[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for spne4:ACF55561.1

[Show Plain Result]

#ERROR : Can't open dsspfile "5crxA.bssp"
#ERROR : Can't open dsspfile "3crxA.bssp"
#ERROR : Can't open dsspfile "2a3vA.bssp"
#ERROR : Can't open dsspfile "2crxA.bssp"
#ERROR : Can't open dsspfile "3c28B.bssp"
#ERROR : Can't open dsspfile "5crxB.bssp"
#ERROR : Can't open dsspfile "1drgA.bssp"
#ERROR : Can't open dsspfile "2a3vB.bssp"
#ERROR : Can't open dsspfile "1a0pA.bssp"
#ERROR : Can't open dsspfile "1crxA.bssp"
#ERROR : Can't open dsspfile "1ae9A.bssp"
#ERROR : Can't open dsspfile "2a3vC.bssp"
#ERROR : Can't open dsspfile "2crxB.bssp"
#ERROR : Can't open dsspfile "3c28A.bssp"
#ERROR : Can't open dsspfile "1ae9B.bssp"
#ERROR : Can't open dsspfile "1aihB.bssp"
#ERROR : Can't open dsspfile "1aihA.bssp"
#ERROR : Can't open dsspfile "3cz6A.bssp"
#ERROR : Can't open dsspfile "2b9bC.bssp"

## Summary of PDB Search
:321
    6e-25  13%  5crxA  [a.60.9 - d.163.1] PROTEIN (BACTERIOPHAGE P1 CRE GENE)
    1e-24  12%  3crxA  [a.60.9 - d.163.1] CRE RECOMBINASE
    2e-24  20%  2a3vA  [x.x.x] SITE-SPECIFIC RECOMBINASE INTI4
    9e-24  12%  2crxA  [a.60.9 - d.163.1] PROTEIN (CRE RECOMBINASE)
    1e-23  12%  3c28B  [x.x.x] RECOMBINASE CRE
    5e-23  13%  5crxB  [a.60.9 - d.163.1] PROTEIN (BACTERIOPHAGE P1 CRE GENE)
    6e-23  12%  1drgA  [a.60.9 - d.163.1] CRE RECOMBINASE
    1e-22  19%  2a3vB  [x.x.x] SITE-SPECIFIC RECOMBINASE INTI4
    4e-22  26%  1a0pA  [x.x.x] SITE-SPECIFIC RECOMBINASE XERD
    8e-22  12%  1crxA  [a.60.9 - d.163.1] CRE RECOMBINASE
    2e-21  16%  1ae9A  [d.163.1] LAMBDA INTEGRASE
    7e-21  19%  2a3vC  [x.x.x] SITE-SPECIFIC RECOMBINASE INTI4
    9e-21  13%  2crxB  [a.60.9 - d.163.1] PROTEIN (CRE RECOMBINASE)
    8e-20  12%  3c28A  [x.x.x] RECOMBINASE CRE
    8e-16  17%  1ae9B  [d.163.1] LAMBDA INTEGRASE
    1e-15  21%  1aihB  [d.163.1] HP1 INTEGRASE
    1e-14  18%  1aihA  [d.163.1] HP1 INTEGRASE
    2e-10  10%  3cz6A  [x.x.x] DNA-BINDING PROTEIN RAP1
    7e-04  18%  2b9bC  [x.x.x] FUSION GLYCOPROTEIN F0
:321

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLVDGKKQQKYSNNNLLQLFITAKQVEGCSSKTIRYYQRT
5crxA           ---------------------------------------------VRKNLMDMFRDRAFSEHTWKMLLSV
3crxA           ---------------------------------------------VRKNLMDMFRDRAFSEHTWKMLLSV
2a3vA           ---------------------------------------------FLLSVREFMQTRYYAKKTIEAYLHW
2crxA           ---------------------------------------------VRKNLMDMFRDRAFSEHTWKMLLSV
3c28B           ------------------------------------------SDEVRKNLMDMFRDRAFSEHTWKMLLSV
