDGYEHYKKIMENPPKNLIFPGIVSPERMRELYALADLFLLPSYNELFPMTILEAASCEAPIMLRDLDLY
2bisA           GDPELEGWARSLKHGNVKVITEMLSREFVRELYGSVDFVIIPSYFEPFGLVALEAMCLGAIPIASAVGGL
3c4qB           ---PYRHMAEELGVEKRIRFLDPRPPSELVAVYRAADIVAVPSFNESFGLVAMEAQASGTPVIAARVGGL
3c48A           PSDTYRHMAEELGVEKRIRFLDPRPPSELVAVYRAADIVAVPSFNESFGLVAMEAQASGTPVIAARGGLP
2acvA           KKVFPEGFLEWMELEGKGMICGWAPQV-----EVLAHKAIGGFVSHCGWNSILESMWFGVPILEQQLNAF
3c4qA           GGPTYRHMAEELGVEKRIRFLDPRPPSELVAVYRAADIVAVPSFNESFGLVAMEAQASGTPVIAARGGLP
3d1jA           PVLQEGFLAAAAEYPGQVGVQIGYHEAFSHRIMGGADVILVPSRFEPCGLTQLYGLKYGTLPLVRRTGGL
3c48B           GPSTYRHMAEELGVEKRIRFLDPRPPSELVAVYRAADIVAVPSFNESFGLVAMEAQASGTPVIAARVGGL
2bgtA           -AREKQFKNPKYPWTKAPVFTGKIPMNMVSEKNSQAIAALIIYNDNFITLRVWETMASDAVMLIDEEFTK
1a8iA           MAKMIIKLITAIGDVVNHDFLENYRVSLAEKVIPAADLSEQIAGTEASGTGNMFMLNGALTIGTMDGANV
3e3lB           MAGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPAADLSEQISTAEASGTGNMFMLNGALTIGTMDGANV
3e3oD           APGYHMAKMIIKGDRLRVIFLENYRVSLAEKVIPAADLSEQISTAEASGTGNMFMLNGALTIGTMDGANV
3copA           ---QEGFLAAAAEYPGQVGVQIGYHEAFSHRIMGGADVILVPSRFAPCGLTQLYGLKYGTLPTVSDCSLE
3e3nC           TAIGDVVNHDPVGDRLRVIFLENYRVSLAEKVIPAADLSEQISTTEASGTGNMFMLNGALTIGTMDGANV
3e3lD           APGYHMAKMIIVGDRLRVIFLENYRVSLAEKVIPAADLSEQISGTEASGTGNMFMLNGALTIGTMDGANV
3dd1B           IIKLITSVADVVNSKLKVIFLENYRVSLAEKVIPATDLSEQISGTEASGTGNMKFMLNGALTIGTMDGNV
3cuvA           TAIGDVVNHDPVGDRLRVIFLENYRVSLAEKVIPAADLSEQISTTEASGTGNMFMLNGALTIGTMDGANV
3beoA           ----MNPVVRETANDILGDYGRIHLIEPLDVIDFHNVAARSYLMLTDSGGVQEEAPSLGVPVLVLRDTTE
3e3oB           ITAIGDVVNHDPGDRLRVIFLENYRVSLAEKVIPAADLSEQIAGTEASGTGNMFMLNGALTIGTMDGANV
3e3oC           MAKMIIKHDPVVGDRLRVIFLENYRVSLAEKVIPAADLSEQIAGTEASGTGNMFMLNGALTIGTMDGANV
3e3lC           MAKMIIKLITAIGDVVNHDFLENYRVSLAEKVIPAADLSEQISTTEASGTGNMFMLNGALTIGTMDGANV
3e3nE           IKLITAIGDVVNGDRLRVIFLENYRVSLAEKVIPAADLSEQISTTEASGTGNMFMLNGALTIGTMDGANV
2atiA           -PGYHMAKMIIKLIKLKVIFLENYRVSLAEKVIPATDLSEQISTTEASGTGNMKFMLNGALIGTMDGANV
3e3lA           MAKMIIKLITAIGDVVNHDFLENYRVSLAEKVIPAADLSEQISGTEASGTGNMFMLNGALTIGTMDGANV
2acvB           KKVFPEGFLEWMELEGKGMICG-----WAPQVEVLAHKAIGGFVSHCGWNSILESMWFGVPILEQQLNAF
3e3oA           MAGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPAADLSEQISGTEASGTGNMFMLNGALTIGTMDGANV
1e1yA           IKLITAIGDVVNGDRLRVIFLENYRVSLAEKVIPAADLSEQIAGTEASGTGNMKFMLNGALTIGTMDGAN
2bfwA           GDPELEGWARSLKHGNVKVITEMLSREFVRELYGSVDFVIIPSYFEPFGLVALEAMCLGAIPIASAVGGL