5crxB           ---------------------------------------------VRKNLMDMFRDRAFSEHTWKMLLSV
1drgA           -------------------------------------------DEVRKNLMDMFRDRAFSEHTWKMLLSV
2a3vB           ------------------------------------------GSQFLLSVREFMQTRYYAKKTIEAYLHW
1a0pA           ------------------------------------------DLARIEQFLDALWLENLAENTLNAYRRD
1crxA           ------------------------------------------SDEVRKNLMDMFRDRAFSEHTWKMLLSV
1ae9A           ----------------------------------------------------------------------
2a3vC           ------------------------------------------GSQFLLSVREFMQTRYYAKKTIEAYLHW
2crxB           ---------------------------------------------VRKNLMDMFRDRAFSEHTWKMLLSV
3c28A           ------------------------------------------SDEVRKNLMDMFRDRAFSEHTWKMLLSV
1ae9B           ----------------------------------------------------------------------
1aihB           ----------------------------------------------------------------------
1aihA           ----------------------------------------------------------------------
3cz6A           ----------------------------------------------------------------------
2b9bC           -------------------------------IPTNVRQLMYYTEASSAFIVVDSPISGCNITSISSYNAT


                         .         .         *         .         .         .         .:140
query           IENLFNAIKESVTQLTTDDLRSYLANYQSEKDCSKANLDNIRRILSSFFAWLEQEEYXXXXXXXXXXXXX
5crxA           CRSWAAWCKLKWFPAEPEDVRDYLL-YLQARGLAVKTIQQHLGQLNMLHRRSGLPRPSDSNAVSLVMRRI
3crxA           CRSWAAWCKLKWFPAEPEDVRDYLLYLQ-ARGLAVKTIQQHLGQLNMLHRRSGLPRPSDSNAVSLVMRRI
2a3vA           ITRYIHFHNKHPSLMGDKEVEEFLTYLAVQGKVATKTQSLALNSLSFLYKEILKTPLSLEIRFQRSQLER
2crxA           CRSWAAWCKLKWFPAEPEDVRDYLLYLQ-ARGLAVKTIQQHLGQLNMLHRRSGLPRPSDSNAVSLVMRRI
3c28B           CRSWAAWCKLKWFPAEPEDVRDYLL-YLQARGLAVKTIQQHLGQLNMLHRRSGLPRPSDSNAVSLVMRRI
5crxB           CRSWAAWCKLKWFPAEPEDVRDYLLYLQ-ARGLAVKTIQQHLGQLNMLHRRSGLPRPSDSNAVSLVMRRI
1drgA           CRSWAAWCKLKWFPAEPEDVRDYLL-YLQARGLAVKTIQQHLGQLNMLHRRSGLPRPSDSNAVSLVMRRI
2a3vB           ITRYIHFHNKHPSLMGDKEVEEFLTYLAVQGKVATKTQSLALNSLSFLYKEILKTPLSLEIRFQRSQ---
1a0pA           LSMMVEWLHHR----GLTLATAQSDDLQAERLSSARLLSAVRRL----FQYLYREKFREDDPSAHLKDL-
1crxA           CRSWAAWCKLKWFPAEPEDVRDYLLYLQARG-LAVKTIQQHLGQLNMLHRRSGLPRPSDSNAVSLVMRRI
1ae9A           ----------------------------------------------------------------------
2a3vC           ITRYIHFHNKHPSLMGDKEVEEFLTYLAVQGKVATKTQSLALNSLSFLYKEILKTPLSLEIRFQRSQLER
2crxB           CRSWAAWCKLKWFPAEPEDVRDYLLYLQ-ARGLAVKTIQQHLGQLNMLHRRSGLPRPSDSNAVSLVMRRI
3c28A           CRSWAAWCKLKWFPAEPEDVRDYLLYLQ-ARGLAVKTIQQHLGQLNMLHRRSGLPRPSDSNAVSLVMRRI
1ae9B           ----------------------------------------------------------------------
1aihB           ----------------------------------------------------------------------
1aihA           ----------------------------------------------------------------------
3cz6A           ----------------------------------------------------------------------
2b9bC           VTKLLQPIGENLETIRNQ----------------------------------------------------


                         +         .         .         .         .         *         .:210
query           TEQNVKETYTDEHLEIMRDNCENLRDLAIIDLLASTGMRVGELVQLNRSDIDFENRECVVFGKGKKERPV
5crxA           RKENVDAGERAKQALAFEDRCQDIRNLAFLGIAYNTLLRIAEIARIRVKDISRTDGGRMEKALSLGVTKL
3crxA           RKENVDAGERAKQALAFEDRCQDIRNLAFLGIAYNTLLKIAEIARIRVKDISRTDGGRMLIHVSTAGVEK
2a3vA           KLPVVLTRDEIRRL----LEIVDPKHQLPIKLLYGSGLRLMECMRLRVQDIDFDYGARIWQGKGGKNRTV
2crxA           RKENVDAGERAKQALAFSDRCQDIRNLAFLGIAYNTLLRIAEIARIRVKDISRTDGGRMLIHIGEKALSL
3c28B           RKENVDAGERAKQALAFERRCQDIRNLAFLGIAYNTLLRIAEIARIRVKDISRTDGGRMLTLVSTAGVEK
5crxB           RKENVDAGERAKQALAFSDRCQDIRNLAFLGIAYNTLLRIAEIARIRVKDISRTDGGRMLIHVSTAGVEK
1drgA           RKENVDAGERAKQALAFSDRCQDIRNLAFLGIAYNTLLRIAEIARIRVKDISRTDGGRMIHIGVEKALSL
2a3vB           -LERKLPVVLTRDEIRRLLEIVDPKHQLPIKLLYGSGLRLMECMRLRVQDIDFDYGARIWQGKGGKNRTV
1a0pA           SEAQVERLLQA----PLIDQPLELRDKAMLEVLYATGLRVSELVGLTMSDISLRQGVVRVIGKGNKERLV
1crxA           RKENVDAGERAKQALAFSDRCQDIRNLAFLGIAYNTLLRIAEIARIRVKDISRTDGGRMLIHVSTAGVEK
1ae9A           -----RSRLTADEYLKIYQAAEPCWLRLAMELAVVTGQRVGDLCEMKWSDIVDGYLYVEQ-SKTGVKIAI
2a3vC           KLPVVLTRDEIRRLLEIVD----PKHQLPIKLLYGSGLRLMECMRLRVQDIDFDYGARIWQGKGGKNRTV
2crxB           RKENVDAGERAKQALAFEDRCQDIRNLAFLGIAYNTLLRIAEIARIRVKDISRTDGGLIHIGAGVEKALS
3c28A           RKENVDAGERAKQALAFEDRCQDIRNLAFLGIAYNTLLRIAEIARIRVKDIMLIHALSLGVTKLVERWVS
1ae9B           -----RSRLTADEYLKIYQAAEPCWLRLAMELAVVTGQRVGDLCEMKWSDIVDGYL-YVEQSKTGVKIAI
1aihB           ---------YERDIYRLLAECDNPDLGLIVRICLATGARWSEAETLTQSQVMPYKITFTN-TKSKKNRTV
1aihA           --------LYERDIYRLLAECDNPDLGLIVRICLATGARWSEAETLTQSQVMPYKITFTNTKSKKNRTVP
3cz6A           -----------------------------------------------RSDFSNE----DIYDNIDPDTIS
2b9bC           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           YFDARTKIHLRNYLNDRKDSHPALFVTLVGKAQRLGIAGVEIRLRKLGDKLGIQKVHPHKFRRTLATKAI
5crxA           VERWISVSGVFCRVRKNGVAAPSATSQLSTRALEGIFEATHRLIYGAKDDSGQLAWSGHSARVGAARDMA
3crxA           ALSLGVTNYLFCRVRKNGVAAPSATSQLSTRALEGIFEATHRLIYGAKDDSGQRAWSGHSARVGAARDMA