2bguA           --REKQFKNPKYPWTKAPVFTGKIPMNMVSEKNSQAIAALIIYNDNFITLRVWETMASDAVMLIDEEFDT
3dzcA           YPVHLNPNVREPVNKLLKGVSNIVLIEPQQYLPFVYLMDRAHIILTDSGGIQEEAPSLGKPVLVMRETTE
1c3jA           --REKQFKNPKYPWTKAPVFTGKIPMNMVSEKNSQAIAALIIYNDNFITLRVWETMASDAVMLIDEEFTK
2c4mA           APGYVRAKAIIKSPLLKVVFVENYNVSPAEHILPASDVSEQIAGKEASGTSNMKFMMNGALTLGTMDGNV
3cehA           MAKMIIKLITSVADVVNNDFLENYRVSLAEKVIPATDLSEQISTAEASGTGNMKFMLNGALTIGTMDGNV
1b4dA           AIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPAADLSEQIAGTEASGTGNMKFMLNGALTMAEEAGEE
3cejA           MAKMIIKLITSVADVVNNDFLENYRVSLAEKVIPATDLSEQIAGTEASGTGNMKFMLNGALTIGTMDGNV
3ddwB           ITSVADVVNNDPGSKLKVIFLENYRVSLAEKVIPATDLSEQIAGTEASGTGNMKFMLNGALTIGTMDGNV
3ddsA           TSVADVVNNDPMGSKLKVIFLENYRVSLAEKVIPATDLSEQIAGTEASGTGNMKFMLNGALTIGTMDGNV
1c8lA           MAKMIIKLITAIGDVVNHDFLENYRVSLAEKVIPAADLSEQISTAEASGTGNMKFMLNGALTIGTMDGAN
2c4mB           -RAKAIIKLINSSPLLKVVFVENYNVSPAEHILPASDVSEQISTAGKSGTSNMKFMMNGALTLGTMDGAN
3bjxB           LRERSLLNIGPLPNLKERLYAAGFDDGEIEKVRRVLYAFNYGNPKYLLLITALSE---------------
2c4mC           APGYVRAKAIIKLILLKVVFVENYNVSPAEHILPASDVSEQIAGKEASGTSNMKFMMNGALTLGTMDGAN
3cv3A           --VIGSGMGRHPGYGDNVIVYGEMKHAQTIGYIKHARFGIAPYASEQVPVYLADSSMKLLQYDFFG-LPA
1e4oA           IIFAINKVADVINDKLKVVFLPDYCVSAAEKLIPAADISEQIAGKEASGTGNMKLALNGALTVGTLDGAN
3ddsB           SVADVVNNDPMVGSKLKVIFLENYRVSLAEKVIPATDLSEQISTTEASGTGNMKFMLNGALTIGTMDGNV
1bx3A           APGYHMAKMIIKGDRLRVIFLENYRVSLAEKVIPAADLSEQIAGTEASGTGNMKFMLNGALTIGTMDGAN
3bjxD           LRERSLLNIGPLPNLKERLYAAGFDDGEIEKVRRVLYAFNYGNP---KYLLLITALSE------------
3cuyA           ---IGSGMGRHPGYGDNVIVYGEMKHAQTIGYIKHARFGIAPYASEQVPVYLADSSMKLLQYDFFGL-PA
3d0rA           ISPLGTLPR-------NVRAVGWTP---LHTLLRTCTAVVHHGGGG----TVMTAIDAGIPQLLAPDFQH
2c9zA           -ARVHLPEGFLEKTRGYGMVVPWAPQA-----EVLAHEAVGAFVTHCGWNSLWESVAGGVPLIDQRLNGR
2c1zA           -ARVHLPEGFLEKTRGYGMVVPWAPQA-----EVLAHEAVGAFVTHCGWNSLWESVAGGVPLICQRLNGR
1ahpA           YLAKNIIFAINKVAKLKVVFLPDYCVSAAEKLIPAADISEQISGKEASGTGNMKLALNGALTVGTLVEIA
2ecpA           YLAKNIIFAINKVAKLKVVFLPDYCVSAAEKLIPAADISEQISGKEASGTGNMKLALNGALTVGTLVEIA
2c1xA           KARVHLPEGFLEKTRGYGMVVPWAPQA-----EVLAHEAVGAFVTHCGWNSLWESVAGGVPLIDQRLNGR
3d0rB           ----DLDISPLGTLPRNVRAVGWTP---LHTLLRTCTAVVHHGGGG----TVMTAIDAGIPQLLQFQHTA
1bc9A           TC-EDIAQFLYKGEGLNKTAIGDYLGER--DEFNIQVLHAFVELHEFTDLNLVQA---------------


                         .         *         .         .         .         .         +:350
query           KVILEGNYRATAGREEMKEAILEYQANPAVLKDLKEKAKNISREYSEEHLLQIWLDFYEKQAALGRK