2a3vA           TLAKELYPHLKEQIALAKRRWHYLFPSFQLRRHHMNETVLQKAVRRSAQEAGIKTVTCHTLRHSFATHLL
2crxA           GVTKLVERWISVSGVADDPNVRKNGVAAPSATSQLSTRALEGIFEATHRLIYGAAWSGHSARVGAARDMA
3c28B           ALSLGVTKLVERWISVSGVAAPSATSQLSTRALEGIFEATHRLIYGAKDDSGQRYWSGHSARVGAARDMA
5crxB           ALSLGVTKLVERWIRKNGVAAPSATSQLSTRALEGIFEATHRLIYGAKDDSGYLAWSGHSARVGAARDMA
1drgA           GVTKLVERWISVSGVADGVAAPSATSQLSTRALEGIFEATHRLIYGAKDDSGQRAWSGHSARVGAARDMA
2a3vB           TLAKELYPHLKEQIALAKFQLSLDPESDVMRRHHMNETVLQKAVRRSAQEAGIEKVTCHTLRHSFATHLL
1a0pA           PLGEEAVYWLETYLEHLLNGVSIDVLFPSQRAQQMTRQTFWHRIKHYAVLAGIEKLSPHVLRHAFATHLL
1crxA           ALSLGVTKLVERWISVSGVADDPNNSQLSTRALEGIFEATHRLIYGAKDDSGQLAWSGHSARVGAARDMA
1ae9A           PTALHIDALGISMKETLDEILGGETIIASTRREPLSSGTVSRYFMRARKASGLSFPPTFHELRSLSARLY
2a3vC           TLAKETALKEKYPNAPYEFRWHYLFPSFQLRRHHMNETVLQKAVRRSAQEAGIEKVTCHTLRHSFATHLL
2crxB           LGVTKLVERWISVSGVAGVAAPSATSQLSTRALEGIFEATHRLIYGAKDDSGQRAWSGHSARVGAARDMA
3c28A           GVADDPNNYLFCRVRKNGVAAPSATSQLSTRALEGIFEATHRLIYGAKDDGQRYLAWSGHSARGAARDMA
1ae9B           PTALHIDALGISMLDKCKEILGGETIIASTRREPLSSGTVSRYFMRARKASGLSFEGDPHELRSLSARLY
1aihB           PISDELFDMLPKKRGRLFNDAYESFENAVLRAE----------------IELPKGQLTHVLRHTFASHFM
1aihA           ISDELFDMLPKKRGRLFNDAYESFENAVLRAEIELPK-----------------GQLTHVLRHTFASHFM
3cz6A           FPPKIATTDLFLPLFFHFGS---------TRQFDKLHEVISGDYEPSQAEKLVDLCDETGIRKNFSTSIL
2b9bC           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           DKGMPIEQVQKLLGHSKIDTTLAYAMVNQNNVKHSHQKFxx
5crxA           RAGVSIPEIMQAGGWTRNLDSETGAMVRL------------
3crxA           RAGVSIPEIMQAGGWTNVNIVMNYIRNLDSETGAMVRLL--
2a3vA           EVGADIRTVQEQLGHTDVKTTQIYTHSGV------------
2crxA           RAGVSIPEIMQAGGWTNVNIVMNYIRNLDSETGAMVRLL--
3c28B           RAGVSIPEIMQAGGWTNVNIVMNYIRGMVRLLE--------
5crxB           RAGVSIPEIMQAGG---------------------------
1drgA           RAGVSIPEIMQAGGWTNVNIVMNFIRNLDSETGAMVRLL--
2a3vB           EVGADIRTVQEQLGHTDVKTTQIYTHVLDRGASGVLSPL--
1a0pA           NHGADLRVVQMLLSDL--STTQIYTHVATERLRQLHQ----
1crxA           RAGVSIPEIMQAGGWTNVNIVMNYIRNLDSETGAMVRLL--
1ae9A           EKQISDKFAQHLLGHFRDDRGREWD----------------
2a3vC           EVGADIRTVQEQLGHTDVKTTQIYTHRGASGVLSPLSRL--
2crxB           RAGVSIPEIMQAGGWTNVNIVMNYIRGAMVRLL--------
3c28A           RAGVSIPEIMQAGGWTNVNIVMNYIRNLDSETGAMVRLL--
1ae9B           EKQISDKFAQHLLGHKWDKIEI-------------------
1aihB           MNGGNILVLKEILGHSTIEMTMRYAHFAPSHLESAVKF---
1aihA           MNGGNILVLKEILGHSTIEMTMRYAHFAPSHLESAVKF---
3cz6A           CLSGDLVFPRYFLNFKDNVNPPPN-----------------
2b9bC           -----------------------------------------