2bisA           RDIITGILVKAGDPGELANAILKALELSRSDLSFRENCKKRAMSFSWEKSAERYVKAYTG-------
3c4qB           PIAVAEGLLVDGHSPHAADALATLLDDDETRIRMGEDAVEHARTFSWAATAAQLSSLYND--AIANE
3c48A           IAVAEGELLVDGHSPHAADALATLLDDDETRIRMGEDAVEHARTFSWAATAAQLSSLYND--AIANE
2acvA           RLVKEWKGSDVVAAEEIEKGLKDLMDKDSIVHKKVQEMKEMSRNAVVDGGSLISVGKLID-------
3c4qA           IAVAEGELLVDGHSPHAADALATLLDDDETRIRMGEDAVEHARTFSWAATAAQLSSLYND--AIANE
3d1jA           ADTVSGFVFEDSNAWSLLRAIRRAFVLWSRPSLWRFVQRQMAMDFSWQVAAKSYRELYYR-------
3c48B           PAEGETGLLVDGHSPHAADALATLLDDDETRIRMGEDAVEHARTFSWAATAAQLSSLYND--AIANE
2bgtA           HRIINDARFYVNNRAELIDRVNELKHSDVLRKEMLSIQDILNKTRAKKAEWQDAFKKAID-------
1a8iA           EMAEEAGEENFFIFDRLDQRGYNAQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNM-------
3e3lB           EMAEEAGEENFFIVDRLDQRGYNAQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNM-------
3e3oD           EMAEEAGEENFFIFDRLDQRGYNAQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNM-------
3copA           NLADGVAVFEDSNAWSLLRAIRRAFVLWSRPSLWRFVQRQMAMDFSWQVAAKSYRELYYR-------
3e3nC           EMAEEAGEENFFIVDRLDQRGYNAQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNM-------
3e3lD           EMAEEAGEENFFIFDRLDQRGYNAQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNM-------
3dd1B           EMAEEAGEENLFIVAALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINM-------
3cuvA           EMAEEAGEENFFIFDRLDQRGYNAQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNM-------
3beoA           RPEGITLKLAGTDEETIFSLADELLSDKEAHDKMSKASNPYGDGRASERIVEAILKHFNK-------
3e3oB           EMAEEAGEENFFIFDRLDQRGYNAQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNM-------
3e3oC           EMAEEAGEENFFIFDRLDQRGYNAQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNM-------
3e3lC           EMAEEAGEENFFIFDRLDQRGYNAQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNM-------
3e3nE           EMAEEAGEENFFIFDRLDQRGYNAQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNM-------
2atiA           EMAEEAGEENLFIFAALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINM-------
3e3lA           EMAEEAGEENFFIFDRLDQRGYNAQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNM-------
2acvB           RLVKEWKGSDVVAAEEIEKGLKDLMDKDSIVHKKVQEMKEMSRNVDGGSSLISVGKLIDD-------
3e3oA           EMAEEAGEENFFIFDRLDQRGYNAQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNM-------
1e1yA           VEMAEEAGEENFFIDRLDQRGYNAQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMHHDRF
2bfwA           RDIITGILVKAGDPGELANAILKLELSRSDLSKFRENCKKRAMSFS---------------------
2bguA           KRIINDARFYVNNRAELIDRVNELKHSDVLRKEMLSIQKTRAKKAEWQDAFKKAIDL----------
3dzcA           RPEAVTVKLVGTNQQQICDALSLLLTDPQAYQAMSQAH----NPYGDGKACQRIADILAK-------
1c3jA           HRIINDARFYVNNRAELIDRVNELKHSDVLRKEMLSIQKTRAKKAEWQDAFKKAID-----------
2c4mA           EIVDSVGEENARVEELPALRESYKPYELYETVPGLKRADALDNGTLNDNNSGLFYDLKHS-------
3cehA           EMAEEAGEENLFIFAALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINM-------
1b4dA           NFFIFGMRVEDV--DRLDQRGYNAQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIV---------
3cejA           EMAEEAGEENLFIFAALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINM-------
3ddwB           EMAEEAGEENLFIFAALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINM-------
3ddsA           EMAEEAGEENLFIFAALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINM-------
1c8lA           VEMAEEAGEENFFIDRLDQRGYNAQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMHHDRF
2c4mB           VEIVDAYIFGARVEELPALRESYKPYELYETVPGLKRALALDNGTLNDNNSGLFYDLKH--------
3bjxB           -------------------------------------------------------------------
2c4mC           VEIVDAYIFGARVEELPALRESYKPYELYETVPGLKRADALDNGTLNDNNSGLFYDLKHS-------
3cv3A           VCPNAVVGPYKSRFDSVIAAITQALEAPRVRYRQCLNWSDTDRVLDPRAYPETRL------------
1e4oA           VEIAEIFIFGHTVEQVKAILAKGYDPKWRKKDKVLDAVKELESGKYSDGDKHAFDQMLHS-------
3ddsB           EMAEEAGEENLFIFAALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINM-------
1bx3A           VEMAEEAGEENFFIDRLDQRGYNAQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMHHDRF
3bjxD           -------------------------------------------------------------------
3cuyA           VCPNAVVGPYKSRFDSVIAAITQALEAPRVRYRQCLNWSDTDRVLDPRAYPETRL------------
3d0rA           TAREAGIGLVSTSDKVDADLLRRLIGDESLRTAAREVREEMVALPTPAETVRRIVERI---------
2c9zA           MVEDVLIEGGVFTKSGLMSCFDKGKKLRENLRALRETADRVGPKGSSTENFITLVDLVSK-------
2c1zA           MVEDVLIEGGVFTKSGLMSCFDKGKKLRENLRALRETADRVGPKGSSTENFITLVDLVSK-------
1ahpA           EKVGEENIFIFGHTVKILAKGYDPVKWRKKDKVLDAVLKELESGKYSDGDKHAFDQ-----------
2ecpA           EKVGEENIFIFGHTVKILAKGYDPVKWRKKDKVLDAVLKELESGKYSDGDKHAFDQ-----------
2c1xA           MVEDVLIEGGVFTKSGLMSCFDQILSQEKGLRALRETARAVGPKGSSTENFITLVDLVSK-------
3d0rB           REAVSRRGLVSTSDKVDADLLRRLIGDESLRTAAREVREEMVALPTPAETVRRIVER----------
1bc9A           -------------------------------------------------------------------